Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03828g8.842ON40440421630.0
SAKL0D01430g8.842ON44740316800.0
KNAG0G034208.842ON51140516630.0
ZYRO0G14234g8.842ON50940516630.0
Suva_13.288.842ON53040316520.0
NCAS0B003008.842ON52340516490.0
Kpol_541.158.842ON49840416410.0
YML115C (VAN1)8.842ON53540316420.0
KAFR0A028308.842ON50740616380.0
Smik_13.198.842ON53639416280.0
Kwal_27.102468.842ON33933816020.0
NDAI0E002908.842ON52240916130.0
Skud_13.268.842ON53939816090.0
TDEL0B005608.842ON50940415870.0
KLLA0D01529g8.842ON50140315720.0
TBLA0B032708.842ON52040215590.0
Ecym_46138.842ON52440915540.0
ABL124W8.842ON48540615490.0
CAGL0B02321g8.842ON51240115450.0
TPHA0C047808.842ON52540714650.0
KLTH0C03432g1.479ON48936310171e-134
Kwal_27.101571.479ON47636210121e-134
Ecym_35731.479ON44736210031e-133
CAGL0L01331g1.479ON4473629881e-131
TDEL0C026001.479ON4623639891e-131
YEL036C (ANP1)1.479ON5003559911e-130
NCAS0G041101.479ON4943629891e-130
Smik_5.571.479ON4913549861e-130
SAKL0D11792g1.479ON4833629851e-130
Skud_5.541.479ON4913549851e-130
KAFR0I027701.479ON4553629811e-129
Suva_5.331.479ON4953549821e-129
NDAI0G003401.479ON5043549801e-129
KNAG0I003001.479ON4573649711e-128
AFR357W1.479ON4343639671e-128
TBLA0B021701.479ON5723629771e-127
NDAI0B012501.479ON4463659601e-126
KLLA0E22155g1.479ON4503629601e-126
ZYRO0F05170g1.479ON6083569731e-126
Kpol_370.51.479ON6453549761e-126
TPHA0O004301.479ON5483519631e-125
KLLA0E12849g8.500ON3923475221e-61
NCAS0C023308.500ON3933475011e-58
SAKL0H11110g8.500ON3933485002e-58
KNAG0A021508.500ON3963534983e-58
KAFR0H013908.500ON3983474975e-58
TBLA0H033408.500ON3933534923e-57
TPHA0L013708.500ON3923474844e-56
KLTH0E11616g8.500ON3943474801e-55
Skud_16.2328.500ON3953474801e-55
Smik_16.1868.500ON3953474802e-55
Kwal_27.118648.500ON4533474842e-55
YPL050C (MNN9)8.500ON3953474802e-55
NDAI0E030208.500ON3963494783e-55
TDEL0B013708.500ON3963504759e-55
ZYRO0F08492g8.500ON3963494751e-54
CAGL0L12804g8.500ON3933504751e-54
Suva_16.2658.500ON3953474696e-54
Kpol_1031.788.500ON3923504619e-53
AGL259C8.500ON3893494565e-52
NCAS0B024408.500ON4003444481e-50
Ecym_25508.500ON3903464434e-50
NDAI0C052508.500ON4023424225e-47
KNAG0A039908.500ON3571752312e-20
SAKL0H20438gsingletonON5652101651e-11
YCR019W (MAK32)1.440ON363134800.20
TBLA0F025406.123ON126330741.7
Smik_13.4528.780ON43796712.6
ZYRO0G12540g3.295ON95065704.1
Suva_13.4258.780ON44491687.8
Skud_13.4118.780ON43894677.9
CAGL0F03575g8.702ON75565688.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03828g
         (404 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   837   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   651   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   645   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   645   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   640   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   639   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   636   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   637   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   635   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   631   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   621   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   625   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   624   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   615   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   610   0.0  
TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...   605   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   603   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   601   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   599   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   568   0.0  
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   396   e-134
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   394   e-134
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   390   e-133
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   385   e-131
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   385   e-131
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   386   e-130
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    385   e-130
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   384   e-130
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   384   e-130
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   384   e-130
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   382   e-129
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   382   e-129
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   382   e-129
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   378   e-128
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   377   e-128
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   380   e-127
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   374   e-126
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   374   e-126
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   379   e-126
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   380   e-126
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   375   e-125
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   205   1e-61
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   197   1e-58
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   197   2e-58
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   196   3e-58
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   196   5e-58
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   194   3e-57
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   191   4e-56
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   189   1e-55
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   189   1e-55
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   189   2e-55
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   191   2e-55
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   189   2e-55
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   188   3e-55
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   187   9e-55
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   187   1e-54
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   187   1e-54
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   185   6e-54
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   182   9e-53
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   180   5e-52
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   177   1e-50
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   175   4e-50
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   167   5e-47
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    94   2e-20
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    68   1e-11
YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Prote...    35   0.20 
TBLA0F02540 Chr6 (615371..619162) [3792 bp, 1263 aa] {ON} Anc_6....    33   1.7  
Smik_13.452 Chr13 complement(734312..735625) [1314 bp, 437 aa] {...    32   2.6  
ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} simila...    32   4.1  
Suva_13.425 Chr13 complement(731503..732837) [1335 bp, 444 aa] {...    31   7.8  
Skud_13.411 Chr13 complement(724707..726023) [1317 bp, 438 aa] {...    30   7.9  
CAGL0F03575g Chr6 complement(348058..350325) [2268 bp, 755 aa] {...    31   8.3  

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  837 bits (2163), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/404 (100%), Positives = 404/404 (100%)

Query: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60
           MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR
Sbjct: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60

Query: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120
           EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ
Sbjct: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120

Query: 121 SGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQI 180
           SGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQI
Sbjct: 121 SGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQI 180

Query: 181 FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 240
           FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG
Sbjct: 181 FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 240

Query: 241 SVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGY 300
           SVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGY
Sbjct: 241 SVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGY 300

Query: 301 AEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEA 360
           AEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEA
Sbjct: 301 AEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEA 360

Query: 361 FGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKRS 404
           FGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKRS
Sbjct: 361 FGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKRS 404

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  651 bits (1680), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/403 (76%), Positives = 348/403 (86%)

Query: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60
           +++K+D GAEH+LIS+GG E+L   D ERYE+EV+ LL +TV+ YDL  +EGS  G  NR
Sbjct: 44  IIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEMLLGATVDVYDLSKYEGSENGAENR 103

Query: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120
           +HVLL VPLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSEDD TL+AL+ Y KELQ
Sbjct: 104 DHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDDTLDALIAYSKELQ 163

Query: 121 SGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQI 180
           +GTLS++FA           KG+ DL+LKYM   YL MV+ A+ PPFHK YDKPFRSVQ+
Sbjct: 164 NGTLSELFAEQDEMRRKASIKGSPDLYLKYMNQDYLNMVEMAFKPPFHKDYDKPFRSVQV 223

Query: 181 FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 240
           FQKDFGQ+IGQGFSDRHAV VQGIRRKLMGRARNWLTANALKPYHSWVYWRD D+ELCPG
Sbjct: 224 FQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARNWLTANALKPYHSWVYWRDVDIELCPG 283

Query: 241 SVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGY 300
           SVI+DLMS + DVAVPNVWRPLPEFL GEQ YDLNSW+ES  AL+LA TLDEDDVIVEGY
Sbjct: 284 SVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDLNSWVESGEALKLANTLDEDDVIVEGY 343

Query: 301 AEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEA 360
           AEYPTWRVHL Y+R+PD+NP +I++LDGVGGVSILAKAKLFR GVHFPAFTFENHAETEA
Sbjct: 344 AEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSILAKAKLFRAGVHFPAFTFENHAETEA 403

Query: 361 FGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403
           FGKMAKKM YRV GLPHYT+WHIYEPSDDDL +IA++EREK+R
Sbjct: 404 FGKMAKKMHYRVGGLPHYTVWHIYEPSDDDLKEIAKKEREKRR 446

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/405 (72%), Positives = 353/405 (87%), Gaps = 2/405 (0%)

Query: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60
           ++ KFD G +HYLIS+ G ++L   D+ERYE EVK L DSTV+ YDL +F GS  GE NR
Sbjct: 106 VIGKFDQGVQHYLISEFGNDVLTPKDQERYEAEVKQLFDSTVQRYDLNEFTGSPDGETNR 165

Query: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120
           +HVL+ VPLR+AE+VLPLMFK+LMNLTYPHELID+AFLVSDCS+DD TLEAL+ Y ++LQ
Sbjct: 166 DHVLICVPLRDAEEVLPLMFKHLMNLTYPHELIDVAFLVSDCSDDDNTLEALIAYSRQLQ 225

Query: 121 SGTLSDVFAAHSSDEELI--KEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSV 178
           +GTLS +F    +  + +  K++  + L+LKYM+  YL  V+ A++PP+H+ YDKPFRSV
Sbjct: 226 NGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKYMKQEYLNKVEKAFTPPYHENYDKPFRSV 285

Query: 179 QIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 238
           QIF+K+FGQIIGQGFSDRHAVKVQGIRRKLMGR+RNWLTANALKPYHSWVYWRDAD+ELC
Sbjct: 286 QIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRSRNWLTANALKPYHSWVYWRDADIELC 345

Query: 239 PGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVE 298
           PGSVIQD+M+ D+DV VPNVWRPLPEFL GEQPYDLNSW+ES  AL+LA+TLDEDDVIVE
Sbjct: 346 PGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQPYDLNSWMESPEALELAETLDEDDVIVE 405

Query: 299 GYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAET 358
           GYAEYPTWRVHLAY+RD + +P ++++LDGVGGVSILA+AKLFRNGV FPAFTFENHAET
Sbjct: 406 GYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVGGVSILARAKLFRNGVQFPAFTFENHAET 465

Query: 359 EAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403
           EAFGKMA+K+G+RV GLPHYTLWHIYEPSDDDL +IA +EREK+R
Sbjct: 466 EAFGKMARKLGFRVGGLPHYTLWHIYEPSDDDLREIANKEREKRR 510

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/405 (75%), Positives = 348/405 (85%), Gaps = 2/405 (0%)

Query: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60
           ++ KFD G +HYLI++ G ++L   D E +E E K LL STVE YDL  F GSA G  N 
Sbjct: 104 VIEKFDGGVQHYLITQFGNDVLTPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANG 163

Query: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120
           EHVLL VPLR+AE+VLPLMFK+LMNLTYPHELIDLAFLVSDC+EDDKTL+AL+ Y ++LQ
Sbjct: 164 EHVLLCVPLRDAEKVLPLMFKHLMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQ 223

Query: 121 SGTLSDVFAA--HSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSV 178
           SGTLS VFA    ++ E     KGT  L+LKYM P YL+ VK+++SPPFH+ YDKPFRSV
Sbjct: 224 SGTLSQVFADMDQAAAEAEQASKGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSV 283

Query: 179 QIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 238
           Q+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC
Sbjct: 284 QVFQKDFGQMIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 343

Query: 239 PGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVE 298
           PGSVI+DLMS D+DVAVPNVWRPLP+FL GEQPYDLNSW+ES  AL LA+TLDEDDVIVE
Sbjct: 344 PGSVIEDLMSKDYDVAVPNVWRPLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVE 403

Query: 299 GYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAET 358
           GYAEYPT+RVHLAY+RDP  +P +I++LDGVGGVSILAKA+LFR G+ FPAFTFENHAET
Sbjct: 404 GYAEYPTYRVHLAYIRDPTQDPNEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAET 463

Query: 359 EAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403
           E FGKMAKKMGYRV GLPHYTLWHIYEPSDDDL +IA +ERE +R
Sbjct: 464 EGFGKMAKKMGYRVGGLPHYTLWHIYEPSDDDLREIANKERESRR 508

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/403 (73%), Positives = 343/403 (85%), Gaps = 1/403 (0%)

Query: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60
           ++ KFD+G +HYLI++ G E+L   D E+Y+EE+  LLDSTVE YDL +FEG+  G   R
Sbjct: 127 VVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFEGAPNGLETR 186

Query: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120
           +H+LL +PLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSE D TL+AL+ Y ++LQ
Sbjct: 187 DHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQ 246

Query: 121 SGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQI 180
           +GTLS++F    +  +  + KGT  L+LKYM   Y+  V  A+SPPFH  YDKPFRSVQ+
Sbjct: 247 NGTLSEIFQEIDAVID-SQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRSVQV 305

Query: 181 FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 240
           FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG
Sbjct: 306 FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 365

Query: 241 SVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGY 300
           SVIQDLMS ++DV VPNVWRPLP FL  EQPYDLNSW+ES  AL LA+TLDEDDVIVEGY
Sbjct: 366 SVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKTLDEDDVIVEGY 425

Query: 301 AEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEA 360
           AEYPTWRVHLAY+RD   +P ++++LDGVGGVSILAKAK+FRNGV FPAFTFENHAETEA
Sbjct: 426 AEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEA 485

