Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03806g8.843ON52552525980.0
Kwal_27.102458.843ON51549219920.0
SAKL0D01386g8.843ON52150816420.0
NDAI0E002808.843ON54951415830.0
YML116W (ATR1)8.843ON54251615280.0
KNAG0J002608.843ON55050715200.0
NCAS0B002908.843ON54251215120.0
Kpol_541.168.843ON52851315070.0
Suva_13.278.843ON55351615050.0
KNAG0G034308.843ON54251114930.0
CAGL0B02343g8.843ON53749814910.0
Skud_13.258.843ON53750414800.0
Smik_13.188.843ON54550714670.0
Suva_13.4678.843ON54350614650.0
TDEL0B005508.843ON53750414490.0
NCAS0A02540singletonON53951114390.0
NCAS0C004008.843ON51749314290.0
KAFR0B03930singletonON55546014280.0
TBLA0D032708.843ON55051714170.0
YMR279C8.843ON54052713990.0
TPHA0C047908.843ON55647713840.0
Skud_13.4518.843ON53951613790.0
NDAI0K004008.843ON55351113770.0
CAGL0M03003g8.843ON55850213720.0
Smik_13.4928.843ON54351613700.0
TBLA0D03280singletonON58052613520.0
KAFR0B039408.843ON54752413371e-180
KAFR0A028408.843ON52048613021e-175
TBLA0C01160singletonON60050011781e-155
Smik_15.560na 1ON5164448271e-104
Skud_15.545na 1ON5164438151e-102
YOR378Wna 1ON5154458121e-102
Suva_8.435na 1ON5154398031e-100
KLLA0B00352gna 1ON4985187961e-99
TDEL0G04950singletonON5125037866e-98
KLTH0C10560gna 1ON5154347613e-94
Kwal_23.6547na 1ON5115057562e-93
KNAG0D00130na 1ON5654715394e-61
KAFR0C04860na 1ON5344334903e-54
NCAS0A05720na 1ON5635454404e-47
SAKL0C06116gsingletonON1851993917e-44
CAGL0L02519gna 1ON5294884061e-42
NDAI0K02730singletonON6044743693e-37
Smik_6.24na 2ON5444981304e-07
Skud_6.16na 2ON5494741091e-04
KLLA0C18931gna 3ON5531851082e-04
Kwal_26.6697singletonON5774341072e-04
AGR076C8.272ON6863861072e-04
ZYRO0F14652g8.570ON5661151072e-04
KLLA0E24113g8.570ON5751231053e-04
Kpol_467.242.473ON3702541044e-04
Suva_10.11singletonON5404631045e-04
NCAS0A078102.473ON5681991028e-04
Ecym_73992.473ON5631991029e-04
KLTH0D16962gsingletonON5711431010.001
ABL040W2.473ON5672881010.001
Kwal_56.237548.272ON5893811000.001
Smik_13.2722.473ON561731000.001
Skud_13.2442.473ON562831000.002
NDAI0H022002.473ON5711271000.002
YMR088C (VBA1)2.473ON56273990.002
ZYRO0C01430g8.272ON590279980.003
CAGL0J09020g7.309ON85676980.003
TDEL0A024902.473ON554195970.003
ZYRO0E10230gsingletonON558242970.003
Suva_4.4318.570ON572188970.004
Smik_16.81na 4ON625130960.004
SAKL0F00440gsingletonON544419960.004
ACL172C3.245ON631137950.006
Suva_14.2762.242ON562134950.006
TPHA0I017608.570ON653144950.007
CAGL0M06281g8.570ON542141940.007
TBLA0F030408.272ON906267950.007
TDEL0A051308.570ON599107940.007
SAKL0E04246gna 5ON565242940.008
SAKL0A08228gsingletonON569130940.008
Suva_13.2652.473ON56173940.008
Smik_2.3208.570ON572165940.009
KLTH0G13464g8.272ON593247930.010
TDEL0D06610singletonON49785930.011
Ecym_42988.272ON678194930.012
KLTH0B10384gsingletonON551168920.012
KLTH0C10142gsingletonON573143920.015
Kwal_14.782na 6ON491116910.015
KNAG0A035408.570ON538253910.017
TDEL0D06570singletonON566238910.018
KLLA0F13684g2.473ON571117900.024
Smik_1.1singletonON594122900.025
KLTH0B10054gsingletonON503116890.027
KLTH0E00462gsingletonON503116890.027
Kpol_543.448.272ON643405890.031
SAKL0E08756g2.242ON565138890.031
ZYRO0F02178gsingletonON595112890.031
NCAS0C03460na 4ON630140880.037
NDAI0D010202.242ON592172880.038
CAGL0B02079gna 4ON624130880.039
TBLA0B044808.570ON608119880.041
NCAS0G029902.242ON581139880.042
AGR195W8.570ON619101880.042
YAL067C (SEO1)singletonON593122870.052
Kwal_56.229493.245ON642105870.055
SAKL0C05588gsingletonON677141870.057
KAFR0J016202.242ON570141870.061
ZYRO0A00330gsingletonON576182860.062
KNAG0I019102.242ON598178860.062
SAKL0H09328g8.570ON596241860.068
KAFR0J009302.242ON566172860.073
KLTH0H05456gna 7ON56872860.074
SAKL0A00726gsingletonON598200860.077
Kwal_34.15746na 3ON518196850.079
ZYRO0G15422gsingletonON542112850.081
TDEL0G03260singletonON612130850.084
SAKL0E02992g2.473ON57067850.085
CAGL0J01375g2.473ON564196850.087
TDEL0F039908.272ON63170850.098
Suva_12.245na 8ON591125850.10
KLTH0E13222g8.570ON566175840.11
SAKL0C02178gsingletonON565181840.12
ZYRO0G21890gsingletonON57672840.14
NCAS0B020108.570ON530176830.15
Kwal_14.1585na 7ON57072830.15
YBR180W (DTR1)8.570ON572262830.16
YGR224W (AZR1)na 4ON613130830.16
Ecym_70638.570ON620113830.17
KNAG0E025602.473ON57868820.21
Skud_2.3068.570ON572246820.22
SAKL0D04510gna 9ON531170820.23
KLLA0B06798g3.245ON663145800.37
TBLA0G025502.242ON613140800.41
YIL120W (QDR1)2.242ON563216800.41
TDEL0C023707.309ON73185800.42
NDAI0C056708.570ON500114790.45
ZYRO0G03234g2.473ON56278790.50
KLTH0G09372g2.242ON551141790.51
SAKL0H16808g8.272ON65748790.53
Ecym_7258na 10ON638165790.56
Kwal_27.121738.570ON567185770.74
KLLA0A04631g8.272ON57970770.74
TBLA0C01100na 11ON649144770.79
KLTH0C10120gsingletonON651126770.86
Skud_7.560na 4ON642131770.87
TBLA0B046406.155ON482150761.1
KAFR0I007108.570ON575113761.2
ZYRO0A03564g3.245ON684168761.3
KLTH0H16214gsingletonON55199751.4
Kwal_23.48242.242ON553136751.4
KLLA0D11330gsingletonON521122751.4
