Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03850g8.841ON32932917600.0
Kwal_27.102558.841ON32932915240.0
YPL273W (SAM4)8.841ON32532613320.0
NCAS0D049408.841ON32732713310.0
Suva_13.515na 1ON32532613080.0
SAKL0D01452g8.841ON32732713020.0
KAFR0B00210singletonON32632512980.0
NDAI0F00250singletonON32932712831e-178
Smik_6.4848.841ON32532612771e-178
Ecym_46128.841ON32632812661e-176
TPHA0G03760singletonON33132312501e-173
KNAG0B06970singletonON33231612491e-173
KLLA0D01551g8.841ON33132412421e-172
TDEL0E05690singletonON32832611991e-166
Suva_16.17singletonON32432611551e-159
Suva_64.1singletonON27327511211e-155
TDEL0E00240singletonON32832611151e-153
Skud_12.4na 2ON32532611141e-153
Smik_12.1na 2ON32432610971e-150
YLL062C (MHT1)na 2ON32432610721e-146
ABL125W8.841ON33632610371e-141
Suva_16.328.841ON25924810181e-139
KAFR0F04420singletonON32632610061e-136
KAFR0L00150singletonON3263259941e-135
TBLA0B032608.841ON3263238941e-119
TPHA0I002608.841ON3233228901e-119
Kpol_1068.78.841ON3233258851e-118
Skud_101.1singletonON2002008501e-115
Skud_100.1singletonON2002008411e-113
ZYRO0G14212g8.841ON3253168331e-110
SAKL0D09306gna 3ON3263387333e-95
Kwal_0.322na 3ON3323386231e-78
KLTH0H12716gna 3ON3483406069e-76
AFR410WsingletonON3703315983e-74
YMR321Cna 1ON1051013961e-47
Skud_47.2singletonON96973561e-41
KNAG0A073103.372ON67976712.4
TPHA0O006301.386ON59450712.5
CAGL0B02387g8.850ON47146702.8
NCAS0A088101.386ON58661693.8
Ecym_45145.443ON124692685.8
NCAS0I017503.247ON560123676.6
Suva_2.6583.102ON63948678.3
ZYRO0A00924g8.857ON43968668.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03850g
         (329 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   682   0.0  
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   591   0.0  
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   517   0.0  
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               517   0.0  
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   508   0.0  
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   506   0.0  
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       504   0.0  
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       498   e-178
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   496   e-178
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   492   e-176
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     486   e-173
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             485   e-173
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   483   e-172
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   466   e-166
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   449   e-159
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        436   e-155
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       434   e-153
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   433   e-153
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   427   e-150
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   417   e-146
ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   404   e-141
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   396   e-139
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               392   e-136
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      387   e-135
TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   348   e-119
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   347   e-119
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   345   e-118
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   332   e-115
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   328   e-113
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   325   e-110
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   286   3e-95
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   244   1e-78
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   238   9e-76
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   234   3e-74
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...   157   1e-47
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      141   1e-41
KNAG0A07310 Chr1 complement(1141818..1143857) [2040 bp, 679 aa] ...    32   2.4  
TPHA0O00630 Chr15 complement(115953..117737) [1785 bp, 594 aa] {...    32   2.5  
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...    32   2.8  
NCAS0A08810 Chr1 (1741889..1743649) [1761 bp, 586 aa] {ON} Anc_1...    31   3.8  
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    31   5.8  
NCAS0I01750 Chr9 (323547..325229) [1683 bp, 560 aa] {ON} Anc_3.2...    30   6.6  
Suva_2.658 Chr2 (1174694..1176613) [1920 bp, 639 aa] {ON} YDR484...    30   8.3  
ZYRO0A00924g Chr1 complement(66827..68146) [1320 bp, 439 aa] {ON...    30   8.5  

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/329 (100%), Positives = 329/329 (100%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD
Sbjct: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD
Sbjct: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI
Sbjct: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN
Sbjct: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS
Sbjct: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300

Query: 301 GARIIGGCCRTSPKDIAAINAAVNKYRPN 329
           GARIIGGCCRTSPKDIAAINAAVNKYRPN
Sbjct: 301 GARIIGGCCRTSPKDIAAINAAVNKYRPN 329

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/329 (83%), Positives = 304/329 (92%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R S+KE+L  NP EVLVLDGGQGTELENRGIKVANPVWSTIPFIS+SFW+A D SSKD
Sbjct: 1   MVRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKD 60

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           RQIVKEMY DFLKAGARVLMTVTYQASFKSVSENT I TLEEYD+LL+RIV+FSR CIGD
Sbjct: 61  RQIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGD 120

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           DK+LVGCIG WGAHNCSEFTGDYG+EPEKID+LQYFKPQLDNFT N+++DLIGFETIPNI
Sbjct: 121 DKFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNI 180

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HELRAILSWD +I+ KPFYIGLSVHE+G+LRDGTTMH+VAELIKS GD++NPNF LLGIN
Sbjct: 181 HELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGIN 240

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           CVSYN S +ILRSLH+E+PE+PLIAYPNSGEVYDTVKKIWNPK   TL+W+Q+VKSYIDS
Sbjct: 241 CVSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDS 300

Query: 301 GARIIGGCCRTSPKDIAAINAAVNKYRPN 329
           GARIIGGCCRTSPKDI AI+ AV KYRPN
Sbjct: 301 GARIIGGCCRTSPKDIEAIHEAVQKYRPN 329

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/326 (74%), Positives = 277/326 (84%), Gaps = 2/326 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R  +K++LA NP++VLVLDGGQGTELENRGIKVANPVWSTIPFIS+SFW+  D SS +
Sbjct: 1   MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS--DESSAN 58

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R+IVKEM+ DFL AGA +LMT TYQ S+KSVSENT I TL EY+ LL+RIV FSR+CIG+
Sbjct: 59  RKIVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGE 118

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           DK+L+GCIGPWGAH C EFTGDYG+EPE ID+ QYFKPQL+NF  ND LDLIGFETIPNI
Sbjct: 119 DKYLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNI 178

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HEL+AILSWD +IL +PFYIGLSVHEHGVLRDGTTM E+A++IK LGDKINPNF  LGIN
Sbjct: 179 HELKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGIN 238

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           CVS+N SP+IL SLHQ +P + L+AYPNSGEVYDT KKIW P  D   +WD VVK YI S
Sbjct: 239 CVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISS 298

Query: 301 GARIIGGCCRTSPKDIAAINAAVNKY 326
           GARIIGGCCRTSPKDI  I+AAV KY
Sbjct: 299 GARIIGGCCRTSPKDIQEISAAVKKY 324

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/327 (72%), Positives = 282/327 (86%), Gaps = 3/327 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R S+KEYL  NP++VLVLDGGQGTELENRGI VANPVWSTIPF+S+SFW+  D SS D
Sbjct: 1   MTRQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWS--DKSSND 58

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           RQIVKEM+EDFL AGA +LMT TYQ SFKSVSENT I TL+EY+ LL+RIVSFSR CIG+
Sbjct: 59  RQIVKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGE 118