Query: 361 FGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403
           FGKMAKKMGYRV GLPHYT+WHIYEPSDDDL +IA REREK+R
Sbjct: 486 FGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRR 528

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/405 (73%), Positives = 345/405 (85%), Gaps = 2/405 (0%)

Query: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60
           +++KFDNG +HYLIS+ G ++L  SD E Y +E++ +LD++VE YDL  F GS+ G  NR
Sbjct: 118 VVKKFDNGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNR 177

Query: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120
           +H+LL VPLR+AE VLPLMFK+LMNLTYPHELIDLAFLVSDCSE D+TL+ALL Y K LQ
Sbjct: 178 DHLLLCVPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQ 237

Query: 121 SGTLSDVFAAHSSDE--ELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSV 178
           +GTLS VF      E     K KGT +L LKYM P YLK+V  ++    H  YDKPFRS+
Sbjct: 238 NGTLSQVFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSI 297

Query: 179 QIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 238
           Q+FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYH+WVYWRDAD+ELC
Sbjct: 298 QVFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELC 357

Query: 239 PGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVE 298
           PGSVI+DLMS D+DV VPNVWRPLPEFL GEQPYDLNSWIESD AL+LA+TLDEDDVIVE
Sbjct: 358 PGSVIEDLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVE 417

Query: 299 GYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAET 358
           GYAEYPTWRVHLAY+RD   +P ++++LDGVGGVSILAKAK+FR+GV FPAFTFENHAET
Sbjct: 418 GYAEYPTWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAET 477

Query: 359 EAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403
           EAFGKMA+KMG+RV GLPHYT+WHIYEPSDDDL++IA +ER+ KR
Sbjct: 478 EAFGKMARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKERQNKR 522

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/404 (72%), Positives = 345/404 (85%), Gaps = 3/404 (0%)

Query: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60
           +++KFD+GA+HYLISK G E+L   DK RYE+E++ LL +TV++YDL  + G+  G  NR
Sbjct: 98  LVKKFDDGAKHYLISKYGSEVLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNR 157

Query: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120
           EHVLL VPLR+AE VLPLMFKN+MNLTYPHELIDLAFLVSDC+E D TLE+L+ Y + LQ
Sbjct: 158 EHVLLCVPLRDAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQ 217

Query: 121 SGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQI 180
            GTL+ +F     D+    +K +  L+LKYM   YLKMV+DAYSPPFH  Y+KPFRSVQI
Sbjct: 218 DGTLAGLFQEMDKDD---SKKDSEKLYLKYMNKDYLKMVEDAYSPPFHNDYEKPFRSVQI 274

Query: 181 FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 240
           FQKDFGQ +GQGF++RH+VKVQGIRRKLMGRARNWL  NALKPYH+WVYWRDADVELCPG
Sbjct: 275 FQKDFGQEVGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPG 334

Query: 241 SVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGY 300
           +VI+DLMS +FDV VPNVWRPLPEFL  EQPYDLNSW+ES+ AL+LA+ LDEDDVIVEGY
Sbjct: 335 TVIEDLMSKNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGY 394

Query: 301 AEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEA 360
           AEYPTWRVHLAY+R+ + NP  +++LDGVGGVSIL KAKLFR+G+HFPAFTFENHAETEA
Sbjct: 395 AEYPTWRVHLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEA 454

Query: 361 FGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKRS 404
           FGKMAKKMG+RV GLPHYTLWHIYEPSDDDL++IA +ERE  RS
Sbjct: 455 FGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLLEIASKERENNRS 498

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/403 (73%), Positives = 340/403 (84%), Gaps = 1/403 (0%)

Query: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60
           ++ KFD+G +HYLIS+ G E+L   D E+Y+ E+  L DSTVE YDL +FEG+  G   R
Sbjct: 131 VISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTVEEYDLSNFEGAPNGLETR 190

Query: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120
           +H+LL +PLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSE D TL+AL+ Y + LQ
Sbjct: 191 DHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRHLQ 250

Query: 121 SGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQI 180
           +GTLS +F    +  +  + KGT  L+LKYM   Y+  V  A+SPPFH+ YDKPFRSVQI
Sbjct: 251 NGTLSQIFQEIDAVID-SQTKGTDKLYLKYMDEGYINRVHQAFSPPFHENYDKPFRSVQI 309

Query: 181 FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 240
           FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG
Sbjct: 310 FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 369

Query: 241 SVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGY 300
           SVIQDLMS ++DV VPNVWRPLP FL  EQPYDLNSW+ES  AL LA+TLDEDDVIVEGY
Sbjct: 370 SVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMESQEALALAKTLDEDDVIVEGY 429

Query: 301 AEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEA 360
           AEYPTWRVHLAY+RD + +P + ++LDGVGGVSILAKAK+FRNGV FPAFTFENHAETEA
Sbjct: 430 AEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAETEA 489

Query: 361 FGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403
           FGKMAKKMGYRV GLPHYT+WHIYEPSDDDL +IA REREK+R
Sbjct: 490 FGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASREREKRR 532

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/406 (73%), Positives = 347/406 (85%), Gaps = 7/406 (1%)

Query: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60
           +++KFD GA+HYLIS+ G ++L   D+E YE E+  L DST+E YDL+DF G+  G  NR
Sbjct: 106 VIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIETYDLQDFGGNPNGAENR 165

Query: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120
           +HVLL +PLR+A  VLPLMF++LMNLTYPHELIDLAFLVSDCSE+D TL+AL+E+ K LQ
Sbjct: 166 DHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCSENDNTLDALIEFSKNLQ 225

Query: 121 SGTLSDVFA---AHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRS 177
           +GTLS V     A + +E   K     +L LKYM P YLK V+ A+SPPFH+ YDKPFRS
Sbjct: 226 NGTLSQVLNEIDAFTKEETSTKS----NLHLKYMDPEYLKRVQKAFSPPFHEDYDKPFRS 281

Query: 178 VQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL 237
           VQIF+K+FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDAD+EL
Sbjct: 282 VQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADIEL 341

Query: 238 CPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIV 297
           CPGSVI+DLM+ D+DV VPNVWRPLP FL GEQPYDLNSW ES  AL+LAQTLDEDDVIV
Sbjct: 342 CPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESAEALKLAQTLDEDDVIV 401

Query: 298 EGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAE 357
           EGYAEYPTWRVHLAY+RDP  NP +++++DGVGGVSILAKAKLFR+GV FPAFTFENHAE
Sbjct: 402 EGYAEYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVSILAKAKLFRSGVQFPAFTFENHAE 461

Query: 358 TEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403
           TEAFGKMAKKMGY+V GLPHYTLWHIYEPSDDDL ++A +ERE++R
Sbjct: 462 TEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREERR 507

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/394 (74%), Positives = 339/394 (86%), Gaps = 1/394 (0%)

Query: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60
           ++ KFDNG EHYLIS+ G ++L   D E+Y+ E+  LLDSTVE YDL  FEG++ G   R
Sbjct: 131 VVSKFDNGVEHYLISQFGSDVLTPKDDEKYQSELSMLLDSTVEKYDLSRFEGASNGVETR 190

Query: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120
           +H+LL VPLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSEDD TL+AL+ Y ++LQ
Sbjct: 191 DHILLCVPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEDDTTLDALIAYSRQLQ 250

Query: 121 SGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQI 180
           +GTLS +F    +  +  + KGT  L+L+YM  +Y+  V+ A+SPPFH+ YDKPFRSVQI
Sbjct: 251 NGTLSQIFQEIDAVID-SQTKGTDKLYLQYMDQNYINRVRQAFSPPFHENYDKPFRSVQI 309

Query: 181 FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 240
           FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG
Sbjct: 310 FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 369

Query: 241 SVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGY 300
           S+IQDLMS ++DV VPNVWRPLP FL+ EQPYDLNSW+ES   L+LA+TLDEDDVIVEGY
Sbjct: 370 SIIQDLMSKNYDVIVPNVWRPLPTFLESEQPYDLNSWMESKEGLELAKTLDEDDVIVEGY 429

Query: 301 AEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEA 360
           AEYPTWRVHLAY+RD + +P ++I+LDGVGGVSILAKAKLFRNGV FPAFTFENHAETEA
Sbjct: 430 AEYPTWRVHLAYIRDAEGDPNEVIDLDGVGGVSILAKAKLFRNGVQFPAFTFENHAETEA 489

Query: 361 FGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQI 394
           FGKMAKKMGYRV GLPHYT+WHIYEPSDDDL +I
Sbjct: 490 FGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/338 (85%), Positives = 314/338 (92%)

Query: 66  LVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQSGTLS 125
           +VPLRNA++VLPLMFKNLMNLTYPHELIDLAFLVSDCSEDD+T EALLEY KELQSGTLS
Sbjct: 1   MVPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLS 60

Query: 126 DVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQIFQKDF 185
            VFA+H+S E +++E+G+ DLFLKYMRPSYLKMVKDA++PPFHK YDKPFRSVQIFQK+F
Sbjct: 61  QVFASHNSGENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQKNF 120

Query: 186 GQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQD 245
           GQ+IGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI+D
Sbjct: 121 GQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIED 180

Query: 246 LMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGYAEYPT 305
           LM+T +DV VPNVWRPLPEFL GEQ YDLNSW+ESD AL LA+ LDEDDVIVEGYAEYPT
Sbjct: 181 LMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEYPT 240

Query: 306 WRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEAFGKMA 365
           WRVHL Y+R+ D +PK  I+LDGVGGVSILAKA+LFRNGVHFPAFTFENHAETEAFGKMA
Sbjct: 241 WRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGKMA 300

Query: 366 KKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403
           KKMGY VAGLPHYTLWHIYEPSDDDLIQ+ ERERE KR
Sbjct: 301 KKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKR 338

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/409 (71%), Positives = 345/409 (84%), Gaps = 12/409 (2%)

Query: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60
           +L KF+NG +HYLIS+ G ++L   DKE+YE+E+  LLD++VE YDL+ F+GS  G  NR
Sbjct: 116 VLGKFENGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENR 175

Query: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120
           +H+LL VPLR+AE VLPLMFK+LMN+TYPHELIDLAFLVSDCS+ D TLEALL+Y + LQ
Sbjct: 176 DHLLLCVPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQ 235

Query: 121 SGTLSDVFA-------AHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDK 173
           +GTLS VF         HS D      +GT +L LKYM   YLKMV+ A++ P H+ YDK
Sbjct: 236 NGTLSQVFQDMDEYQYEHSDDT-----RGTKNLHLKYMNQEYLKMVETAFNTPPHENYDK 290

Query: 174 PFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDA 233
           PFRSVQIF+KDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYHSWVYWRDA
Sbjct: 291 PFRSVQIFRKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDA 350

Query: 234 DVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDED 293
           D+ELCPG++++D+M+ D+DV VPNVWRPLPEFL  EQPYDLNSWIESD AL+LA+TL ED
Sbjct: 351 DIELCPGTIVEDMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPED 410

Query: 294 DVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFE 353
           DVIVEGYAEYPTWRVHLAY+R+   +P  +++LDGVGGVSILAKAKLFR+GVHFPAFTFE
Sbjct: 411 DVIVEGYAEYPTWRVHLAYIREAQGDPTSVVDLDGVGGVSILAKAKLFRSGVHFPAFTFE 470

Query: 354 NHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKK 402
           NHAETE FGKMAK+MGYRV GLPHYT+WHIYEPSDDDL +IA +ER+ +
Sbjct: 471 NHAETEGFGKMAKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKERQSR 519

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/398 (73%), Positives = 336/398 (84%), Gaps = 7/398 (1%)

Query: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60
           ++ KFD G +HYLIS+ G E+L   ++E Y++E+  LLDSTVE YDL DFEG+  G   R
Sbjct: 131 VISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNMLLDSTVEKYDLSDFEGAPNGLETR 190

Query: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120
           +H+LL +PLRNA  VLPLMFK+LMNLTYPHELIDLAFLVSDCSE D TL+AL+ Y ++LQ
Sbjct: 191 DHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDALIAYSRQLQ 250

Query: 121 SGTLSDVFAAHSSDEELI---KEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRS 177
           +GTLS +F     D + I   + KGT  L+LKYM   Y+  V  A+SPPFH  YDKPFRS
Sbjct: 251 NGTLSQIF----QDIDAIIDSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHDNYDKPFRS 306

Query: 178 VQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL 237
           VQIFQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL
Sbjct: 307 VQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL 366

Query: 238 CPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIV 297
           CPGSVI+DLMS ++DV VPNVWRPLP FL  EQ YDLNSW+ES  AL+LA+TLDEDDVIV
Sbjct: 367 CPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDLNSWMESREALELAKTLDEDDVIV 426