Suva_4.553na 12ON562152751.5
KNAG0K01020singletonON599164751.5
KLTH0C08074g3.245ON642105751.5
NCAS0D04970na 8ON582120751.7
Kwal_26.7984na 10ON612160741.8
SAKL0D04070g3.245ON667114741.8
Smik_11.368singletonON580218741.8
YPR198W (SGE1)singletonON543127742.2
Smik_19.10singletonON543171732.3
Kwal_56.24353na 13ON582122732.8
Kwal_47.189193.503ON640106732.8
NDAI0K03000na 8ON592122723.0
SAKL0E08778g2.241ON600238723.1
TDEL0D038003.245ON640145723.2
KLTH0E16720gsingletonON574151723.4
ZYRO0G21868gna 7ON62072723.5
Skud_9.482.241ON599140723.6
TDEL0C00120singletonON569148714.0
Smik_2.434na 12ON474148714.3
KNAG0M00710singletonON539165714.3
Kpol_1048.458.570ON648145714.3
SAKL0A02926gna 13ON572125714.3
Kwal_23.48142.241ON529170714.3
NDAI0K014602.451ON32344704.4
Smik_3.206singletonON10953665.0
KLLA0E03829g3.503ON609135715.1
Kwal_14.728singletonON568130705.9
TBLA0D030001.155ON516136705.9
TDEL0D057103.503ON616101706.1
NCAS0D028805.227ON534112706.4
Kwal_47.171694.291aON576170697.4
CAGL0K12716g8.22ON484105698.0
SAKL0D11000g1.451ON657128698.1
TBLA0D029003.503ON691106698.1
KLTH0C11044g6.27ON31557688.5
KLLA0D12716gna 13ON595122698.7
NDAI0I027703.503ON626104689.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03806g
         (525 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...  1005   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   771   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   637   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      614   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   593   0.0  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...   590   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      587   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   585   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   584   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   579   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   578   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   574   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   569   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   568   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   562   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   558   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      555   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   554   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   550   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   543   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   537   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   535   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               535   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   533   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   532   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   525   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   519   e-180
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   506   e-175
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   458   e-155
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   323   e-104
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   318   e-102
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   317   e-102
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   313   e-100
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   311   1e-99
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   307   6e-98
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   297   3e-94
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   295   2e-93
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   212   4e-61
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     193   3e-54
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            174   4e-47
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   155   7e-44
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   160   1e-42
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   146   3e-37
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    55   4e-07
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    47   1e-04
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    46   2e-04
Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}...    46   2e-04
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    46   2e-04
ZYRO0F14652g Chr6 complement(1207106..1208806) [1701 bp, 566 aa]...    46   2e-04
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    45   3e-04
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    45   4e-04
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    45   5e-04
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    44   8e-04
Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}...    44   9e-04
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    44   0.001