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
            K+L+GCIGPWGAH C+EF GDYG+ PE IDY QYFKPQLDNF  N++LDLIGFET+PN+
Sbjct: 119 QKYLIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNV 178

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           +EL+AILSWD  IL KPFYIGLSVHE+GVLRDGTTM E+  + KSLG+K+NPN +LLGIN
Sbjct: 179 NELKAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGIN 238

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPK-GDHTLTWDQVVKSYID 299
           CVS+NHSP IL  +H+ +P++PLIAYPNSGEVYDTVKKIW P+  +++LTW+QVVK YI+
Sbjct: 239 CVSFNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIE 298

Query: 300 SGARIIGGCCRTSPKDIAAINAAVNKY 326
           +GARIIGGCCRT+PKDI  I+ AV K+
Sbjct: 299 AGARIIGGCCRTTPKDILEISKAVKKF 325

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  508 bits (1308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 240/326 (73%), Positives = 274/326 (84%), Gaps = 2/326 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R  +K+ LA +P++VLVLDGGQGTELENRGIKVANPVWSTIPFIS+SFW+  D SS +
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS--DESSAN 58

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R+IVKEM+ DFL AGA +LMT+TYQ SFKSVSENT I TL  YD LL+RIV FSR CIG+
Sbjct: 59  RKIVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGE 118

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           +K L+GCIGPWGAH C EFTG+YG  PE ID+ QYFKPQLDNF  ND LDL+GFETIPNI
Sbjct: 119 EKHLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNI 178

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HEL+AILSWD +IL KPFYIGLSVHEHGVLRDGTTM  VA++IK LGDKINPNF+LLGIN
Sbjct: 179 HELKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGIN 238

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           CVS+N SP+IL SLH+ +P +PL+AYPNSGEVYDT KKIW P  D   +WD VVK YI S
Sbjct: 239 CVSFNQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWMPNSDKLNSWDTVVKQYIGS 298

Query: 301 GARIIGGCCRTSPKDIAAINAAVNKY 326
           GARIIGGCCRT+PKDI  ++AAV KY
Sbjct: 299 GARIIGGCCRTTPKDIQEVSAAVKKY 324

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  506 bits (1302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 229/327 (70%), Positives = 282/327 (86%), Gaps = 2/327 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R  +K++   +P+E+LV+DGGQGTELENRGIKVANPVWSTIPFIS+SFW+  + SS+D
Sbjct: 1   MARQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWS--NESSRD 58

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           RQIVKEM++DF+K G+R+LMT TYQ SFKSVSENT I TL+EY+ LL RIV+FSR CIG+
Sbjct: 59  RQIVKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGE 118

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           DK+L+GCIG WGAH C EFTGDYG+ PE+ID+L+YF+PQL NF  ++ +DLIGFETIPN+
Sbjct: 119 DKYLIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNV 178

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HEL+AILSWD +I+ KPFYIGLSVHE+GVLRDGTTM EVA++IKSLGDK+NPN +LLGIN
Sbjct: 179 HELKAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGIN 238

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           CVS+NHS  IL SLH+E+P++P+I YPNSGE+YDTVKKIW    +  +TWD VVKSYI++
Sbjct: 239 CVSFNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIEN 298

Query: 301 GARIIGGCCRTSPKDIAAINAAVNKYR 327
           GARIIGGCCRTSP+DI  I  A+ KY+
Sbjct: 299 GARIIGGCCRTSPQDIKDIVQAIEKYK 325

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  504 bits (1298), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 237/325 (72%), Positives = 276/325 (84%), Gaps = 2/325 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           MPR  +KEYL  NP++VLVLDGGQGTELENRGI VANPVWSTIPFIS+SFW+  ++SSKD
Sbjct: 1   MPRQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFWS--NASSKD 58

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R+IVK M++DFL AGA +LMT+TYQ SFKSV+ENT I TL+EY+ LL RIVSFSRSCIGD
Sbjct: 59  REIVKGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGD 118

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           +K+L+GCIGPWGAH C+EF GDYG  PE IDY  YFKPQLDNF  N DLDLIGFET+PN 
Sbjct: 119 EKYLIGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNF 178

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HEL+AILSWD TIL KPFYIGLSVHE+GVLRDGTTM+E+   IKSLG KINPNF+LLGIN
Sbjct: 179 HELKAILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGIN 238

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           CVS++ SP+IL S+H+E+P++PLIAYPNSGE+YDTVKKIW P     +TW+ VV  YI +
Sbjct: 239 CVSFSDSPDILESIHKELPDMPLIAYPNSGEIYDTVKKIWLPNHYSDITWNDVVNRYIKA 298

Query: 301 GARIIGGCCRTSPKDIAAINAAVNK 325
           GARIIGGCCRT P DI  ++AAV K
Sbjct: 299 GARIIGGCCRTMPDDIEQVSAAVKK 323

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  498 bits (1283), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 232/327 (70%), Positives = 279/327 (85%), Gaps = 3/327 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R  +K+YL+ NP+++L+LDGGQGTELENRGI VANPVWSTIPF++DSFW+    SSKD
Sbjct: 1   MTRQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSG--QSSKD 58

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R+IVK+M+ DFL+AGA +LMT TYQ SFKSVSENT+I TL+EYD LL+RIV+FSR CIG+
Sbjct: 59  REIVKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGE 118

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           +K+L+GCIGPWGAH CSEFTG+YG  PE IDY +YFKPQL NF  NDDLD+IGFETIPN+
Sbjct: 119 NKYLIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNV 178

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           +EL+ ILSW T ILPKPFYIGLSVHE+GVLRDGTTM +VA++I SL DK+NPN VLLGIN
Sbjct: 179 YELKTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGIN 238

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHT-LTWDQVVKSYID 299
           CVS  HSP+IL S+H  +P+LPLI YPNSGEVYDTVKKIW P  D T ++WD+VV+ Y+ 
Sbjct: 239 CVSLAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLK 298

Query: 300 SGARIIGGCCRTSPKDIAAINAAVNKY 326
           +GARIIGGCCRT+P DI  I+ AV+KY
Sbjct: 299 AGARIIGGCCRTTPNDIKQISDAVHKY 325

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  496 bits (1277), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 242/326 (74%), Positives = 272/326 (83%), Gaps = 2/326 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R  +K+ LA NP++VLVLDGGQGTELENRGIKVANPVWSTIPFIS+S    +D SS  
Sbjct: 1   MARLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISES--FWSDESSSS 58

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R+IVKEM+ DFL AGA +LMT TYQ S+KSVSENT I TL EY+ LL+RIV FSR CIG+
Sbjct: 59  RKIVKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGE 118

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           DK+L+GCIGPWGAH C EFTGDYG+ PE ID+ QYFKPQLDNF  ND+LDLIGFETIPNI
Sbjct: 119 DKYLIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNI 178

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HEL+AILSWD ++L KPFYIGLSVHEHGVLRDGTTM EVA++IK LGDKINPNF LLGIN
Sbjct: 179 HELKAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGIN 238

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           CVS+N SP+IL SLHQ +P++ L+AYPNSGEVYDT KKIW P  D   +WD VVK YI S
Sbjct: 239 CVSFNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISS 298