Query: 298 EGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAE 357
           EGYAEYPTWRVHLAY+RD + NP ++++LDGVGGVSILAKAK+FRNGV FPAFTFENHAE
Sbjct: 427 EGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSILAKAKIFRNGVQFPAFTFENHAE 486

Query: 358 TEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIA 395
           TEAFGKMAKKMGYRV GLPHYT+WHIYEPSDDDL +IA
Sbjct: 487 TEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIA 524

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/404 (72%), Positives = 343/404 (84%), Gaps = 3/404 (0%)

Query: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60
           +++KFDNG  +Y I++ G+E + S +  ++E+EV  LLDSTVE YD+  F G+     N+
Sbjct: 107 VIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAAENQ 166

Query: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120
           EHVLL VPLR+AE VLPLMFK+LMN+TYPHELIDLAFLVSDCSE D TL+AL+ Y ++LQ
Sbjct: 167 EHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQ 226

Query: 121 SGTLSDVFA-AHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQ 179
           +GTLS VFA    S++E  ++KG  +L+L+YM   YL+ VKD++SPPFH+ YDK FRSVQ
Sbjct: 227 NGTLSQVFAEVEMSEKE--RKKGGENLYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSVQ 284

Query: 180 IFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCP 239
           IFQKDFGQ IGQGFSDRHAVKVQG+RRKLM RARNWLTANALKPYHSWVYWRDADVELCP
Sbjct: 285 IFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELCP 344

Query: 240 GSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEG 299
           GSVIQDLM+ D+DV VPNVWRPLP FL G+QPYDLNSWIES  AL LA+TLDEDDVIVEG
Sbjct: 345 GSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVEG 404

Query: 300 YAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETE 359
           YAEYPTWR HLAY RD + +P +++ LDGVGGVSILA+A+LFR G+HFPAFTFENHAETE
Sbjct: 405 YAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAETE 464

Query: 360 AFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKR 403
           AFGKMAKKMG+RV GLPHYTLWHIYEPSDDDL +I  +EREK+R
Sbjct: 465 AFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKEREKRR 508

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/403 (69%), Positives = 335/403 (83%), Gaps = 2/403 (0%)

Query: 2   LRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNRE 61
           ++K+D G  HY+ISKGG E L S DKE +E E   LL ST + YDL  + G++ G  NR+
Sbjct: 99  IKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTDLYDLSQYNGASNGAANRD 158

Query: 62  HVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQS 121
           HVLL VPLR+A  +LP++FKNLMNLTYPHELID+AFLVSDC+++ +T+ +LL++ KELQ+
Sbjct: 159 HVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCTDNGRTMSSLLDFSKELQN 218

Query: 122 GTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQIF 181
           GTLS       +D++  K      L+LKYM   YLKMVK+A++PPFH  YDKPFRS+QIF
Sbjct: 219 GTLSKTLQDFEADKD--KGNSAEQLYLKYMGKDYLKMVKNAFNPPFHDDYDKPFRSIQIF 276

Query: 182 QKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGS 241
           +KDFGQ IGQGFSDRHAVKVQG+RRKLMGRARNWLTANALKPYHSWVYWRD DVELCPG+
Sbjct: 277 EKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANALKPYHSWVYWRDVDVELCPGT 336

Query: 242 VIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGYA 301
           VI+DLM  D+DV VPNVWRPLP FL G Q YDLNSW+ES+ A++LA+TLDEDDVIVEGYA
Sbjct: 337 VIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESNEAIKLAKTLDEDDVIVEGYA 396

Query: 302 EYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEAF 361
           EYPTWRVHL YLR  + NP D+++LDGVGGVSILA+A+LFR G+HFPAFTFENHAETEAF
Sbjct: 397 EYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVSILARAQLFRKGIHFPAFTFENHAETEAF 456

Query: 362 GKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKRS 404
           GKMAKKMG++V GL HYTLWHIYEPSDDDL +IA+ ERE +R+
Sbjct: 457 GKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLERESRRN 499

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/402 (71%), Positives = 334/402 (83%), Gaps = 6/402 (1%)

Query: 2   LRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNRE 61
              FD G +HYLI++ G +++ S DKERY +E+++LL S+V+ YDL  FEG+A G  NRE
Sbjct: 115 FHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENRE 174

Query: 62  HVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQS 121
           H+L L PLR+AE VLP+MFK+LMNLTYPHELID+AFLVSDCSE DKTL+ L+ + + LQ 
Sbjct: 175 HLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQD 234

Query: 122 GTLSDVF----AAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRS 177
           GTL D+F    A+ +  E+  +    H  +LK+M  +Y+KM   +++ P H  Y+KPFRS
Sbjct: 235 GTLVDIFKDMDASIAKSEKKNENPNKH--YLKFMDQNYIKMADASFAGPHHNEYNKPFRS 292

Query: 178 VQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL 237
           VQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL
Sbjct: 293 VQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL 352

Query: 238 CPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIV 297
           CPGSVIQDLMS ++DV VPNVWRPLPEFL  EQPYDLNSW+ES  AL+LA+TLDEDDVIV
Sbjct: 353 CPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIV 412

Query: 298 EGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAE 357
           EGYAEYPTWRVHLAYLRDP+ +P   +++DGVGGVSILAKAKLFR+GVHFPAFTFENHAE
Sbjct: 413 EGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAE 472

Query: 358 TEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAERER 399
           TEAFGKMAKKMGY V GLP+Y LWHIYEPSDDDL  +A  ER
Sbjct: 473 TEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/409 (71%), Positives = 330/409 (80%), Gaps = 11/409 (2%)

Query: 2   LRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNRE 61
           +R++D+G +H LI + G   L+S+ +E +EE +  LL +TVE YDL  + G+A G  NRE
Sbjct: 121 VRRYDDGFKHILIDQDG--TLNSNQEEGFEEHLDMLLSTTVETYDLSKYAGTANGAENRE 178

Query: 62  HVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQS 121
           HVL+ VPLRNAE VLPLMF++LMNLTYPHELIDLAFLVSDCS+DD T+++L+ Y +ELQ 
Sbjct: 179 HVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHTMDSLISYAEELQK 238

Query: 122 GTLS------DVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPF 175
           GTLS      D +  H   +   KE    DL LKYM   YL MV++A   PFHK YDKPF
Sbjct: 239 GTLSKSLKLQDAYKMHKKSKSKNKEG---DLHLKYMNKDYLNMVENALKEPFHKNYDKPF 295

Query: 176 RSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADV 235
           RSVQIFQKDFGQIIGQGFSDRH VKVQG RRKLMG+ARNWLTANALKPYHSWVYWRDADV
Sbjct: 296 RSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANALKPYHSWVYWRDADV 355

Query: 236 ELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDV 295
           ELCPGSVI+DLMS  +DV VPNVWRPLPEFL  EQ YDLNSWIESD AL LA+TLDEDDV
Sbjct: 356 ELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIESDNALNLAKTLDEDDV 415

Query: 296 IVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENH 355
           IVEGYAEY TWR HLA  RDP  N  D+++LDGVGGVSILAKAKLFRNGVHF AF FENH
Sbjct: 416 IVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKLFRNGVHFAAFAFENH 475

Query: 356 AETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKRS 404
           AETEAFGKMAKKMGYRV GL HYTLWHIYEPS+DDL++IA +ER  +RS
Sbjct: 476 AETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKERSSRRS 524

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/406 (69%), Positives = 335/406 (82%), Gaps = 6/406 (1%)

Query: 2   LRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNRE 61
           L K+D G EHY +++ GQ    S D   +EE+++ L+ +TVE YDLR++EG+  G  NRE
Sbjct: 83  LAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVEQYDLRNYEGTPNGAENRE 139

Query: 62  HVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQS 121
           HVL+ +PLRNA  VLP+MFK+LMNLTYPHELID+AFLVSDCSE+DKTL++L+EY   LQ 
Sbjct: 140 HVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCSENDKTLQSLMEYATYLQK 199

Query: 122 GTLSDVFAAHSSDEELIKEK---GTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSV 178
           GTL++V A   ++ + +K K   G  DL+LKYM   YL+MV+DA+SPP+H+ Y+KPFRSV
Sbjct: 200 GTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVRDAFSPPYHENYEKPFRSV 259

Query: 179 QIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 238
           Q+F+KDFGQ IGQGFSDRH VKVQGIRR+LMGRARNWLTANALKPYHSWVYWRD DVELC
Sbjct: 260 QVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANALKPYHSWVYWRDVDVELC 319

Query: 239 PGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVE 298
           PGSVI+DLMS  +DV VPNVWRPLPEFL G+Q YDLNSWIES  AL LA+ L+EDDVIVE
Sbjct: 320 PGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIESTDALNLAKKLEEDDVIVE 379

Query: 299 GYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAET 358
           GYAEY TWR HL   R+   NP+++I+LDGVGGVSILAKAKLFR G HF AF FENHAET
Sbjct: 380 GYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKLFRQGAHFTAFAFENHAET 439

Query: 359 EAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREKKRS 404
           EAFGKMAKKMGY+V GLPHYTLWHIYEPSDDD++ IA RERE +RS
Sbjct: 440 EAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRERENRRS 485

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/401 (71%), Positives = 329/401 (82%), Gaps = 3/401 (0%)

Query: 1   MLRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNR 60
           ++ KFD G  +YLIS+ G E    SD   Y + ++ LLDSTVE YDL +F+GSA G   +
Sbjct: 115 IVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTVEKYDLGNFQGSADGFEQQ 174

Query: 61  EHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQ 120
           EH+L+ VPLR+AE+VLPLMFKNLMNLTYPHELIDLAFLVSDCSE DKTLEAL  Y + LQ
Sbjct: 175 EHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDCSEGDKTLEALETYSQLLQ 234

Query: 121 SGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRSVQI 180
            G L D+ A     +   K K    + LKYM P YLK VK AY PPFH  Y KPFRSVQI
Sbjct: 235 EGILPDILADM---DNYNKGKSNESIHLKYMEPDYLKRVKAAYKPPFHPNYSKPFRSVQI 291

Query: 181 FQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPG 240
           FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL +NALKPYHSWVYWRDADVELCPG
Sbjct: 292 FQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNALKPYHSWVYWRDADVELCPG 351

Query: 241 SVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGY 300
           SVI+DLM  D+DV VPNVWRPLP+FL   QPYDLNSW+ES+ ALQLA+TLDEDDVIVEGY
Sbjct: 352 SVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMESNEALQLAKTLDEDDVIVEGY 411

Query: 301 AEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEA 360
           AEYPT+RVHLAY+R+ D +P  +++LDGVGGVSILA+A++FR GVHF AFTFENHAETEA
Sbjct: 412 AEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARVFREGVHFSAFTFENHAETEA 471

Query: 361 FGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREK 401
           FGKMAKK+G+RV GLPHYTLWHIYEPSDDDL+ +A+ E+ K
Sbjct: 472 FGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEKGK 512

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/407 (67%), Positives = 329/407 (80%), Gaps = 7/407 (1%)

Query: 2   LRKFDNGAEHYLISKGGQE---ILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEV 58
           + K+D G   YL+     +    L    KE Y+ E+  LL S+V+ YD++DF G++ G  
Sbjct: 117 ISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSGTSHGVS 176

Query: 59  NREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKE 118
           +REHVLL +PLR+AE VLPLMFKNLMNLTYPHELID+AFLVSDCSE+D TLE+LL+Y + 
Sbjct: 177 SREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESLLQYTRF 236

Query: 119 LQSGTLSDVFAAHSSDEEL----IKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKP 174
           LQ+GTL DVF      +E+    ++      L+LKYM+  YL+ VK+A+  PFH+ YDKP
Sbjct: 237 LQNGTLPDVFEEMDKLDEMTDKVVENADDSKLYLKYMKKEYLQRVKEAFKSPFHENYDKP 296

Query: 175 FRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDAD 234
           FRS+QI++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWL  NALKPYHSWVYWRDAD
Sbjct: 297 FRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWVYWRDAD 356

Query: 235 VELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDD 294
           VELCPG+VI+DLMS DFDV VPNVWRPLPEF+  EQPYDLNSW+ES  A+ LA+ L ED+
Sbjct: 357 VELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAKKLHEDE 416

Query: 295 VIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFEN 354
           VIVEGYAEYPTWRVHLAYLR+ D +P  ++++DGVGGVSILA+A+LFR GVHFPAFTFEN
Sbjct: 417 VIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDGVGGVSILARARLFRAGVHFPAFTFEN 476

Query: 355 HAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREK 401
           HAETEAFGKMAKKMG+RV GLPHYTLWHIYEPSDDDL+ IA +E+E+
Sbjct: 477 HAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEKER 523

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  396 bits (1017), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 195/363 (53%), Positives = 246/363 (67%), Gaps = 48/363 (13%)