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    44   0.001
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    43   0.001
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    43   0.001
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    43   0.002
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    43   0.002
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    43   0.002
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    42   0.003
CAGL0J09020g Chr10 (889269..891839) [2571 bp, 856 aa] {ON} highl...    42   0.003
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    42   0.003
ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {...    42   0.003
Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W ...    42   0.004
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    42   0.004
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    42   0.004
ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON} Syn...    41   0.006
Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065...    41   0.006
TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.5...    41   0.007
CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} simil...    41   0.007
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    41   0.007
TDEL0A05130 Chr1 complement(910315..912114) [1800 bp, 599 aa] {O...    41   0.007
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    41   0.008
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    41   0.008
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    41   0.008
Smik_2.320 Chr2 (575945..577663) [1719 bp, 572 aa] {ON} YBR180W ...    41   0.009
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    40   0.010
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    40   0.011
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    40   0.012
KLTH0B10384g Chr2 complement(877070..878725) [1656 bp, 551 aa] {...    40   0.012
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    40   0.015
Kwal_14.782 s14 (42720..44195) [1476 bp, 491 aa] {ON} YGR260W (T...    40   0.015
KNAG0A03540 Chr1 (450487..452103) [1617 bp, 538 aa] {ON} Anc_8.5...    40   0.017
TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa] ...    40   0.018
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    39   0.024
Smik_1.1 Chr1 complement(4254..6038) [1785 bp, 594 aa] {ON} YAL0...    39   0.025
KLTH0B10054g Chr2 complement(839166..840677) [1512 bp, 503 aa] {...    39   0.027
KLTH0E00462g Chr5 (45358..46869) [1512 bp, 503 aa] {ON} weakly s...    39   0.027
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    39   0.031
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    39   0.031
ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} simila...    39   0.031
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    39   0.037
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    39   0.038
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    39   0.039
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    39   0.041
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    39   0.042
AGR195W Chr7 (1120597..1122456) [1860 bp, 619 aa] {ON} Syntenic ...    39   0.042
YAL067C Chr1 complement(7235..9016) [1782 bp, 593 aa] {ON}  SEO1...    38   0.052
Kwal_56.22949 s56 complement(342503..344431) [1929 bp, 642 aa] {...    38   0.055
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    38   0.057
KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {...    38   0.061
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    38   0.062
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    38   0.062
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    38   0.068
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    38   0.073
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    38   0.074
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    38   0.077
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    37   0.079
ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} simi...    37   0.081
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               37   0.084
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    37   0.085
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    37   0.087
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    37   0.098
Suva_12.245 Chr12 (391999..393774) [1776 bp, 591 aa] {ON} YAL067...    37   0.10 
KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]...    37   0.11 
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    37   0.12 
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    37   0.14 
NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570     37   0.15 
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    37   0.15 
YBR180W Chr2 (589741..591459) [1719 bp, 572 aa] {ON}  DTR1Putati...    37   0.16 