Query: 301 GARIIGGCCRTSPKDIAAINAAVNKY 326
           GARIIGGCCRTSPKDI  I  AV KY
Sbjct: 299 GARIIGGCCRTSPKDIQEIFTAVKKY 324

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  492 bits (1266), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 225/328 (68%), Positives = 275/328 (83%), Gaps = 2/328 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R SVK+ L SNP+++L++DGGQGTELENRGI VANPVWSTIPFI+DSFW+  D SS+D
Sbjct: 1   MVRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWS--DRSSRD 58

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           RQIV  M+E+++ AGA +LMT+TYQ+SFKSVSENT I TLEEY+ LL RIV+FSR+CIG 
Sbjct: 59  RQIVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGA 118

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           D +LVGCIG WGAH C+EF+GDYG  PE+I YL YF+PQL+NF + +D+D+IGFETIPNI
Sbjct: 119 DNYLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNI 178

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HEL AILSWD +I+ KPFYIG+SVHEHG LRDGTTM +VA+L +SLG K+NPNF+ LGIN
Sbjct: 179 HELTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGIN 238

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           C S+ +S  IL SLH+E+P +PLIAYPNSGE+YDTVKKIW    +  +TWD++VKSY+ S
Sbjct: 239 CCSFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQS 298

Query: 301 GARIIGGCCRTSPKDIAAINAAVNKYRP 328
           GARIIGGCCRT+P DI  I  AV KY+P
Sbjct: 299 GARIIGGCCRTTPNDIRQIVTAVKKYKP 326

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  486 bits (1250), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 222/323 (68%), Positives = 265/323 (82%), Gaps = 2/323 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R  +K YL  NP +VLV+DGGQGTELENRGIKVANPVWSTIPFIS+SFW+  D SS+D
Sbjct: 1   MARQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFWS--DQSSED 58

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R+IVKEM+ DF+ AGA +LMT TYQ SFKSVSENT I   + Y+ LL+RI+ FSR CIG+
Sbjct: 59  RKIVKEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGE 118

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           +++L+GCIG WGAH C+EF GDYG  PE ID+ +YFKPQLDNF  N+ LDLIGFET+PNI
Sbjct: 119 ERYLIGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNI 178

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HEL+AILSWD  IL KPFYIGLSVHE+G+LRDGT+M EVA LIK  G+K+NPN  LLGIN
Sbjct: 179 HELKAILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGIN 238

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           CVSYNHS +I++S+H+E+P LPLIAYPNSGE+YDT KKIW P  +   TWD +VK YI++
Sbjct: 239 CVSYNHSNDIIKSIHKELPNLPLIAYPNSGEIYDTTKKIWLPNKNPIFTWDDIVKGYIEA 298

Query: 301 GARIIGGCCRTSPKDIAAINAAV 323
           G RIIGGCCRT+P DI A+  AV
Sbjct: 299 GVRIIGGCCRTTPNDIKAVTIAV 321

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  485 bits (1249), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 229/316 (72%), Positives = 263/316 (83%), Gaps = 2/316 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           MPR  ++EYL  NP +VLVLDGGQGTELENRGI VANPVWST+PFI  SFW+  + SSKD
Sbjct: 1   MPRQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFWS--NKSSKD 58

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R IVK M++ FL AGA +LMT TYQ SFKSVSENT I  LEEY +LL RIV FSR CIG 
Sbjct: 59  RVIVKGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGP 118

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           DK+L+GCIGPWGAH C+EF GDYG  P +IDYL YFKPQLDNF  ND+LDLIGFETIPNI
Sbjct: 119 DKYLIGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNI 178

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HELRAILSWD TIL KPFYIGLSVH +G+LRDG+TM +VA+LIKS G K+N N  LLGIN
Sbjct: 179 HELRAILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGIN 238

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           CVS++ SP+IL S+H+E+P++PLIAYPNSGEVYDTVKKIW P  D  +TW++VV  YI +
Sbjct: 239 CVSFSDSPDILESIHKELPDMPLIAYPNSGEVYDTVKKIWLPNRDMVMTWEEVVDRYIKA 298

Query: 301 GARIIGGCCRTSPKDI 316
           GARI+GGCCRTSPKDI
Sbjct: 299 GARIVGGCCRTSPKDI 314

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  483 bits (1242), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 221/324 (68%), Positives = 268/324 (82%), Gaps = 2/324 (0%)

Query: 3   RPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKDRQ 62
           R  +K+Y   NP+ VLV+DGGQGTELENRGI VANPVWST+PFI++SFW+++  +SKDR 
Sbjct: 2   RVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSD--ASKDRI 59

Query: 63  IVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGDDK 122
           IVK+M+EDF++AGA +LMT+TYQ SFKSVSENT I TLEEY+ LL RIVSFSRSCIG+D+
Sbjct: 60  IVKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDR 119

Query: 123 WLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHE 182
           +L+GCIG WGAH CSEFTGDYG  P++IDY +YF+PQL NF  + D+D+IGFETIPNIHE
Sbjct: 120 YLIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHE 179

Query: 183 LRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGINCV 242
           LRAILSWD T+L KPFYIGLSVHE+GVLRDGT+M ++A+LI SLGDK+N N + +GINC 
Sbjct: 180 LRAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCC 239

Query: 243 SYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDSGA 302
           ++N S  IL SLH   P +PLI YPNSGE+YDTVKKIW    +   TWD VVKSYI++GA
Sbjct: 240 AFNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGA 299

Query: 303 RIIGGCCRTSPKDIAAINAAVNKY 326
           RIIGGCCRT+  DI  +  AVNKY
Sbjct: 300 RIIGGCCRTTVDDIKEVRLAVNKY 323

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  466 bits (1199), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 215/326 (65%), Positives = 269/326 (82%), Gaps = 3/326 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R  +K+ L    +E+LVLDGGQGTELENRGI+VANPVWSTIPF+S+SFWT  DSSSK+
Sbjct: 1   MVRIPIKK-LVIESKEILVLDGGQGTELENRGIEVANPVWSTIPFLSESFWT--DSSSKE 57

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R+IV+ +++DF K+G+ +LMT+TYQ SF S+ ENT   TL EY+ LL RIV FSRSCIGD
Sbjct: 58  RKIVESVFDDFKKSGSNILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGD 117

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           +++L+G +GPWGAH C EFTG+YG  PE IDY +YFKPQLDNF   D++DLIGFET+PN 
Sbjct: 118 ERYLIGSVGPWGAHVCCEFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNF 177

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HEL+AILSWD T + KPFYIGLSVH +GVLRDGTTM E+ E IK LG+KI+ NF+LLG+N
Sbjct: 178 HELKAILSWDETKIAKPFYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVN 237

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           CVS+N S ++++S+H+ +P++PL+AYPNSGEVYDT KKIW    D   +WD VV+SYID+
Sbjct: 238 CVSFNDSSDMVKSIHKALPDMPLLAYPNSGEVYDTEKKIWFDNKDKLDSWDSVVRSYIDN 297

Query: 301 GARIIGGCCRTSPKDIAAINAAVNKY 326
           GARIIGGCCRTSP+DIA ++AAV KY
Sbjct: 298 GARIIGGCCRTSPRDIAEVSAAVKKY 323