Query: 41  TVEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVS 100
            V++YDLR+++G A G    +HVL  VPLR+A + LP+ F ++  ++YPH LIDL+FLVS
Sbjct: 52  NVQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYPHNLIDLSFLVS 111

Query: 101 DCSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVK 160
           D S+D  T+  LLEY ++ QS                              +P   +   
Sbjct: 112 DSSDD--TMGVLLEYLQKAQS------------------------------KPDRTQR-- 137

Query: 161 DAYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 220
                         F +++I++KDFGQ IGQ FSDRH    QG RRKLMGRARNWL + A
Sbjct: 138 --------------FGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVA 183

Query: 221 LKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIES 280
           LKPYHSWVYWRD DVE  P ++++DLM  D DV VPNVWRPLP++L   QPYDLNSW ES
Sbjct: 184 LKPYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQES 243

Query: 281 DPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKL 340
           +  LQLA++LDED VIVEGY EY TWR HLAY+RDP  +P+D +ELDG+GGVSIL+KAK+
Sbjct: 244 EGGLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELDGIGGVSILSKAKV 303

Query: 341 FRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAERERE 400
           FR G HFPAF+FE HAETEAFGK+++++GY V GLPHY +WHIYEPS DDL  +A    E
Sbjct: 304 FRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEE 363

Query: 401 KKR 403
           +KR
Sbjct: 364 EKR 366

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  394 bits (1012), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 195/362 (53%), Positives = 244/362 (67%), Gaps = 48/362 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           VE+YDLR+++G+  G    + VL  VPLR+A + LP+ F ++  ++YPH LIDL+FLVSD
Sbjct: 53  VEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYPHNLIDLSFLVSD 112

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            S+D  T+  LL++ K+ QS T                                      
Sbjct: 113 SSDD--TMGVLLDHLKKAQSKT-------------------------------------- 132

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                      K F +++IF+KDFGQ IGQ FSDRH    QG RRKLMGRARNWL + AL
Sbjct: 133 --------DRKKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMGRARNWLGSVAL 184

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESD 281
           KPYHSWVYWRD DVE  P ++++DLM  D DV VPNVWRPLP++L   QPYDLNSW ES+
Sbjct: 185 KPYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWQESE 244

Query: 282 PALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLF 341
             +QLA++LDED VIVEGY EY TWR HLAY+RDP  NP+D +ELDG+GGVSIL+KAK+F
Sbjct: 245 GGMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELDGIGGVSILSKAKVF 304

Query: 342 RNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREK 401
           R G HFPAF+FE HAETEAFGK+++++GY V GLPHY +WHIYEPS DDL  +A    E+
Sbjct: 305 RAGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPSSDDLKHMAWMAEEE 364

Query: 402 KR 403
           KR
Sbjct: 365 KR 366

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  390 bits (1003), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 193/362 (53%), Positives = 243/362 (67%), Gaps = 48/362 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           V++YDL +++G+  G    + VL  VPLR+A   LP+ FK+L ++TYPH LIDL+FLVSD
Sbjct: 50  VDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYPHNLIDLSFLVSD 109

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            ++D  T+  LL    +LQS                 +  GT                  
Sbjct: 110 STDD--TMGVLLNSLHDLQS-----------------QADGT------------------ 132

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                      K F  ++IFQKDFGQIIGQ FSDRH    QG RRKLM RARNWL + A+
Sbjct: 133 -----------KRFGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSAAI 181

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESD 281
           KPYHSWVYWRD DVE  P ++++DLM  D D+ VPNVWRPLP++L   QPYDLNSW+ES+
Sbjct: 182 KPYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLNYIQPYDLNSWVESE 241

Query: 282 PALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLF 341
             LQLA +L EDDVIVEGY EY TWRVHLAY+RDP+ +P+  +ELDG+GGVSIL+KAK+F
Sbjct: 242 GGLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSKAKVF 301

Query: 342 RNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREK 401
           R G HFPAF+FE HAETEAFGK++++M Y V GLPHY +WH+YEPS DDL  +A    E+
Sbjct: 302 RTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEE 361

Query: 402 KR 403
           +R
Sbjct: 362 QR 363

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  385 bits (988), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 191/362 (52%), Positives = 238/362 (65%), Gaps = 50/362 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           VE YDL D+ G   G    + +L  VPLR+A + LP+ F +L  +TYPH LIDL+FLVSD
Sbjct: 54  VEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVSD 113

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            S  D T+  L+ + ++ Q                                         
Sbjct: 114 SS--DNTMGVLMHHLQQAQ----------------------------------------- 130

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                  K  +K F +++IF+KDFGQIIGQ FSDRH    QG RRKLM RARNWL + A+
Sbjct: 131 -------KDKNKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAI 183

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESD 281
           KPYHSWVYWRD DVE+ P S+++DLM  D DV VPNVWRPLP++L   QPYDLNSW+ES+
Sbjct: 184 KPYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESE 243

Query: 282 PALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLF 341
             LQLA TL ED VIVEGY EY TWR HLAY+RDP+ NP+D + LDG+GGVSIL+KA++F
Sbjct: 244 GGLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKARVF 303

Query: 342 RNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREK 401
           R G HFPAF+F+ HAETEAFGK++++MG+ V GLPHY +WHIYEPS DDL  +A    E+
Sbjct: 304 RAGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMAEEE 363

Query: 402 KR 403
           KR
Sbjct: 364 KR 365

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  385 bits (989), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 194/363 (53%), Positives = 239/363 (65%), Gaps = 49/363 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           VE+YDLR+++G   G      +L LVPLR+A Q LP  F ++  L+YPH LID++FLVSD
Sbjct: 57  VEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVSD 116

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            S+D  T+  LL + +  QS                                        
Sbjct: 117 SSDD--TMGELLHHLQIAQS---------------------------------------- 134

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                  K  +K F +++IF+KDFGQ IGQ FSDRH    QG RRKLM RARNWL +  L
Sbjct: 135 ------QKDRNKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVTL 188

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESD 281
           KPYHSWVYWRD DVE+ P S+++DLM  D DV VPNVWRPLP++L   QPYDLNSW ES+
Sbjct: 189 KPYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 248

Query: 282 PALQLAQTL-DEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKL 340
             +QLA TL DED VIVEGY E+ TWR HLAY+RDP+ NP+D +ELDG+GGVSILAKAK+
Sbjct: 249 AGIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAKAKV 308

Query: 341 FRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAERERE 400
           FR G HFPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DL  +A    E
Sbjct: 309 FRTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEE 368

Query: 401 KKR 403
           +KR
Sbjct: 369 EKR 371

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  386 bits (991), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 191/355 (53%), Positives = 235/355 (66%), Gaps = 48/355 (13%)

Query: 41  TVEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVS 100
           +VE YDLR+++G+  G    + +L  VPLR+A + LP+ F +L  +TYPH LIDL+FLVS
Sbjct: 61  SVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVS 120

Query: 101 DCSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVK 160
           D S  D T+  LL   +  QS                                       
Sbjct: 121 DSS--DNTMGVLLSNLQMAQS--------------------------------------- 139

Query: 161 DAYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 220
                   +   K F +++I++KDFGQIIGQ FSDRH    QG RRKLM RARNWL + A
Sbjct: 140 -------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVA 192

Query: 221 LKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIES 280
           LKPYHSWVYWRD DVE  P ++++DLM  D DV VPNVWRPLP++L   QPYDLNSW ES
Sbjct: 193 LKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKES 252

Query: 281 DPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKL 340
           +  LQLA +LDED VIVEGY EY TWR HLAY+RDP+ NP+D +ELDG+GGVSILAKAK+
Sbjct: 253 EGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKV 312

Query: 341 FRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIA 395
           FR G HFPAF+FE HAETEAFG+++++M Y V GLPHY +WHIYEPS DDL  +A
Sbjct: 313 FRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  385 bits (989), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 191/362 (52%), Positives = 239/362 (66%), Gaps = 48/362 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           VE YDL +++G+  G    + +L  VPLR+A + LP+ F +L  +TYPH LIDL+FLVSD
Sbjct: 82  VEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYPHNLIDLSFLVSD 141

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            S  D T+  LL   +  QS                                        
Sbjct: 142 SS--DNTMGVLLSNLQNAQS---------------------------------------- 159

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                  +   K F +++IF+KDFGQIIGQ FSDRH  K QG RRKLM RARNWL + A+
Sbjct: 160 ------QQDRSKRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRKLMARARNWLGSVAI 213

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESD 281
           KPYHSWVYWRD DVE  P ++++DLM  D DV VPNVWRPLP++L   QPYDLNSW ES+
Sbjct: 214 KPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESE 273

Query: 282 PALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLF 341
             LQLA +LDED VIVEGY EY TWR HLAY+RDP+ NP+D +EL+G+GGVSIL+KAK+F
Sbjct: 274 GGLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELNGIGGVSILSKAKVF 333

Query: 342 RNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREK 401
           R+G HFPAF+FE HAETEAFGK++++M + V GLPHY +WHIYEPS +DL  +A    E+
Sbjct: 334 RSGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPSKEDLKHMAWMAEEE 393

Query: 402 KR 403
           KR
Sbjct: 394 KR 395

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  384 bits (986), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 190/354 (53%), Positives = 233/354 (65%), Gaps = 48/354 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           VE YDLR+++G+  G    + +L  VPLR+A + LP+ F +L  +TYPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYPHNLIDLSFLVSD 121

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            S  D T+  LL    + QS                                        
Sbjct: 122 SS--DNTMGVLLSNLHKAQS---------------------------------------- 139

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                  +   K F +++I++KDFGQIIGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 140 ------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVAL 193

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESD 281
           KPYHSWVYWRD DVE  P ++++DLM  D DV VPNVWRPLP++L   QPYDLNSW ES+
Sbjct: 194 KPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 253

Query: 282 PALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLF 341
             LQLA  L+ED VIVEGY EY TWR HLAY+RDP+ NP+D +ELDG+GGVSILAKAK+F
Sbjct: 254 GGLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 313

Query: 342 RNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIA 395
           R G HFPAF+FE HAETEAFG+++++M Y V GLPHY +WHIYEPS DDL  +A
Sbjct: 314 RTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  384 bits (985), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 241/362 (66%), Gaps = 48/362 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           VE+YDL +++G+A G    + VL  VPLR+A + LP+ FK++  ++YPH LIDL+FLVSD
Sbjct: 82  VEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISYPHNLIDLSFLVSD 141

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            S+D  T+  LL   K+ QS                                        
Sbjct: 142 SSDD--TMGVLLSSLKKAQS---------------------------------------- 159

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                 ++   + F +++IF+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 160 ------NQDKSQRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAL 213

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESD 281
           KPYHSWVYWRD DVE  P ++++DLM  + DV VPNVWRPLP++L   QPYDLNSW ES+
Sbjct: 214 KPYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 273

Query: 282 PALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLF 341
             LQLA +L+ED VIVEGY EY TWR HLAY+RDP  +P+  +ELDG+GGVSIL+KAK+F
Sbjct: 274 GGLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMELDGIGGVSILSKAKVF 333

Query: 342 RNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREK 401
           R G HFPAF+FE HAETEAFGK++++M Y V GLPHY +WH+YEPS DDL  +A    E+
Sbjct: 334 RTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPSSDDLKHMAWMAEEE 393

Query: 402 KR 403
           KR
Sbjct: 394 KR 395

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  384 bits (985), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 189/354 (53%), Positives = 233/354 (65%), Gaps = 48/354 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           VE YDLR+++G+  G    + +L  VPLR+A + LP+ F +L  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYPHNLIDLSFLVSD 121

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            S  D T+  LL   +  QS                                        
Sbjct: 122 SS--DNTMGVLLSSLQTAQS---------------------------------------- 139

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                  +   K F +++I++KDFGQIIGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 140 ------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVAL 193

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESD 281
           KPYHSWVYWRD DV+  P ++++DLM  D DV VPNVWRPLP++L   QPYDLNSW ES+
Sbjct: 194 KPYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 253

Query: 282 PALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLF 341
             LQLA  LDED VIVEGY EY TWR HLAY+RDP+ NP+D +ELDG+GGVSILAKAK+F
Sbjct: 254 GGLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 313

Query: 342 RNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIA 395
           R G HFPAF+FE HAETEAFG+++++M Y V GLPHY +WHIYEPS DDL  +A
Sbjct: 314 RTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  382 bits (981), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 190/362 (52%), Positives = 244/362 (67%), Gaps = 48/362 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           VE+YDLR+++G++ G    + +L  VPLR+A + LP+ F++L  +TYPH  IDL+FLVSD
Sbjct: 62  VEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYPHNFIDLSFLVSD 121

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            S+D  T+  LL + +  QS                                   +M K 
Sbjct: 122 SSDD--TMGVLLSHLQSAQS-----------------------------------QMDKS 144