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  449 bits (1155), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 204/326 (62%), Positives = 263/326 (80%), Gaps = 3/326 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R ++++ +  +P++VLVLDGGQGTELENRGI + +PVWS  PFISDSFW   +S+S D
Sbjct: 1   MGRIAIEKLILEHPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFW---ESTSSD 57

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R +V+EMY DF+ AGA VLMTVTYQA+F S+SENTSI TL +Y+  L R+VSF+R  IG+
Sbjct: 58  RTLVEEMYRDFMDAGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGE 117

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           D++L+G IGPW AH  SE+TGDYGS PE IDYLQ+FK QLDNF  + ++DLIGFET+PN 
Sbjct: 118 DRYLIGSIGPWAAHVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNF 177

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HEL+AILSWD  I+ KPFY+GLSVH++G+LRDGTTM E+A  +KSLG KIN +F+LLG+N
Sbjct: 178 HELKAILSWDENIISKPFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVN 237

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           C+S+N S  IL+SLHQ +P++PL+AYPNSGEVYDT  K W+       +W+ VV+ +ID+
Sbjct: 238 CISFNQSTSILKSLHQALPDMPLLAYPNSGEVYDTKTKTWHQAKGKQNSWEVVVEEFIDN 297

Query: 301 GARIIGGCCRTSPKDIAAINAAVNKY 326
           GARIIGGCCRTS KDI+ I +AV+K+
Sbjct: 298 GARIIGGCCRTSAKDISEIASAVDKH 323

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  436 bits (1121), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 206/275 (74%), Positives = 236/275 (85%), Gaps = 2/275 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R  +K+ LA +P++VLVLDGGQGTELENRGIKVANPVWSTIPFIS+SFW+  D SS +
Sbjct: 1   MARIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS--DESSAN 58

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R+IVKEM+ DFL AGA +LMT+TYQ SFKSVSENT I TL  YD LL+RIV FSR CIG+
Sbjct: 59  RKIVKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGE 118

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           +K L+GCIGPWGAH C EFTG+YG  PE ID+ QYFKPQLDNF  ND LDL+GFETIPNI
Sbjct: 119 EKHLIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNI 178

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HEL+AILSWD +IL KPFYIGLSVHEHGVLRDGTTM  VA++IK LGDKINPNF+LLGIN
Sbjct: 179 HELKAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGIN 238

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDT 275
           CVS+N SP+IL SLH+ +P +PL+AYPNSGEVYDT
Sbjct: 239 CVSFNQSPDILESLHRALPNMPLLAYPNSGEVYDT 273

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  434 bits (1115), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 198/326 (60%), Positives = 262/326 (80%), Gaps = 3/326 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R  +++ L ++  ++LVLDGGQGTE+ENRGI+VANPVWS+IPF+S+SFWT  D  SK+
Sbjct: 1   MGRVPLRKVL-TDSRKILVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWT--DEWSKE 57

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R+IV+E+Y+DF+ +G+ +LMTVTYQASFK+++ENT + TL EY++LL RIV+FSR CIGD
Sbjct: 58  RKIVEEIYKDFMSSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGD 117

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           +++LVG +GPW A+N SE+TGDYG   + IDY  Y+KPQLDNF   +++D+IG ET+PN 
Sbjct: 118 ERYLVGSVGPWAAYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNF 177

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HEL+AILSWD   + KPFY+ L+ H+ GVLRDGT M ++A+ IK LG+ +NPNF+LLGIN
Sbjct: 178 HELKAILSWDEKKIAKPFYVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGIN 237

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           CVS+N S +IL  LH  +PE+ L+AYPNSGEVY+  KKIW      T +WD VVKS+I+S
Sbjct: 238 CVSFNDSRDILELLHNALPEMLLLAYPNSGEVYEPKKKIWLANKCKTTSWDSVVKSFINS 297

Query: 301 GARIIGGCCRTSPKDIAAINAAVNKY 326
           GARIIGGCCRTSP+DIA ++ AV KY
Sbjct: 298 GARIIGGCCRTSPQDIADVSIAVKKY 323

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  433 bits (1114), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 201/326 (61%), Positives = 251/326 (76%), Gaps = 3/326 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R S+++ +   P  VLVLDGGQGTELENRGI +  PVWS  PF SDSFW   + SS D
Sbjct: 1   MKRISIEKLILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPFTSDSFW---EQSSHD 57

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R++V+EMY DF+ AGA VLMT+TYQA+FKS+SENTSI TL  Y+  L RIVSF+R  IG+
Sbjct: 58  REVVEEMYRDFMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGE 117

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           +++LVG IGPW AH  SE+TG+YG  PE IDY  +FKPQLD+F  N D+DLIGFET+PN 
Sbjct: 118 ERYLVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNF 177

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HEL+AILSW   I+ KPFY+GLSVH++G+LRDGTTM EV+  IK LG +IN + +L+G+N
Sbjct: 178 HELKAILSWGEDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVN 237

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           C+S+N S  ILR+LH+ +P+ PL+ YPNSGEVYD  +K W+   D   +WD  VK++IDS
Sbjct: 238 CISFNRSTLILRTLHESLPDTPLLVYPNSGEVYDVKEKTWHWPTDKPESWDITVKTFIDS 297

Query: 301 GARIIGGCCRTSPKDIAAINAAVNKY 326
           GARIIGGCCRTSPKDIA I  AV +Y
Sbjct: 298 GARIIGGCCRTSPKDIAEIATAVRRY 323

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  427 bits (1097), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 194/326 (59%), Positives = 255/326 (78%), Gaps = 3/326 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R  +++ L  +P++VLVLDGGQGTELENRGI + +PVWS  PF+SDSFW   + SS++
Sbjct: 1   MKRIPIEKLLIEHPQKVLVLDGGQGTELENRGININSPVWSAAPFVSDSFW---EKSSRE 57

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R++V+EMY DF+ AGA VLMT+TYQA+FKS+S+NT+I TL  Y   L +IV FSR  IG+
Sbjct: 58  RKVVEEMYRDFMNAGANVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGE 117

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           +++L+G IGPW AH  SE+TG+YG  PE IDY ++F+PQLD F  N+D+DLIGFETIPN 
Sbjct: 118 ERYLIGSIGPWAAHVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNF 177

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HEL+AILSW   I+ +PFY+GLSVH++G+LRDGTT+ E++  IK LG KIN NF+LLG+N
Sbjct: 178 HELKAILSWGEDIISRPFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVN 237

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           C+S+N S  IL++LH+ +P+ PL+ YPNSGE+YD  +K W    D   +WD  V+ +IDS
Sbjct: 238 CISFNQSTLILKALHEVLPDFPLLVYPNSGEIYDPKEKTWYHPTDKLDSWDVTVRKFIDS 297

Query: 301 GARIIGGCCRTSPKDIAAINAAVNKY 326
           GARIIGGCCRTSPKDIA I A+V+ Y
Sbjct: 298 GARIIGGCCRTSPKDIAEIAASVDTY 323

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  417 bits (1072), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 191/326 (58%), Positives = 251/326 (76%), Gaps = 3/326 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R  +KE +  +P +VL+LDGGQGTELENRGI + +PVWS  PF S+SFW   + SS++
Sbjct: 1   MKRIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFW---EPSSQE 57

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R++V+EMY DF+ AGA +LMT+TYQA+F+S+SENTSI TL  Y   L +IVSF+R  IG+
Sbjct: 58  RKVVEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGE 117

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           +++L+G IGPW AH   E+TGDYG  PE IDY  +FKPQL+NF  N D+DLIGFETIPN 
Sbjct: 118 ERYLIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNF 177

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HEL+AILSWD  I+ KPFYIGLSV ++ +LRDGTT+ E++  IK LG+KIN N +L+G+N
Sbjct: 178 HELKAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVN 237

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           CVS+N S  IL+ LH+ +P +PL+ YPNSGE+Y+  +K W+   +    W+  VK ++D+
Sbjct: 238 CVSFNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTNKLDDWETTVKKFVDN 297

Query: 301 GARIIGGCCRTSPKDIAAINAAVNKY 326
           GARIIGGCCRTSPKDIA I +AV+KY
Sbjct: 298 GARIIGGCCRTSPKDIAEIASAVDKY 323

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  404 bits (1037), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 196/326 (60%), Positives = 237/326 (72%), Gaps = 4/326 (1%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           MPR  +++YL  +P  VLV+DGGQGTELENRGI VA+PVWS  PF+  + W   DS  ++
Sbjct: 1   MPRIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPDS--RE 58

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R IV  +  DF+ AGA V+MT+TYQASF SV+ NT ITTL++Y+ALL RIV F R  +GD
Sbjct: 59  RAIVASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGD 118

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           DK+LVG IG WGAH C+EFTGDYG  P+ IDYL YFKPQLDNF     LDLIGFETIPN 
Sbjct: 119 DKYLVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNA 178

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HELRAILSWD +++ KPFY+ LSVH+ G LRDGT M +VA ++ +    +NPNF+ LGIN
Sbjct: 179 HELRAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAAA-APLNPNFLGLGIN 237

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           C S + +P IL  LH  +P LP+  YPNSGE+YD VKK+WN    H + W  VV SYI S
Sbjct: 238 CSSLSRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVWN-ASPHVVDWGAVVASYIRS 296

Query: 301 GARIIGGCCRTSPKDIAAINAAVNKY 326
           GARIIGGCCRT P DI  I  AV  +
Sbjct: 297 GARIIGGCCRTIPNDIRQIADAVRTH 322

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  396 bits (1018), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 185/248 (74%), Positives = 208/248 (83%)

Query: 79  LMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGDDKWLVGCIGPWGAHNCSE 138
           LMT+TYQ SFKSVSENT I TL  YD LL+RIV FSR CIG++K L+GCIGPWGAH C E
Sbjct: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70

Query: 139 FTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHELRAILSWDTTILPKPF 198
           FTG+YG  PE ID+ QYFKPQLDNF  ND LDL+GFETIPNIHEL+AILSWD +IL KPF
Sbjct: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130

Query: 199 YIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGINCVSYNHSPEILRSLHQEI 258
           YIGLSVHEHGVLRDGTTM  VA++IK LGDKINPNF+LLGINCVS+N SP+IL SLH+ +
Sbjct: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190

Query: 259 PELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDSGARIIGGCCRTSPKDIAA 318
           P +PL+AYPNSGEVYDT KKIW P  D   +WD VVK YI SGARIIGGCCRT+PKDI  
Sbjct: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250

Query: 319 INAAVNKY 326
           ++AAV KY
Sbjct: 251 VSAAVKKY 258

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  392 bits (1006), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 183/326 (56%), Positives = 239/326 (73%), Gaps = 2/326 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R  +KEYL  N +++LVLDGGQGTELE RGI +++PVWST+PFI++SFW+  +SSS D
Sbjct: 1   MGRVPIKEYLLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFWS--NSSSND 58

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
           R+I+K+MY DF+ AGA VL T TYQ SF S+SENT+I TL++Y  LL+RI  F+R CIGD
Sbjct: 59  RKIIKDMYSDFISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGD 118

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
            K+LVG IG + A+  +E+TGD+G   + IDY  YFKPQLDNF  + ++D+IGFETIPNI
Sbjct: 119 SKYLVGSIGTYAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNI 178

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
           HELRAILS +   L KPFYI LS +    LRDGT++  V ++IKS    +NPN +LLGIN
Sbjct: 179 HELRAILSLNKKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGIN 238

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           C+  N S   +  L+  +P+ PLI YPNSGE YD V+KIW    D   TW+ +V  Y+D+
Sbjct: 239 CIGLNSSHLTMEYLNNHLPQFPLIVYPNSGEKYDPVRKIWLADEDPAFTWEYIVHRYLDA 298

Query: 301 GARIIGGCCRTSPKDIAAINAAVNKY 326
           GARI+GGCCRT+P DI +I+ A+  Y
Sbjct: 299 GARIVGGCCRTTPSDIRSISEAIKCY 324

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  387 bits (994), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 178/325 (54%), Positives = 236/325 (72%), Gaps = 2/325 (0%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R  +K+YL  NPE+VLV DGGQG ELE RG+ + + +WST PF+S SFW+  D SS D
Sbjct: 1   MVRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFWS--DPSSND 58

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGD 120
            +IVK M+EDF+ AGA +LMT TYQ SFK+VSE+T + +L EY+ LL +IV F+R+CIGD
Sbjct: 59  IRIVKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGD 118

Query: 121 DKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNI 180
           +++L+G IG +GA    E++GDYG  PE +D+  YFKPQLDNF  ND++D++GFETI N 
Sbjct: 119 NRYLIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANF 178

Query: 181 HELRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGIN 240
            EL+++LSWD   + KPFYI LSVH++G LRDGT MH + + IKSL   INPN   LG+N
Sbjct: 179 TELKSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVN 238

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           CV+YN + EI+ S+H  +P +PL  +PNSGEV++  K IW    +   +W+ VVK +I S
Sbjct: 239 CVNYNKATEIIDSIHNGLPTMPLSVFPNSGEVFNVEKGIWTANPEAAASWEAVVKRFISS 298

Query: 301 GARIIGGCCRTSPKDIAAINAAVNK 325
           G RI+GGCCRT P DI  I+ AV K
Sbjct: 299 GVRIVGGCCRTRPHDIEQISKAVKK 323

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  348 bits (894), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 167/323 (51%), Positives = 233/323 (72%), Gaps = 3/323 (0%)

Query: 3   RPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKDRQ 62
           R S KEY  ++P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW   D  S++  
Sbjct: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFW-QKDEKSQNIS 60

Query: 63  IVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGDDK 122
           IVK+M++ F+ AG++ LM++TYQ SF ++S NT I  LEEY+ LL++IV F R CIG+ K
Sbjct: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120

Query: 123 WLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHE 182
           +L+G IGP+ +H  +E+TGDYG  PE +DYL YFKPQLDNF  NDD+DLI  ET+PN +E
Sbjct: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYE 180