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                      K F +++I++KDFGQIIGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 145 -----------KRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAL 193

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESD 281
           KPYHSWVYWRD DVE  P ++++DLM  D DV VPNVWRPLP++L   QPYDLNSW ES+
Sbjct: 194 KPYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWQESE 253

Query: 282 PALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLF 341
             LQLA+ L+ED VIVEGY EY TWR HLAY+RDP+ +P++ +ELDG+GGVSIL+KAK+F
Sbjct: 254 GGLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVF 313

Query: 342 RNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREK 401
           R G HFPAF+FE HAETEAFG+++++M Y V GLPHY +WHIYEPS +DL  +A    E+
Sbjct: 314 RTGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWMAEEE 373

Query: 402 KR 403
           KR
Sbjct: 374 KR 375

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  382 bits (982), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 190/354 (53%), Positives = 233/354 (65%), Gaps = 48/354 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           VE YDLR+++G+  G    + +L  VPLR+A + LP+ F +L  ++YPH LIDL+FLVSD
Sbjct: 62  VEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYPHNLIDLSFLVSD 121

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            S  D T+  LL   +  QS                                        
Sbjct: 122 SS--DNTMGVLLSKLQMAQS---------------------------------------- 139

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                  +   K F +++I++KDFGQIIGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 140 ------QQDKTKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRKLMARARNWLGSVAL 193

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESD 281
           KPYHSWVYWRD DVE  P ++++DLM  D DV VPNVWRPLP++L   QPYDLNSW ES+
Sbjct: 194 KPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 253

Query: 282 PALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLF 341
             LQLA  LDED VIVEGY EY TWR HLAY+RDP+ NP+D +ELDG+GGVSILAKAK+F
Sbjct: 254 GGLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 313

Query: 342 RNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIA 395
           R G HFPAF+FE HAETEAFG+++++M Y V GLPHY +WHIYEPS DDL  +A
Sbjct: 314 RTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPSSDDLKHMA 367

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  382 bits (980), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 189/354 (53%), Positives = 233/354 (65%), Gaps = 48/354 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           VE YDL +++G+  G    + +L  VPLR+A + LP+ F +L  ++YPH  IDL+FLVSD
Sbjct: 87  VEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVSD 146

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            S+D  T+  LL   +  QS                                        
Sbjct: 147 SSDD--TMGVLLSNLQNAQS---------------------------------------- 164

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                  +   K F +++IF+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A+
Sbjct: 165 ------QQDKSKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAI 218

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESD 281
           KPYHSWVYWRD DVE  P ++++DLM  D DV VPNVWRPLP++L   QPYDLNSW ES+
Sbjct: 219 KPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKESE 278

Query: 282 PALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLF 341
             LQLA TL EDDVIVEGY EY TWR HLAY+RDP+ NP+D +ELDG+GGVSILAKAK+F
Sbjct: 279 GGLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAKAKVF 338

Query: 342 RNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIA 395
           R G HFPAF+FE HAETEAFGK+++KM Y V GLPHY +WHIYEPS +DL  +A
Sbjct: 339 RTGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  378 bits (971), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 186/364 (51%), Positives = 238/364 (65%), Gaps = 48/364 (13%)

Query: 40  STVEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLV 99
           +  E YDL+++ G++ G    + +L  VPLR+A + LP+ FK+L  +TYPH L+DL+FLV
Sbjct: 65  ANTEFYDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLV 124

Query: 100 SDCSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMV 159
           SD  +D  T+  LL   +  QS                                      
Sbjct: 125 SDSKDD--TMGVLLSNLQTAQS-------------------------------------- 144

Query: 160 KDAYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 219
                    K   K F +++ F+KDFGQIIGQ FSDRH    QG RRKLM RARNWL + 
Sbjct: 145 --------QKDRSKRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSV 196

Query: 220 ALKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIE 279
           A+KPYHSWVYWRD DVE  P ++++DLM    DV VPNVWRPLPE+L   QPYDLNSW E
Sbjct: 197 AIKPYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSWQE 256

Query: 280 SDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAK 339
           SD  L+LA +LD+D VIVEGY EY TWR HLAY+RDP+ +P+  +ELDG+GGVSIL+KA+
Sbjct: 257 SDAGLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKAR 316

Query: 340 LFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAERER 399
           +FR+G HFPAF+FE HAETEAFGK++++MGY V GLPHY +WHIYEPS +DL  +A    
Sbjct: 317 VFRSGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAWMAE 376

Query: 400 EKKR 403
           E++R
Sbjct: 377 EEQR 380

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  377 bits (967), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 191/363 (52%), Positives = 239/363 (65%), Gaps = 49/363 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           VE++DL    G A G    + VL  VPLR+A + LP+ FK+L  +TYPH L+DL+FLVSD
Sbjct: 42  VEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVSD 101

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
               D+T+  L ++ +ELQS                              +P   +    
Sbjct: 102 SK--DETMSVLRQHVRELQS------------------------------QPDNARQ--- 126

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                        F +++IFQKDFGQ IGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 127 -------------FGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAL 173

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESD 281
           KPYHSWVYWRD DVE  P ++I+DLM  D DV VPNVWRPLP++L   QPYDLNSW+ES+
Sbjct: 174 KPYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWVESE 233

Query: 282 PALQL-AQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKL 340
             LQL A T DED VIVEGY EY TWRVHLAY+RDP+ +P+  +ELDG+GGVSIL++A++
Sbjct: 234 GGLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSRARV 293

Query: 341 FRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAERERE 400
           FR+G HFPAF+F+ HAETE FGK+++ MGY V GLPHY +WHIYEPS DDL  +A    E
Sbjct: 294 FRSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEE 353

Query: 401 KKR 403
           ++R
Sbjct: 354 EQR 356

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  380 bits (977), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 237/362 (65%), Gaps = 48/362 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           V  YDL ++ G++ G    + +L  VPLR+A Q LP  F +L  +TYPH LIDL+FLVSD
Sbjct: 72  VHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFLVSD 131

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
             +D  T+  LL + +  QS                                        
Sbjct: 132 SKDD--TMGVLLSHLQTAQS---------------------------------------- 149

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                  +   K F +++I++KDFGQIIGQ FSDRH    QG RRKLM RARNWL + AL
Sbjct: 150 ------QQNKLKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAL 203

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESD 281
           KPYHSWVYWRD DVE CP ++++DLM    DV VPNVWRPLP++L   QPYDLNSW ES+
Sbjct: 204 KPYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNSWQESE 263

Query: 282 PALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLF 341
             LQLA +LDED VIVEGY EY TWR HLAY+RDP+ +P++ +ELDG+GGVSIL+KAK+F
Sbjct: 264 GGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILSKAKVF 323

Query: 342 RNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREK 401
           R+G HFPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DL  +A    E+
Sbjct: 324 RSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMAWMAEEE 383

Query: 402 KR 403
           KR
Sbjct: 384 KR 385

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  374 bits (960), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 187/365 (51%), Positives = 236/365 (64%), Gaps = 51/365 (13%)

Query: 41  TVEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVS 100
           +VE YD+ +++G   G      +L+ VPL++A   LPL FK L  +TYPHELIDL+FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 101 DCSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVK 160
           D S  D T+  LL   K LQ                                        
Sbjct: 114 DSS--DNTMYNLLNMLKRLQ---------------------------------------- 131

Query: 161 DAYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 220
                    G    F +++I++KDFGQ+IGQGFSDRH    QG RRKLMG+ARNWL   A
Sbjct: 132 ------IDGGTSGKFGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWLNTVA 185

Query: 221 LKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIES 280
           +KPYHSWVYWRD DVE+ P ++++DLM  D DV VPNVWRPLP++L   QPYDLNSW ES
Sbjct: 186 IKPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWKES 245

Query: 281 DPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKL 340
           +  L L+ +L ED VIVEGY EY TWR HLAY+RDP+ +P+  +ELDGVGGVSIL+KA +
Sbjct: 246 EAGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILSKANV 305

Query: 341 FRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIA---ER 397
           FR+G HFPAF+F+ HAETEAFGK++K M + V GLP+Y +WHIYEPS +DL  +A   E+
Sbjct: 306 FRSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQYMAKLEEK 365

Query: 398 EREKK 402
           ER K+
Sbjct: 366 ERLKR 370

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  374 bits (960), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 236/362 (65%), Gaps = 48/362 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           VE+YDL +++G+A G    + V+  VPLR+A   L + F  L  LTYPH LIDL+FLVSD
Sbjct: 57  VEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVSD 116

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            S+D  T++ LL + +  QS                                        
Sbjct: 117 SSDD--TMKTLLSHLRRAQS---------------------------------------- 134

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                 ++   + F +++IF+KDFGQ +GQ FSDRH    QG RRK M RARNWL + AL
Sbjct: 135 ------NQDKSRRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGSAAL 188

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESD 281
           KPYHS+VYWRD DV+  P ++++DLM  D DV VPNVWRPLP++L   QPYDLNSW+ES+
Sbjct: 189 KPYHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWVESE 248

Query: 282 PALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLF 341
             LQLA +LDED  IVEGY EY TWR HLAY+RDP  +P+  +ELDG+GGVSIL+KAK+F
Sbjct: 249 GGLQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKAKVF 308

Query: 342 RNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAEREREK 401
           R G HFPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS DDL  +A    E+
Sbjct: 309 RTGSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMAWMAEEE 368

Query: 402 KR 403
           KR
Sbjct: 369 KR 370

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  379 bits (973), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 188/356 (52%), Positives = 236/356 (66%), Gaps = 49/356 (13%)

Query: 41  TVEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVS 100
            VE+YDLR+++G   G      +L LVPLR+A + LP  F ++  +TYPH LID +FLVS
Sbjct: 62  NVEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYPHNLIDFSFLVS 121

Query: 101 DCSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVK 160
           D S+D  T+ ALL + ++ QS                                       
Sbjct: 122 DSSDD--TMGALLSHLEKAQS--------------------------------------- 140

Query: 161 DAYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 220
                  +K   + F +++I++KDFGQ IGQ FSDRH    QG RRKLM RARNWL   A
Sbjct: 141 -------NKDKTRRFGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRKLMARARNWLGTVA 193

Query: 221 LKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIES 280
           LK YHSWVYWRD DVELCP S+++DLM  D DV VPNVWRPLP++L   QPYDLNSW ES
Sbjct: 194 LKAYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWKES 253

Query: 281 DPALQLAQTLDEDD-VIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAK 339
           +  +QLA +L +DD VIVEGY +Y TWR HLAY+RDP+ NP+D +ELDG+GGVSIL+K K
Sbjct: 254 EVGVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELELDGIGGVSILSKGK 313

Query: 340 LFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIA 395
           +FR G HFPAF+FE HAETEAFGK++++MGY V GLPHY +WHIYEPS +DL  +A
Sbjct: 314 VFRTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEPSTEDLQHMA 369

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  380 bits (976), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 182/354 (51%), Positives = 236/354 (66%), Gaps = 48/354 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           VE YDL +++G+  G    + +L  +PLR+A Q LP+ F ++  +TYPH L+DL+FLVSD
Sbjct: 66  VEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYPHNLVDLSFLVSD 125

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            S+D  T+  LL + + +QS                                        
Sbjct: 126 SSDD--TMGVLLSHLQTVQS---------------------------------------- 143

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                  +   K F +++I++KDFGQIIGQ FSDRH    QG RRKLM +ARNWL + AL
Sbjct: 144 ------QQDKSKRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMAKARNWLGSVAL 197

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESD 281
           KPYHSWVYWRD D+E  P ++++DLM  D D+ VPNVWRPLP++L   QPYDLNSW ES+
Sbjct: 198 KPYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQESE 257

Query: 282 PALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLF 341
             LQLA  LDE+ VIVEGY EY TWR HLAY+RDP+ +P+D +ELDG+GGVSIL+KAK+F
Sbjct: 258 GGLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELDGIGGVSILSKAKVF 317

Query: 342 RNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIA 395
           R+G HFPAF+FE HAETEAFGK++++M Y V GLPHY +WHIYEPS +DL  +A
Sbjct: 318 RSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMA 371

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  375 bits (963), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 182/351 (51%), Positives = 231/351 (65%), Gaps = 48/351 (13%)

Query: 41  TVEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVS 100
            VE YDLR+++G+  G    + ++  VPLR+A Q LP  F +L  ++YPH LIDL+FLVS
Sbjct: 64  NVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFLVS 123

Query: 101 DCSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVK 160
           D S+D  T+  LL   +  QS                                       
Sbjct: 124 DSSDD--TMGVLLSNLQTAQS--------------------------------------- 142

Query: 161 DAYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 220
                   +   K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL + A
Sbjct: 143 -------QRDKSKRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNWLGSVA 195