Query: 183 LRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGINCV 242
           L+A+LSWD T + KPFYI LSV + G LRDGT+M  ++ + ++   K NPN +++G+NCV
Sbjct: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCV 239

Query: 243 SYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTL-TWDQVVKSYIDSG 301
           SY+ +  I++ L   +P+LPL+ YPNSGEVYD + + W    D  L +W+ +VK  + +G
Sbjct: 240 SYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANG 299

Query: 302 ARIIGGCCRTSPKDIAAINAAVN 324
            R++GGCCRT+P DI  I  AV+
Sbjct: 300 VRMVGGCCRTTPDDIHKIAQAVS 322

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  347 bits (890), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 163/322 (50%), Positives = 221/322 (68%), Gaps = 2/322 (0%)

Query: 3   RPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKDRQ 62
           R   ++++  +P E+LVLDGGQGTELENRG+ + +P+WSTI F++D FW  N  ++ +R+
Sbjct: 2   RVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENT-ERK 60

Query: 63  IVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGDDK 122
            ++EM+ DF  AGA V  T+TYQ SF SVSENT I +L+EY  LL +I  F R CI DD 
Sbjct: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120

Query: 123 WLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHE 182
           +L+GCIG + A   +E+ G+YG    KIDYL+YFKPQLD F  + ++D+IGFETIPN HE
Sbjct: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180

Query: 183 LRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGINCV 242
           L AILSWD  I+ +PF+I LS+ +   LRDGT+  E+  L      + N N V +G NC+
Sbjct: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGR-NKNLVYVGGNCI 239

Query: 243 SYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDSGA 302
           SY +S + +R LH  +P L LIAYPNSGE+YD   K W+      ++W++VV  Y D+G 
Sbjct: 240 SYAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGV 299

Query: 303 RIIGGCCRTSPKDIAAINAAVN 324
           +IIGGCCRT+P DI  I  AV+
Sbjct: 300 KIIGGCCRTTPDDIKQIKKAVD 321

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  345 bits (885), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 226/325 (69%), Gaps = 3/325 (0%)

Query: 3   RPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKDRQ 62
           R  ++E + + P+EVLV DGG GT LE+RGI V++P+WST+PF+ D FW + ++ + DR 
Sbjct: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDS-ETKTSDRN 60

Query: 63  IVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGDDK 122
           I++ +Y D++ +G+R+L T+TYQ SF  +S +T + T+E Y  L+  I SF RS IG+D 
Sbjct: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120

Query: 123 WLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHE 182
           +L+G IGP+GA   +E+TG+YG  P  I+YL+YFKPQL+ F  NDD+D+IGFET+PN +E
Sbjct: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180

Query: 183 LRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGINCV 242
           L AILSWD +++ KP+Y+ LS+ ++G LRDGT+  E+A + K   +  N N +L G NC+
Sbjct: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCI 238

Query: 243 SYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDSGA 302
           S+ ++ E +  LHQ IP LPLI YPNSGE+YD + K W       LTW+ ++K    S  
Sbjct: 239 SFKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNV 298

Query: 303 RIIGGCCRTSPKDIAAINAAVNKYR 327
           RI+GGCCRT+P DI  I   + K +
Sbjct: 299 RIVGGCCRTTPDDINKIKDMITKVK 323

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  332 bits (850), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 174/200 (87%)

Query: 80  MTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGDDKWLVGCIGPWGAHNCSEF 139
           MT TYQ S+KSVSENT I TL EY+ LL+RIV FSR CIG++K+L+GCIGPWGAH C EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREF 60

Query: 140 TGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHELRAILSWDTTILPKPFY 199
           TGDYG +PE ID+ +YFKPQLDNF  ND LDLIGFETIPN+HELRAILSWD +IL KPFY
Sbjct: 61  TGDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 200 IGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGINCVSYNHSPEILRSLHQEIP 259
           IGLSVHEHGVLRDGTTM EVA++IK LGDKINPNF LLGINCVS+N SP+IL SLHQ +P
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 180

Query: 260 ELPLIAYPNSGEVYDTVKKI 279
           ++ L+AYPNSGEVYDT KKI
Sbjct: 181 DMALLAYPNSGEVYDTEKKI 200

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  328 bits (841), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 153/200 (76%), Positives = 173/200 (86%)

Query: 80  MTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGDDKWLVGCIGPWGAHNCSEF 139
           MT TYQ S+KSVSENT I TL EY+ LL+RIV FSR CIG+DK+L+GCIGPWGAH C EF
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEF 60

Query: 140 TGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHELRAILSWDTTILPKPFY 199
           TGDYG +P+ ID+ +YFKPQLDNF  +D LDLIGFETIPN+HELRAILSWD +IL KPFY
Sbjct: 61  TGDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 200 IGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGINCVSYNHSPEILRSLHQEIP 259
           IGLSVHEHGVLRDGTTM EVA++IK LGDKINPNF LLGINCVS+N SP+IL SLHQ +P
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLP 180

Query: 260 ELPLIAYPNSGEVYDTVKKI 279
            + L+AYPNSGEVYDT KKI
Sbjct: 181 NMALLAYPNSGEVYDTEKKI 200

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  325 bits (833), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 216/316 (68%), Gaps = 9/316 (2%)

Query: 15  EEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKDRQIVKEMYEDFLKA 74
           + VLV+DGGQGTELENRG+ ++ P+WST+PF  + FW   D    DR +V  M++ ++ A
Sbjct: 13  DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNF-DQPYTDRDVVNSMFKAYVDA 71

Query: 75  GARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGDDKWLVGCIGPWGAH 134
           GA++L TVTYQ S+K++  +T I T  +YD LL RIV F R CIGDD +LVG IGP+ AH
Sbjct: 72  GAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDHYLVGSIGPYAAH 131

Query: 135 NCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHELRAILSWDTTIL 194
             +E+TGDYG +PE+IDY QYF+PQ+ NF  N+ +D+IG ET+PN+HEL++ILSWD T +
Sbjct: 132 VGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHELKSILSWDETKI 191

Query: 195 PKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGINCVSYNHSPEILRSL 254
            KPFY+ L V + G LRDGT + ++  L     ++ N N +L+GINC S + S + L  L
Sbjct: 192 SKPFYVSLCVGDDGNLRDGTPLEQLVPL---FANRSNKNLLLVGINCCSLSVSSQALSHL 248

Query: 255 HQEIPELP--LIAYPNSGEVYDTVKKIWN-PKG--DHTLTWDQVVKSYIDSGARIIGGCC 309
           ++ +   P  L+ YPNSGE+YD   + W+ P G   H L+W  +V+ Y   GAR IGGCC
Sbjct: 249 NEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRKFGARAIGGCC 308

Query: 310 RTSPKDIAAINAAVNK 325
           RT+P DI  I   V++
Sbjct: 309 RTTPLDIQEICKVVDR 324

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  286 bits (733), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 154/338 (45%), Positives = 213/338 (63%), Gaps = 26/338 (7%)

Query: 1   MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
           M R  + EYL S+   +LVLDGGQGTE+E RGI V +P+WST+PFI  +    N      
Sbjct: 1   MRRQPIAEYLESS---ILVLDGGQGTEMERRGIDVIHPLWSTLPFIKKNPTHLNH----- 52