Query: 221 LKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIES 280
           LKPYHSWVYWRD D+E  P ++++DLM  D D+ VPNVWRPLP++L   QPYDLNSW ES
Sbjct: 196 LKPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNSWQES 255

Query: 281 DPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKL 340
           +  LQLA  L+ED VIVEGY EY TWR HLAY+RDP+ +P+  +ELDG+GGVSIL+KA +
Sbjct: 256 EGGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKANV 315

Query: 341 FRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDL 391
           FR+G HFPAF+FE HAETEAFGK++++MGY V GLPHY +WHIYEPS +DL
Sbjct: 316 FRSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDL 366

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  205 bits (522), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 120/347 (34%), Positives = 179/347 (51%), Gaps = 53/347 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL   + ++   VN+E VL+L P++   Q     + NL++LTYP  LI+L F++  
Sbjct: 96  IAHYDLNKLKSTSNALVNKERVLILTPMQTFHQQ---YWNNLLSLTYPRALIELGFIIPR 152

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            +  D  L+ L    +E+Q+G                                       
Sbjct: 153 TASGDAALQKLESAVREVQTGK-------------------------------------- 174

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                     DK F  + I ++        G  DRHA++VQ  RR  M  ARN L  + +
Sbjct: 175 ---------QDKRFAKITILRQASQSFDRLGEKDRHALEVQKERRAAMALARNELLFSTI 225

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQ---PYDLNSWI 278
            P+ SW+ W DAD+   P +VIQDL S +  V   NV++   +  Q ++   PYD N+W 
Sbjct: 226 GPHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQKFYDKDQKKESIRPYDFNNWA 285

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKA 338
           ES+  L+LAQ L ++++IVEGY+E  T+R  +A+  D +     ++ELDGVGG   L KA
Sbjct: 286 ESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELDGVGGGCTLVKA 345

Query: 339 KLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYE 385
           ++ R+G  F  F F +  ETEAF KMAK++GY V GLP+Y ++HI E
Sbjct: 346 EVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  197 bits (501), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 118/347 (34%), Positives = 176/347 (50%), Gaps = 53/347 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL     ++   +N+E +L+L P++   Q     ++NL+ LTYP ELI+L F+   
Sbjct: 94  IAHYDLNKLHSTSDAAINKEKILILTPIQKFHQE---YWENLLQLTYPRELIELGFIAPR 150

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
               D+ L AL     ++QS                                        
Sbjct: 151 TPTGDQALAALEAAVDKVQSDK-------------------------------------- 172

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                     ++ F  V I ++D          +RHA++VQ  RR  M  ARN L  + +
Sbjct: 173 ---------KNQRFSKVTILRQDSVGFNKLTEKERHALEVQKERRASMALARNELLFSTI 223

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQ---PYDLNSWI 278
            P+ SWV W DAD+   P S+IQD+ + D  V   NV++   +  + ++   PYD N+W 
Sbjct: 224 GPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQRYYDEEKKQKAIRPYDFNNWQ 283

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKA 338
           ESD  L+LA  + +D++IVEGYAE  T+R  +AY  DPD++  + + LDGVGG   L KA
Sbjct: 284 ESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPDNSVAEEMRLDGVGGGCTLVKA 343

Query: 339 KLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYE 385
           ++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 344 EVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 390

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  197 bits (500), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 124/348 (35%), Positives = 179/348 (51%), Gaps = 55/348 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL     +    +N+E VL+L P++N  Q     + NL+ LTYP ELI+L F+V  
Sbjct: 95  IAHYDLNKLTSTQNAALNKEQVLILTPMQNFHQK---YWDNLLQLTYPRELIELGFIVPR 151

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
               +  LE L    K++Q+G   D F                           + +++ 
Sbjct: 152 TGSGNVALEQLEAAVKKVQTGKKEDRFGK-------------------------ITILRQ 186

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
           A S  F K  +K                     +RHA++VQ  RR  M  ARN L  + +
Sbjct: 187 A-SQSFDKLLEK---------------------ERHALEVQKERRAAMALARNELLFSTI 224

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQ---PYDLNSWI 278
            PY SW+ W DAD+   P SVI+D+ + +  V   NV++   +  Q ++   PYD N+W 
Sbjct: 225 GPYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQRYYDQEQKKESIRPYDYNNWA 284

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDI-IELDGVGGVSILAK 337
           ESD  LQLA  +  D+++VEGY E  T+R  +A+  + DS P  + +ELDGVGG   L K
Sbjct: 285 ESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYE-DSAPATVEMELDGVGGGCTLVK 343

Query: 338 AKLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYE 385
           A + R+G  FP F F +  ETE F KMAK++GY V GLP+Y ++HI E
Sbjct: 344 ADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIDE 391

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  196 bits (498), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 121/353 (34%), Positives = 175/353 (49%), Gaps = 59/353 (16%)

Query: 39  DSTVEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFL 98
           ++ + HYDL     + Q  VN+E VL+L P++   +     + N++++TYP ELI+L F+
Sbjct: 94  ENHIAHYDLNKLHSTKQAAVNKERVLILTPMQTFHEQ---YWDNILHMTYPRELIELGFI 150

Query: 99  VSDCSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKM 158
                  D  L+ L    K++QSG  ++ FA                             
Sbjct: 151 APRTPTGDAALKKLEAAIKKIQSGKKNERFA----------------------------- 181

Query: 159 VKDAYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTA 218
                              + I +++          DRHA+ VQ  RR  M  ARN L  
Sbjct: 182 ------------------KIIILRQESQSFDMLAEKDRHALAVQKQRRSAMALARNELLF 223

Query: 219 NALKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGE------QPY 272
           + L P+ SWV W DAD+   P +VIQDL + D  V   NV++    F   E      +PY
Sbjct: 224 STLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RFFNDELSKADIRPY 280

Query: 273 DLNSWIESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGV 332
           D N+W ES+  L+LA +L  D++IVEGYAE  T+R  +A+  D      + + LDGVGG 
Sbjct: 281 DFNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEEMALDGVGGG 340

Query: 333 SILAKAKLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYE 385
             L KA++ R+G  FP F F +  ETE F KMAK++GY V GLP+Y ++HI E
Sbjct: 341 CTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIEE 393

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  196 bits (497), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 119/347 (34%), Positives = 172/347 (49%), Gaps = 53/347 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL     +A   VN+E VL+L P++   +     ++NL+ LTYP ELI+L F++  
Sbjct: 99  IAHYDLNKLRSTAYAAVNKERVLILTPMQTFHKQY---WENLLQLTYPRELIELGFIIPR 155

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
               +  L+ L    K++QS   +  FA                                
Sbjct: 156 TKTGENALKELEIAIKKVQSDKKNQRFA-------------------------------- 183

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                           + I ++D          DRH++ VQ  RR  M  ARN L  + L
Sbjct: 184 ---------------KITILRQDSQSFDQLAEKDRHSILVQKERRAAMALARNELLFSTL 228

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPL---PEFLQGEQPYDLNSWI 278
            P+ +WV W DAD+   P +VIQD+ S D  V   NV++      E     +PYD N+W 
Sbjct: 229 GPHTAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQKYFDNDEKKMAIRPYDFNNWR 288

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKA 338
           ESD  L++A  +DE+++IVEGY+E  T+R  +A+  + D    D +ELDGVGG   L KA
Sbjct: 289 ESDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELDGVGGGCTLVKA 348

Query: 339 KLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYE 385
            + R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 349 DVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  194 bits (492), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 118/353 (33%), Positives = 184/353 (52%), Gaps = 59/353 (16%)

Query: 39  DSTVEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFL 98
           ++ + HYDL     ++   VN+E VL+L P++         ++NL+ LTYP ELI+L F+
Sbjct: 91  ENHIAHYDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---WQNLLQLTYPRELIELGFI 147

Query: 99  VSDCSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKM 158
           +      D  L+AL    K++Q+            D++                      
Sbjct: 148 LPRSDSGDAALKALEAAVKKVQT------------DKK---------------------- 173

Query: 159 VKDAYSPPFHKGYDKPFRSVQIFQKD---FGQIIGQGFSDRHAVKVQGIRRKLMGRARNW 215
                        ++ F  + I ++D   FGQ++ +   +RHA+ VQ  RR  M  ARN 
Sbjct: 174 -------------NQRFSKITILRQDSQGFGQLMEK---ERHALHVQKERRAAMALARNE 217

Query: 216 LTANALKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQ---PY 272
           L  + + P+ SWV W DAD+   P +VIQD+ + D  V   NV++   +  + E+    Y
Sbjct: 218 LLFSTIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQRYFDEEKKEKSIRAY 277

Query: 273 DLNSWIESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGV 332
           D N+W ESD  LQ+A  +++D++IVEGY+E  T+R  +A+  DP ++    + LDGVGG 
Sbjct: 278 DFNNWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPTASVNSEMMLDGVGGG 337

Query: 333 SILAKAKLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYE 385
             L KA + R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++H+ E
Sbjct: 338 CTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHMEE 390

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  191 bits (484), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 110/347 (31%), Positives = 172/347 (49%), Gaps = 53/347 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL     +      +EHVL+  P++         + NL+ ++YP  L++L F++  
Sbjct: 96  IAHYDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY---WSNLLKMSYPRSLLELGFIIPR 152

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
               D+TL+ L    K +Q+G + D FA                                
Sbjct: 153 TPTGDETLKKLEAAVKNVQTGKVEDRFA-------------------------------- 180

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                           + I ++D       G  +RH++ VQ  RR  M  ARN L  +++
Sbjct: 181 ---------------KITILRQDSQSFDKLGEKERHSLAVQKERRSAMALARNELLFSSI 225

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGE---QPYDLNSWI 278
            P  SWV W DAD+   P +VIQD+ + +  V   NV++   +  + E   +PYD N+W 
Sbjct: 226 GPSTSWVLWLDADIVETPATVIQDMTNHNKPVLAANVYQRFFDKEKNENSIRPYDFNNWA 285

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKA 338
           ES+  L++A+ ++ED++IVEGYAE  T+R  +A+  D       ++ LDGVGG   L KA
Sbjct: 286 ESEKGLEIAKNMNEDEIIVEGYAEIATYRPLMAHFYDKAGKIDALMALDGVGGGCTLVKA 345

Query: 339 KLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYE 385
           ++ R+G  FP F F +  ETE F KMAK++ Y + GLP+Y ++HI E
Sbjct: 346 EVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIFGLPNYLVYHIEE 392

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  189 bits (480), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 112/347 (32%), Positives = 172/347 (49%), Gaps = 53/347 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL     + +   N+E VL+L P++         + NL+ LTYP +LI+L F++  
Sbjct: 96  ISHYDLNKLTSTDKAFANKEQVLILTPMQTFHDQY---WDNLLQLTYPRDLIELGFIIPR 152

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            +  D  L  L    K  Q G                                       
Sbjct: 153 TATGDTALRKLEAAVKRTQLGK-------------------------------------- 174

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                     D+ F  + I ++D          +RHA+KVQ  RR  M  ARN L  + +
Sbjct: 175 ---------KDQRFSKITILRQDSQSFDSLQEKERHALKVQKERRAAMALARNELLFSTI 225

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRP-LPEFLQ--GEQPYDLNSWI 278
            P+ SW+ W DAD+   P S+IQD+ + +  V   NV++  + E  +   E+PYD N+W 
Sbjct: 226 GPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQKYMNEETKKIAERPYDFNNWA 285

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKA 338
           +S+ ALQ+A  + +D+V+ EGYAE PT+R  +A++ D   +    + LDGVGG   L KA
Sbjct: 286 DSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASGSQAAEMSLDGVGGGCTLVKA 345

Query: 339 KLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYE 385
           ++ R+G  FP+F F +  ETE F KMA+++ Y + GLP+Y ++HI E
Sbjct: 346 EVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNYLVYHIEE 392

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  189 bits (480), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 114/347 (32%), Positives = 176/347 (50%), Gaps = 53/347 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL     ++   VN+EHVL+L P++   Q     + NL+ L+YP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTSDAAVNKEHVLILTPMQTFHQQ---YWDNLLQLSYPRELIELGFITPR 152

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            +  D  L+ L    K++Q+   +  F+  +               L+    S+ K+++ 
Sbjct: 153 TATGDLALKNLENAIKKVQTDKKTQRFSKIT--------------ILRQNSQSFDKLME- 197

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                                            +RHA+ VQ  RR  M  ARN L  + +
Sbjct: 198 --------------------------------KERHALDVQKERRAAMALARNELLFSTI 225

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGE---QPYDLNSWI 278
            P+ SW+ W DAD+   P S+IQD+   D  V   N+++   +  + +   +PYD N+W 
Sbjct: 226 GPHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQRFYDQEKKQPSIRPYDFNNWQ 285

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKA 338
           ESD  L++A  + +D++IVEGYAE  T+R  +A+  + D  P + + LDGVGG   L KA
Sbjct: 286 ESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALDGVGGGCTLVKA 345

Query: 339 KLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYE 385
            + R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 346 DVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  189 bits (480), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 116/347 (33%), Positives = 174/347 (50%), Gaps = 53/347 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL     +     N+EHVL+L P++   Q     + NL+ LTYP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTPDAAANKEHVLILTPMQTFHQQY---WDNLLQLTYPRELIELGFITPR 152

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            +  D  L+ L    K++Q+   +  F+                  +  MR +       
Sbjct: 153 TATGDLALKKLENAVKKVQADKKAQRFSK-----------------ITIMRQN------- 188

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
             S  F K  +K                     +RHA+ VQ  RR  M  ARN L  + +
Sbjct: 189 --SQSFDKLMEK---------------------ERHALDVQKERRAAMALARNELLFSTI 225

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGE---QPYDLNSWI 278
            P+ SWV W DAD+   P ++IQD+   +  V   N+++   +  + +   +PYD N+W 
Sbjct: 226 GPHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQRFYDQEKKQSSIRPYDFNNWQ 285

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKA 338
           ESD  L++A  +D+D++IVEGYAE  T+R  +A+    +  P   + LDGVGG   L KA
Sbjct: 286 ESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLDGVGGGCTLVKA 345

Query: 339 KLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYE 385
           ++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 346 EVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  191 bits (484), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 114/347 (32%), Positives = 173/347 (49%), Gaps = 53/347 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL     +A   +N+E VL+L P++   +     + NL+ LTYP EL++L F++  
Sbjct: 155 ITHYDLNKLTSTANAALNKEQVLILTPMQTFHEE---YWNNLLQLTYPRELLELGFIIPR 211

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            +  D  L  L    K+ Q                L K+                     
Sbjct: 212 TTSGDNALRKLEAAVKKTQ----------------LSKK--------------------- 234

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                     D+ F  + I ++D          DRHA++VQ  RR  M  ARN L  + +
Sbjct: 235 ----------DQRFLKITILRQDSQSFDLLKEKDRHALEVQKKRRSAMALARNELLFSTI 284

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQ---PYDLNSWI 278
            PY SWV W DAD+   P ++IQD+ + D  V   NV++   +   G++   PYD N+W 
Sbjct: 285 GPYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTKGPYDFNNWA 344

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKA 338
           +SD ALQ+A ++ +D V+ EGY E  T+R  +A+      +P   + LDGVGG   L KA
Sbjct: 345 DSDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGVGGGCTLVKA 404

Query: 339 KLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYE 385
           ++ R+G  FP+F F +  ETE F KMA+++ Y + GLP+Y ++HI E
Sbjct: 405 EVHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  189 bits (480), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 112/347 (32%), Positives = 177/347 (51%), Gaps = 53/347 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL     +++  VN+EH+L+L P++   Q     + NL+ L YP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIELGFITPR 152

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            +  D  L+ L    K++Q+   +  F+  +               L+    S+ K+++ 
Sbjct: 153 TATGDLALKKLENAIKKVQTDKKTQRFSKIT--------------ILRQNSQSFDKLME- 197

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                                            +RHA+ VQ  RR  M  ARN L  + +
Sbjct: 198 --------------------------------KERHALDVQKERRAAMALARNELLFSTI 225

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGE---QPYDLNSWI 278
            P+ SWV W DAD+   P S+IQD+   +  +   N+++   +  + +   +PYD N+W 
Sbjct: 226 GPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNNWQ 285

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKA 338
           ESD  L++A  + +D++IVEGYAE  T+R  +A+  D +  P + + LDGVGG   L KA
Sbjct: 286 ESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLVKA 345

Query: 339 KLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYE 385
           ++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 346 EVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  188 bits (478), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 111/349 (31%), Positives = 173/349 (49%), Gaps = 53/349 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           +  +DL     +    +N+E VL+L PL+   Q     ++N++ L+YP ELI+L F+V  
Sbjct: 97  IAEFDLNKLHSTKDASINKEKVLILTPLQKFHQE---YWENILQLSYPRELIELGFIVPR 153

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
               D  L++L +  ++ Q+   +  FA                                
Sbjct: 154 TQTGDLALQSLEKAVEKTQTDKKNQRFA-------------------------------- 181

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                           V I ++D          +RHA+ VQ  RR  M  ARN L  + +
Sbjct: 182 ---------------KVTILRQDSESFNKLAEKERHALNVQKERRSSMALARNELLFSTI 226

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPL---PEFLQGEQPYDLNSWI 278
            P+ SWV W DAD+   P ++IQD+ + D  V   NV++      +     +PYD N+W 
Sbjct: 227 GPHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQRYYDDEKKASATRPYDFNNWQ 286

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKA 338
           ES+  L+LA  +++D++IVEGY+E  T+R  +AY  D      + + LDGVGG   L KA
Sbjct: 287 ESEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMILDGVGGGCTLVKA 346

Query: 339 KLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPS 387
           ++ R+G  FP+F F +  ETE F KMAK++GY + GLP+Y ++HI E +
Sbjct: 347 EVHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEETN 395

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  187 bits (475), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 116/350 (33%), Positives = 177/350 (50%), Gaps = 53/350 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL     +A+  +N+E VL+L P++   +     + NL+ LTYP ELI+L F+V  
Sbjct: 97  IAHYDLNKLHSTAKAALNKEQVLILTPMQTFHEQ---YWDNLLQLTYPRELIELGFIVPR 153

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
               D  L  L E  K++Q+            D++                         
Sbjct: 154 TQSGDVALAKLEEAVKKVQT------------DKK------------------------- 176

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                     ++ F  V I ++D          +RHA+ VQ  RR  M  ARN L  + +
Sbjct: 177 ----------NQRFVKVTILRQDSKSFDKLQEKERHALAVQKERRAAMALARNELLFSTI 226

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGE---QPYDLNSWI 278
            P+ SWV W DAD+   P ++IQD+ + +  V   NV++   +  + E   + YD N+W 
Sbjct: 227 GPHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQRYYDEEKKESSIRAYDFNNWA 286

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKA 338
           ES+  L+LA  + ED++IVEGY+E  T+R  +AY  D + +P   + LDGVGG   L +A
Sbjct: 287 ESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGAEMALDGVGGGCTLVQA 346

Query: 339 KLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSD 388
            + R+G  FP F F +  ETE F KMAK++ + V GLP+Y ++HI E +D
Sbjct: 347 DVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYHIEEWND 396

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  187 bits (475), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 115/349 (32%), Positives = 177/349 (50%), Gaps = 53/349 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL     +A+  +N+EHVL+L P++   Q     + NL+ LTYP E  +L F++  
Sbjct: 97  IAHYDLNKLHSTAEAALNKEHVLILTPMQTFHQEY---WDNLLQLTYPREFTELGFILPR 153

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            S  D  L  L    K++Q+   +  F    S   ++++                     
Sbjct: 154 TSSGDIALSKLEAAVKKVQTDKKNQRF----SKITILRQNSA------------------ 191

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                   G+DK      + +K+           RHA++VQ  RR  M  ARN L  ++L
Sbjct: 192 --------GFDK------LMEKE-----------RHALEVQKERRSAMASARNELLFSSL 226

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGE---QPYDLNSWI 278
            P  SWV W DAD+   P ++IQD+ S +  V   NV++   +    +   +PYD N+W 
Sbjct: 227 GPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQKYYDDQAKKVQIRPYDFNNWQ 286

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKA 338
           ESD AL+LA+ + +D+++VEGY +  T+R  +AY  D        + LDGVGG   L KA
Sbjct: 287 ESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNAEMNLDGVGGGCTLVKA 346

Query: 339 KLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPS 387
            + R+G  FP F F +  ETE F KMA+++ Y + GLP+Y ++HI E +
Sbjct: 347 DVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYHIEETN 395

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  187 bits (475), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 114/350 (32%), Positives = 178/350 (50%), Gaps = 53/350 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           V  YDL     ++   VN+E VL+L P++   Q     + NL+ LTYP +L++L F++  
Sbjct: 94  VAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQAY---WDNLLQLTYPRDLLELGFIIPK 150

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            +  D  L+ L    K  Q+   ++ F   +    ++++                     
Sbjct: 151 SASGDAALKQLEAAVKRAQTDKKNNRFGKVT----ILRQDS------------------- 187

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                  KG+DK        Q+           +RHA+ VQ  RR  M  ARN L  + +
Sbjct: 188 -------KGFDK-------LQE----------KERHALAVQKERRSAMALARNELLFSTI 223

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGE---QPYDLNSWI 278
            P+ SWV W DAD+     S+IQD+ + +  V   NV++   +  + +   +PYD N+W 
Sbjct: 224 GPHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQRYFDEAENKPSIRPYDFNNWA 283

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKA 338
           +S  A +L   + +D++IVEGYAE  T+R  +A+   PD  P +++ LDGVGG   L KA
Sbjct: 284 DSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDGVGGGCTLVKA 343

Query: 339 KLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYEPSD 388
           ++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E +D
Sbjct: 344 EVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  185 bits (469), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 115/347 (33%), Positives = 173/347 (49%), Gaps = 53/347 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL     +    VN+EH+L+L P++   Q     + NL+ L YP ELI+L F+   
Sbjct: 96  IAHYDLNKLHSTPDAAVNKEHILILTPMQTFHQQ---YWDNLLQLNYPRELIELGFITPR 152

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
            +  D  L+ L    K++Q+                           K  R S + +++ 
Sbjct: 153 TATGDSALKKLESAIKKVQTDK-------------------------KTQRFSKITILRQ 187

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
             S  F K  +K                     +RHA++VQ  RR  M  ARN L  + +
Sbjct: 188 N-SQSFDKLMEK---------------------ERHALEVQKERRAAMALARNELLFSTI 225

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGE---QPYDLNSWI 278
            P+ SWV W DAD+   P S+IQD+   +  V   N+++   +  + +   +PYD N+W 
Sbjct: 226 GPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQRFYDQEKKQASIRPYDFNNWQ 285

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKA 338
           ESD  L +A  + +D++IVEGYAE  T+R  +A+  D      + + LDGVGG   L KA
Sbjct: 286 ESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALDGVGGGCTLVKA 345

Query: 339 KLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYE 385
           ++ R+G  FP F F +  ETE F KMAK++ Y V GLP+Y ++HI E
Sbjct: 346 EVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  182 bits (461), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 114/350 (32%), Positives = 176/350 (50%), Gaps = 59/350 (16%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL     ++    ++EHVL+L P++   +     ++NL+ L+YP ELI+L F++  
Sbjct: 96  IAHYDLNKLHSTSDSISDKEHVLVLTPMQTFHEK---YWENLLKLSYPRELIELGFIIPR 152

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
               D  L+ L    K +QS   ++ F    S   +++++                    
Sbjct: 153 SDAGDAALKKLETAVKNVQSDKKNNRF----SKITILRQE-------------------- 188

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
             S  F K  +K                     +RH++ VQ  RR  M  ARN L  + L
Sbjct: 189 --SQSFDKLEEK---------------------ERHSLAVQKERRAAMALARNELLFSTL 225

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQ------PYDLN 275
            P+ SWV W D+D+   P +VI+ +   D  V   NV++    F   ++      PYD N
Sbjct: 226 GPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQ---RFFDNDKQQDSIRPYDFN 282

Query: 276 SWIESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSIL 335
           +W ESD  LQLA  + +D++IVEGYAE  T+R  +A+  +P  +  + + LDGVGG   L
Sbjct: 283 NWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNPSGDVGEEMALDGVGGGCTL 342

Query: 336 AKAKLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYE 385
            KA++ R+G  FP F F +  ETE F KMAK++ Y V GLP++ ++HI E
Sbjct: 343 VKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNFLVYHIEE 392

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  180 bits (456), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 116/349 (33%), Positives = 171/349 (48%), Gaps = 58/349 (16%)

Query: 39  DSTVEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFL 98
           D  +  YDL   + +A    N E VL+L P++   Q     + NL+ LTYP + I L FL
Sbjct: 91  DDRLREYDLNTLQSTAMAAANGEQVLILTPMQIFHQQ---YWDNLLLLTYPRKYIHLGFL 147

Query: 99  VSDCSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKM 158
           +   S  +  L  L +  +++Q+G                              P     
Sbjct: 148 LPRTSSGNTALRKLEKAVRKVQTG------------------------------PK---- 173

Query: 159 VKDAYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTA 218
                        D+ F  + I ++DF        S RH   VQ  RR  M  ARN L  
Sbjct: 174 -------------DQRFGKITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLF 220

Query: 219 NALKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGE---QPYDLN 275
           + + PY SWV W D+D+   P ++I+D+ S +  +   NV++   E   GE   + YDLN
Sbjct: 221 STIGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQRYVE--NGEPAIRAYDLN 278

Query: 276 SWIESDPALQLAQTLDEDDVIVEGYA-EYPTWRVHLAYLRDPDSNPKD-IIELDGVGGVS 333
           +W ES+  L++A  L ED +IVEGY  E+ T+R  +A++   D  PKD ++ LDGVGG  
Sbjct: 279 NWAESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYS-DKRPKDELMALDGVGGGC 337

Query: 334 ILAKAKLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWH 382
            L KA++ R+G  FP F F +  ETE F KMAK++ Y + GLP+Y ++H
Sbjct: 338 TLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  177 bits (448), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 110/344 (31%), Positives = 170/344 (49%), Gaps = 52/344 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL   + SA    N+EHVL+L PL++ EQ     + NL+ L+YP + I+L F++  
Sbjct: 103 IAHYDLNKLQSSANAAENKEHVLILTPLKSFEQG---YWDNLLKLSYPRDAIELGFIIPR 159

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
             + D +L+ L    K++Q+    D F+                  +  +R +       
Sbjct: 160 TKKGDHSLKKLESAIKKVQTAKQGDKFSK-----------------ITILRQN------- 195

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                  KG++      ++ + ++ + I                R  M  ARN L A+ L
Sbjct: 196 ------SKGFETVPEKKEVSEIEYEKQI----------------RAEMALARNELLASTL 233

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGE---QPYDLNSWI 278
            P  +W+ W D+D+   P S+IQD+   D  V   NV+    +   GE   +PYD  +WI
Sbjct: 234 GPQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDRESGELSIRPYDFRNWI 293

Query: 279 ESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKA 338
           ES  ALQLA  + ED++IVEG A   T R  + +    D +P   I LDGVG   +L K+
Sbjct: 294 ESTEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSSEISLDGVGASCLLVKS 353

Query: 339 KLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWH 382
           ++ R+G  FP F F +  E+E F KMAK++ Y V GLP+Y ++H
Sbjct: 354 EVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  175 bits (443), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 108/346 (31%), Positives = 168/346 (48%), Gaps = 52/346 (15%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           +  YD+     ++    N+E VL+L P++         ++NL++LTYP +L  L F++  
Sbjct: 95  IMKYDMNTLTTTSSPLANKEIVLILTPMQKFHDKY---WENLLSLTYPRKLTQLGFIIPR 151

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
               D  ++ L +  K++QSG                KE                     
Sbjct: 152 TPTGDVAMKRLEDAVKKVQSG----------------KE--------------------- 174

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
                     ++ F  + I ++D          +RHA  VQ  RR  M  ARN L  + +
Sbjct: 175 ----------NQRFLKITILRQDSQSFNKLDEKERHAFNVQKERRAAMALARNELVFSTI 224

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGE--QPYDLNSWIE 279
            P  SW+ W DAD+   P +VIQD+ + D  +   NV++   +    E  +PYD N+W E
Sbjct: 225 GPSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQRYIDDQNQENIRPYDFNNWQE 284

Query: 280 SDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAK 339
           S   L++A ++ +D++IVE Y E  T+R  +A L DP+ +P   + LDGVGG   L KA+
Sbjct: 285 SQTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCTLVKAQ 344

Query: 340 LFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWHIYE 385
           + R+G  FP F F +  ETE F  MAK++ Y V GLP+Y ++H  E
Sbjct: 345 VHRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  167 bits (422), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 110/342 (32%), Positives = 180/342 (52%), Gaps = 45/342 (13%)

Query: 42  VEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSD 101
           + HYDL     SA    N+EHVL+L PL++ ++     ++NL+NL+YP +LI+L F+V +
Sbjct: 102 IAHYDLNKLVSSANALENKEHVLILTPLQSFDEK---YWENLLNLSYPRDLIELGFMVPN 158

Query: 102 CSEDDKTLEALLEYCKELQSGTLSDVFAAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKD 161
             + D+ L+ L    K +Q                + K+ G++    K+ + + L+  KD
Sbjct: 159 TKKGDQILKQLENAVKNVQG---------------IDKKLGSN----KFAKITILRQ-KD 198

Query: 162 AYSPPFHKGYDKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 221
           +    FHK  D+         KD  ++        + ++++  +R  M  ARN L ++ L
Sbjct: 199 S---GFHKFNDR---------KDKKEM--------NDIELEKEKRAEMALARNELLSSTL 238

Query: 222 KPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWR--PLPEFLQGEQPYDLNSWIE 279
               +W+ W D++V   P ++IQD+   D  V   NV+      +     +PYD  +WIE
Sbjct: 239 SHSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDKDKANIRPYDFRNWIE 298

Query: 280 SDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAK 339
           SD ALQLA  + ED++IVEG A   T R  +    + D +P + + LDG+G    L K++
Sbjct: 299 SDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAACTLVKSE 358

Query: 340 LFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLW 381
           + R+G  FP F F +  E+E F KMAK++ Y V GLP+Y ++
Sbjct: 359 VHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 93.6 bits (231), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 87/175 (49%), Gaps = 3/175 (1%)

Query: 206 RKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPEF 265
           RK +   +N L  + L PY SWV W D+ +   P +++QDL +    +   +++      
Sbjct: 183 RKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHIFNNSDGS 242

Query: 266 LQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGYAEYPTWRVHLAYLRDPDSNPKDIIE 325
              E    LN+W+ SD    LA  +    V++EG +   T R  +    D  ++    +E
Sbjct: 243 PDSET---LNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLTEME 299

Query: 326 LDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTL 380
           LD V     L KA++ R+G  FP F F +  ETE F +MA+ + ++  GLP+Y +
Sbjct: 300 LDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (53%), Gaps = 3/93 (3%)

Query: 29  RYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNREHVLLLVPLRNAEQVLPLMFKNLMNLTY 88
           +Y++   ++    + +Y+L +   S   E + EH+L+L+PL N        F+NL  LTY
Sbjct: 66  QYKDNRGAVETGGISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFENLFALTY 122

Query: 89  PHELIDLAFLVSDCSEDDKTLEALLEYCKELQS 121
           P +LIDL  +V D       L+AL E   ++Q+
Sbjct: 123 PKQLIDLGVIVPDSKNATGILQALQETLAKVQA 155

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/210 (25%), Positives = 89/210 (42%), Gaps = 35/210 (16%)

Query: 195 DRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVA 254
           DRH   VQ  RRK + + RN+L  N       +    D+D+ + P  +++  +    ++ 
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFL-YNRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 255 VPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIVEGYAEYPTWRVH--LAY 312
           VP + R     +  ++ YD N+WI         +T  ED      Y  Y    V+    +
Sbjct: 427 VPRILR-----VGSDREYDKNTWIGE-------RTKPEDTSKQNNYESYVPRPVNGKTKF 474

Query: 313 LRD----------PDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTF---------- 352
           L+D          P++   +++ELD VGG  +    K+F  G+ FP F            
Sbjct: 475 LQDCVDEKITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEG 534

Query: 353 ENHAETEAFGKMAKKMGYRVAGLPHYTLWH 382
            +  ETE     AK +GY+  G+P+    H
Sbjct: 535 YDGVETEGLCYQAKTLGYKCYGVPNVICRH 564

>YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Protein
           necessary for structural stability of L-A
           double-stranded RNA-containing particles
          Length = 363

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 58/134 (43%), Gaps = 12/134 (8%)

Query: 237 LCPGS----VIQDLMSTDFDVAVPNV--WRPLPEFLQGEQPYDLNSWIE-SDPALQLAQT 289
           LC GS    +I DL+          +  W P P+    +   D+ S ++ +D  + L+  
Sbjct: 145 LCSGSRCLDIINDLLRVKSSKGTKPIVIWEPFPDLCDFDHQNDIKSVMQRNDVTVILSPN 204

Query: 290 LDEDDVIVEGYAEYPTW---RVHLAYLRDP--DSNPKDIIELDGVGGVSILAKAKLFRNG 344
            +E   +    ++ PT     + LA+  D   D N   I+    +G +S+  K K  R  
Sbjct: 205 AEESSRLFGLSSKEPTSLEECLALAHRFDDFMDENNMCILRCGALGSISVSEKFKNGRTY 264

Query: 345 VHFPAFTFENHAET 358
            HFPA+ F+  ++ 
Sbjct: 265 DHFPAYHFKTQSKV 278

>TBLA0F02540 Chr6 (615371..619162) [3792 bp, 1263 aa] {ON} Anc_6.123
           YBR225W
          Length = 1263

 Score = 33.1 bits (74), Expect = 1.7,   Method: Composition-based stats.
 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 3/30 (10%)

Query: 256 PNVWR---PLPEFLQGEQPYDLNSWIESDP 282
           P VW+    LPEF   + P DLN WI  DP
Sbjct: 640 PIVWQLAYDLPEFTIADFPIDLNPWISDDP 669

>Smik_13.452 Chr13 complement(734312..735625) [1314 bp, 437 aa] {ON}
           YMR240C (REAL)
          Length = 437

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 40/96 (41%), Gaps = 9/96 (9%)

Query: 205 RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPE 264
           RRKL   + + L +    PY   + W D D      S++  +  T   + VPN W+   E
Sbjct: 127 RRKLEKPSLSQLKSQV--PYPQVIEWYDCDARY--PSLLASIKCTKNVIPVPNHWQSKKE 182

Query: 265 FLQGEQ-----PYDLNSWIESDPALQLAQTLDEDDV 295
           +L G       P+ L   I+     Q+  TL +  V
Sbjct: 183 YLSGRSLLGKGPFQLPDIIKKTNIEQMRSTLPQSGV 218

>ZYRO0G12540g Chr7 (989838..992690) [2853 bp, 950 aa] {ON} similar
           to uniprot|P38244 Saccharomyces cerevisiae YBR074W
           Hypothetical ORF
          Length = 950

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 3/65 (4%)

Query: 323 IIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAETEAFGKMAKKMGYRVAGLPHYTLWH 382
           +I L+G G   I  KA LFR      A  ++N  ++  FG    + G+   G+   T + 
Sbjct: 215 VINLEGTG---IGGKAVLFRTSDVSTAKIYQNAVKSNPFGNSLFQQGFYEGGVGSETDYR 271

Query: 383 IYEPS 387
           IYE +
Sbjct: 272 IYESN 276

>Suva_13.425 Chr13 complement(731503..732837) [1335 bp, 444 aa] {ON}
           YMR240C (REAL)
          Length = 444

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 41/91 (45%), Gaps = 9/91 (9%)

Query: 205 RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPE 264
           RRK+   + + L +    PY   + W D D      +++  +  T   + VPN W+   E
Sbjct: 132 RRKMEKPSLSELKSQV--PYPQIIEWYDCDANYP--ALLASIKCTKNVIPVPNHWQSKKE 187

Query: 265 FLQ-----GEQPYDLNSWIESDPALQLAQTL 290
           +L      G++P++L   I+     Q+  TL
Sbjct: 188 YLSGRSLLGKKPFELPDIIKKTNIEQMRSTL 218

>Skud_13.411 Chr13 complement(724707..726023) [1317 bp, 438 aa] {ON}
           YMR240C (REAL)
          Length = 438

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 42/94 (44%), Gaps = 9/94 (9%)

Query: 205 RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSTDFDVAVPNVWRPLPE 264
           RRK+   + + L +    PY   + W D D       ++  +  T   + VPN W+   E
Sbjct: 128 RRKMEKPSLSQLKSQV--PYPQIIEWYDCDAHYP--FLLASIKCTKNVIPVPNHWQSKKE 183

Query: 265 FLQ-----GEQPYDLNSWIESDPALQLAQTLDED 293
           +L      G++P++L   I+     Q+  TL +D
Sbjct: 184 YLSGRSLLGKRPFELPDIIKKTDIEQMRSTLPQD 217

>CAGL0F03575g Chr6 complement(348058..350325) [2268 bp, 755 aa] {ON}
           similar to uniprot|Q08693 Saccharomyces cerevisiae
           YOR256c and similar to uniprot|Q08919 Saccharomyces
           cerevisiae YPL176c SSP134
          Length = 755

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 1/65 (1%)

Query: 12  YLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFE-GSAQGEVNREHVLLLVPLR 70
           Y IS GG E   +   E  +E+ +S++D      D+ +F    +  E+N E   LL  L 
Sbjct: 449 YFISIGGSEFNSAGAAELIKEKYQSIIDGVYSIIDISEFNVWDSSKELNIETHPLLFSLF 508

Query: 71  NAEQV 75
           N E+V
Sbjct: 509 NEEEV 513

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,555,654
Number of extensions: 2106480
Number of successful extensions: 5793
Number of sequences better than 10.0: 82
Number of HSP's gapped: 5908
Number of HSP's successfully gapped: 126
Length of query: 404
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 292
Effective length of database: 40,638,807
Effective search space: 11866531644
Effective search space used: 11866531644
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)