Query: 61  RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSE--NTSITTLEEYDALLSRIVSFSR-SC 117
              +K MY DF  +GAR L T+TYQASF ++ +  +  + T ++Y   L+ I+ F+R  C
Sbjct: 53  ---IKGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQC 109

Query: 118 IGDDKWLVGCIGPWGAHNC--SEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFE 175
           I D ++L+GC+GP+ A+ C  +E++GDYGSE  KID+ QYFKPQLD F+ +D +D++GFE
Sbjct: 110 ISDSQYLIGCVGPYAAYLCNGAEYSGDYGSE--KIDFKQYFKPQLDVFSRDDRIDMVGFE 167

Query: 176 TIPNIHELRAILSWDTTIL--PKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPN 233
           TIPNI EL+ +LS D T +   KPFYI +S   +G LRDGT + ++ E IK       PN
Sbjct: 168 TIPNIEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPN 227

Query: 234 FVLLGINCVSYNHSPEILRSLHQEIPE----LPLIAYPNSGEVYDTVKKIWNPKGDHT-- 287
            + LGINCV Y+HS  IL  L+  + +    L    YPNSGE+YD     W+   +    
Sbjct: 228 LLFLGINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEIAPE 287

Query: 288 LTWDQVVKSYIDSGARIIGGCCRTSPKDIAAINAAVNK 325
           LTW+ +V  + +   ++IGGCCRT+P DI  I  AVNK
Sbjct: 288 LTWNYLVSKFAEQKCQLIGGCCRTTPDDIKQIADAVNK 325

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  244 bits (623), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 132/338 (39%), Positives = 199/338 (58%), Gaps = 29/338 (8%)

Query: 3   RPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKDRQ 62
           R  ++EYL     E+L+LDGGQGTELE RGI +A+P+WST+P+++           K  +
Sbjct: 2   RLQLEEYLK---HEILLLDGGQGTELEKRGINIAHPLWSTLPYVT--------KDKKHLK 50

Query: 63  IVKEMYEDFLKAGARVLMTVTYQASFKSVSENTS--ITTLEEYDALLSRIVSFSRS-CIG 119
           I+KEMY  F  AG   LMT+TYQASF S+  ++   I   +EY   L  ++ ++ + CI 
Sbjct: 51  IIKEMYSAFESAGCNALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCIS 110

Query: 120 DDKWLVGCIGPWGAH--NCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETI 177
            + +LVG +GP+ A+  N +E++G Y  +   ID++++F+PQ+ +F V+  +DLIG ETI
Sbjct: 111 PNSYLVGSVGPYAAYLSNGAEYSGHYIED--NIDFIEFFRPQVQHFAVSSRIDLIGIETI 168

Query: 178 PNIHELRAILSWDTTILP--KPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFV 235
           PN  E +A+L  + + L   KP+YI ++    G LRDGT   ++ E IK     + PN V
Sbjct: 169 PNFEEFKALLRPEFSRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLV 228

Query: 236 LLGINCVSYNHSPEILRSLHQEIPELPL-------IAYPNSGEVYDTVKKIW--NPKGDH 286
             GINCVS+ H  +IL+ L+  + ++ +         YPNSGEVY      W  NP+   
Sbjct: 229 FFGINCVSFAHCADILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGPNPEIGP 288

Query: 287 TLTWDQVVKSYIDSGARIIGGCCRTSPKDIAAINAAVN 324
             TW+ +    +  G  +IGGCCRTSP D+  I + V+
Sbjct: 289 ADTWENLASKVVQQGCLMIGGCCRTSPADLRQIASVVS 326

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  238 bits (606), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 131/340 (38%), Positives = 200/340 (58%), Gaps = 31/340 (9%)

Query: 3   RPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKDRQ 62
           R  +KE+  +N   +L+LDGGQGTELE +G+ +++P+WST+PFI          +    +
Sbjct: 2   RKPLKEFFKNN---ILLLDGGQGTELEKKGVSISHPLWSTLPFII--------KNKTHLE 50

Query: 63  IVKEMYEDFLKAGARVLMTVTYQASFKSVSENTS--ITTLEEYDALLSRIVSFS-RSCIG 119
            +KEMY DF +AG+  LMT+TYQASF S+ + +   + + E+Y A L  ++ F+ R CI 
Sbjct: 51  AIKEMYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECIT 110

Query: 120 DDKWLVGCIGPWGA--HNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETI 177
            DK+LVG +GP+     N +E++G YG    KID++ Y+ PQ+ +F ++  +DLIG ETI
Sbjct: 111 PDKYLVGSVGPYAGLLSNGAEYSGYYGEG--KIDFIDYYSPQVKHFALSPRIDLIGIETI 168

Query: 178 PNIHELRAILSWDTTILP--KPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFV 235
           PNI E +A+LS + + L   KP+YI ++   +G LRDGT+++E+   IK     +  NFV
Sbjct: 169 PNIDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNFV 228

Query: 236 LLGINCVSYNHSPEILRSLHQEIPELPLI--------AYPNSGEVYDTVKKIW--NPKGD 285
              INCV + H  EIL+SL+  + E+  +        AYPNSGE+Y      W  NP   
Sbjct: 229 FFAINCVEFLHCVEILQSLNDCL-EMQGVDRRFRFRGAYPNSGEIYHGGTHSWSSNPYAG 287

Query: 286 HTLTWDQVVKSYIDSGARIIGGCCRTSPKDIAAINAAVNK 325
              TW+ +    +     ++GGCCRT  ++I  +     K
Sbjct: 288 PEDTWENLTLGLLSQECLMLGGCCRTGSEEIRQMALTTKK 327

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  234 bits (598), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 125/331 (37%), Positives = 196/331 (59%), Gaps = 24/331 (7%)

Query: 5   SVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKDRQIV 64
           ++ E+L  N   VLV+DGG G ELE RG+ V +P+WST PF+        D ++ D   +
Sbjct: 50  AITEFLERN---VLVMDGGMGVELERRGMDVKSPLWSTAPFLR------GDRAALD--TI 98

Query: 65  KEMYEDFLKAGARVLMTVTYQASFKS-VSENTSITTLEEYDALLSRIVSFS-RSCIGDDK 122
           + +Y +F  AG+R + T+TYQASF S V  + S+++  +Y+  L ++V F+ R C+   +
Sbjct: 99  RGLYREFRAAGSRGISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPAR 158

Query: 123 -WLVGCIGPWGAHNC--SEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPN 179
            +++G +GP+ A  C  +E+TGDYG E   I++  YF+PQ+  F  +  +D I FET+PN
Sbjct: 159 DYIIGSVGPYAAFLCNGAEYTGDYGFE--TINFFNYFEPQVSKFATDPRIDAIAFETVPN 216

Query: 180 IHELRAILS--WDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLL 237
           + EL A+L   +   +  KPFYI +S  +  VLRDGT +  V +LI+   D + PN +  
Sbjct: 217 VVELMAMLQPEFHALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLCF 276

Query: 238 GINCVSYNHSPEILRSLHQEIPELPL---IAYPNSGEVYDTVKKIWNPKGD-HTLTWDQV 293
           G+NCV    S  +L  L+ ++ + P+     YPN   V+D     W P  D  +LTW + 
Sbjct: 277 GLNCVDLTRSAAMLAELNMQLQDCPIKFQAIYPNGTSVFDESLSAWRPSKDAESLTWAEA 336

Query: 294 VKSYIDSGARIIGGCCRTSPKDIAAINAAVN 324
           VK Y++   R+IGGCC T+P+D+  I  A++
Sbjct: 337 VKLYLNQDCRMIGGCCGTTPQDMRQIAEALD 367

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score =  157 bits (396), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 80/101 (79%)

Query: 226 LGDKINPNFVLLGINCVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGD 285
           LGDKINPN   LGINCVS+N SP+IL SLHQ +P + L+AYPNSGEVYDT KKIW P  D
Sbjct: 4   LGDKINPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSD 63

Query: 286 HTLTWDQVVKSYIDSGARIIGGCCRTSPKDIAAINAAVNKY 326
              +WD VVK YI SGARIIGGCCRTSPKDI  I+AAV KY
Sbjct: 64  KLNSWDTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKKY 104

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  141 bits (356), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 80/97 (82%), Gaps = 2/97 (2%)

Query: 1  MPRPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKD 60
          M R  +K+ L  NP++VLVLDGGQGTELENRGIKVANPVWSTIPFISDSFW+  D SS +
Sbjct: 1  MVRLPLKQLLEDNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWS--DESSAN 58

Query: 61 RQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSI 97
          R+IVK M+ DFL AGA +LMT TYQ S+KSVSENT I
Sbjct: 59 RKIVKGMFNDFLNAGAEILMTTTYQTSYKSVSENTPI 95

>KNAG0A07310 Chr1 complement(1141818..1143857) [2040 bp, 679 aa]
           {ON} Anc_3.372 YBR117C
          Length = 679

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 5/76 (6%)

Query: 248 PEILRSLHQEIPELPLIAYPNSGEVYDTV-KKIWNPKGDHTLTWDQVVKSYIDS----GA 302
           PE L+ L Q+    P  ++    EVYD   KK+  P  +    WDQ++K+Y       GA
Sbjct: 268 PEDLKQLRQKFGFNPDKSFQVPQEVYDFYQKKVLQPGVEANKKWDQLLKAYEQKYPELGA 327

Query: 303 RIIGGCCRTSPKDIAA 318
            +        P+D AA
Sbjct: 328 DLARRLAGQLPQDWAA 343

>TPHA0O00630 Chr15 complement(115953..117737) [1785 bp, 594 aa] {ON}
           Anc_1.386 YLR173W
          Length = 594

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 5/50 (10%)

Query: 260 ELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVV-----KSYIDSGARI 304
           ++ L+  PN+  + D +KKIW    DH   W  +      KSY+  GA +
Sbjct: 185 KITLLLKPNTKNIVDVLKKIWKKDYDHLNIWSDMSLKLSKKSYLLFGANL 234

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 23/46 (50%)

Query: 114 SRSCIGDDKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQ 159
           +R C+   K ++   G      C  FTGD+ S+P  + YL   +P+
Sbjct: 243 TRQCLVIKKKILEFAGTVKGDYCKMFTGDFNSQPNSVPYLVLTQPR 288

>NCAS0A08810 Chr1 (1741889..1743649) [1761 bp, 586 aa] {ON}
           Anc_1.386 YLR173W
          Length = 586

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 7/61 (11%)

Query: 241 CVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDS 300
           CV   +  E+L  LH     L ++  P+   V   +KKIWN   D    W ++  ++  S
Sbjct: 166 CVDLRN--EVLTDLH-----LTILIEPDMDNVLKVIKKIWNHDYDELKLWSRLDATFFKS 218

Query: 301 G 301
           G
Sbjct: 219 G 219

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 12/92 (13%)

Query: 231 NPNFVLLGINCVSYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDH---- 286
           NP+F+ L +N   Y    +I+R+   +I    L+   N+G  YD +  I N KG H    
Sbjct: 408 NPHFINLSVNY--YYGDRDIIRNYESQI----LLDPKNAGIYYDDLTFIANVKGSHQLLT 461

Query: 287 -TLTWDQVVKSYIDSGARIIG-GCCRTSPKDI 316
            TL  + V +  ++S  R+       T PK I
Sbjct: 462 FTLKQNIVGQEALNSALRLFHIDPSETDPKQI 493

>NCAS0I01750 Chr9 (323547..325229) [1683 bp, 560 aa] {ON} Anc_3.247
           YBR044C
          Length = 560

 Score = 30.4 bits (67), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 53/123 (43%), Gaps = 27/123 (21%)

Query: 57  SSKDRQIVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRS 116
           S KDR +V  +Y+  L+   ++L ++ Y  + K                  S ++  +  
Sbjct: 247 SLKDRALVL-VYDGTLRDAKQILPSLHYATTIKR-----------------SLVILTTGD 288

Query: 117 CIGDDKWLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFET 176
           C+GD       +     HN     G  GSE   +  L+Y + + DN ++ ++ +L+ F  
Sbjct: 289 CVGD------ALTSIIIHNNKNRRG--GSESRAL-VLKYIEKENDNLSIQENYNLLSFLN 339

Query: 177 IPN 179
           +PN
Sbjct: 340 LPN 342

>Suva_2.658 Chr2 (1174694..1176613) [1920 bp, 639 aa] {ON} YDR484W
           (REAL)
          Length = 639

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 30/48 (62%), Gaps = 6/48 (12%)

Query: 147 PEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHELRAILSWDTTIL 194
           P+ IDYL  F  +L N+T   DLD I  ++    +EL+++L +++T L
Sbjct: 74  PQLIDYLTQFTDRLSNYT--QDLDFIKKKS----NELQSLLEYNSTKL 115

>ZYRO0A00924g Chr1 complement(66827..68146) [1320 bp, 439 aa] {ON}
           similar to uniprot|P29704 Saccharomyces cerevisiae
           YHR190W ERG9 Farnesyl-diphosphate farnesyl transferase
           (squalene synthase) joins two farnesyl pyrophosphate
           moieties to form squalene in the sterol biosynthesis
           pathway
          Length = 439

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

Query: 39  VWSTIPFISDSFWTANDSSSKDRQIVKEMYEDFLKAGARVLMTVTY---QASFKSVSENT 95
           + S +P    ++   N   ++  Q ++EMY+D L  GA+   T+ Y   Q  FK   +  
Sbjct: 351 IKSRVPVQDPNYLKVNIQVARIEQHIEEMYQDKLPNGAKPKETIYYTKAQERFKQDEKIL 410

Query: 96  SITTLEEY 103
            I   EEY
Sbjct: 411 PIEQNEEY 418

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,149,048
Number of extensions: 1722377
Number of successful extensions: 4713
Number of sequences better than 10.0: 50
Number of HSP's gapped: 4770
Number of HSP's successfully gapped: 50
Length of query: 329
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 219
Effective length of database: 40,868,139
Effective search space: 8950122441
Effective search space used: 8950122441
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)