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    37   0.16 
Ecym_7063 Chr7 complement(130980..132842) [1863 bp, 620 aa] {ON}...    37   0.17 
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    36   0.21 
Skud_2.306 Chr2 (557166..558884) [1719 bp, 572 aa] {ON} YBR180W ...    36   0.22 
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    36   0.23 
KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} simila...    35   0.37 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    35   0.41 
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    35   0.41 
TDEL0C02370 Chr3 (416622..418817) [2196 bp, 731 aa] {ON} Anc_7.3...    35   0.42 
NDAI0C05670 Chr3 complement(1310115..1311617) [1503 bp, 500 aa] ...    35   0.45 
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    35   0.50 
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    35   0.51 
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    35   0.53 
Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}...    35   0.56 
Kwal_27.12173 s27 complement(1120952..1122655) [1704 bp, 567 aa]...    34   0.74 
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    34   0.74 
TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432     34   0.79 
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    34   0.86 
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    34   0.87 
TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa] ...    34   1.1  
KAFR0I00710 Chr9 (139612..141339) [1728 bp, 575 aa] {ON} Anc_8.5...    34   1.2  
ZYRO0A03564g Chr1 (283783..285837) [2055 bp, 684 aa] {ON} simila...    34   1.3  
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    33   1.4  
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    33   1.4  
KLLA0D11330g Chr4 (970243..971808) [1566 bp, 521 aa] {ON} simila...    33   1.4  
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...    33   1.5  
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    33   1.5  
KLTH0C08074g Chr3 (688367..690295) [1929 bp, 642 aa] {ON} simila...    33   1.5  
NCAS0D04970 Chr4 (952902..954650) [1749 bp, 582 aa] {ON}               33   1.7  
Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {O...    33   1.8  
SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} simila...    33   1.8  
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    33   1.8  
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    33   2.2  
Smik_19.10 Chr19 complement(12270..13901) [1632 bp, 543 aa] {ON}...    33   2.3  
Kwal_56.24353 s56 (964777..966525) [1749 bp, 582 aa] {ON} YAL067...    33   2.8  
Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]...    33   2.8  
NDAI0K03000 Chr11 (686056..687834) [1779 bp, 592 aa] {ON}              32   3.0  
SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {...    32   3.1  
TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.2...    32   3.2  
KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} simi...    32   3.4  
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    32   3.5  
Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W (...    32   3.6  
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}         32   4.0  
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...    32   4.3  
KNAG0M00710 Chr13 complement(118300..119919) [1620 bp, 539 aa] {...    32   4.3  
Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON} (1178...    32   4.3  
SAKL0A02926g Chr1 complement(267564..269282) [1719 bp, 572 aa] {...    32   4.3  
Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W...    32   4.3  
NDAI0K01460 Chr11 (332950..333921) [972 bp, 323 aa] {ON} Anc_2.451     32   4.4  
Smik_3.206 Chr3 complement(303825..304154) [330 bp, 109 aa] {ON}...    30   5.0  
KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly...    32   5.1  
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    32   5.9  
TBLA0D03000 Chr4 complement(727249..728799) [1551 bp, 516 aa] {O...    32   5.9  
TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa] ...    32   6.1  
NCAS0D02880 Chr4 complement(547303..548907) [1605 bp, 534 aa] {O...    32   6.4  
Kwal_47.17169 s47 complement(282962..284692) [1731 bp, 576 aa] {...    31   7.4  
CAGL0K12716g Chr11 complement(1260998..1262452) [1455 bp, 484 aa...    31   8.0  
SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} simila...    31   8.1  
TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.5...    31   8.1  
KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {O...    31   8.5  
KLLA0D12716g Chr4 complement(1084062..1085849) [1788 bp, 595 aa]...    31   8.7  
NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503     31   9.2  

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score = 1005 bits (2598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/525 (94%), Positives = 495/525 (94%)

Query: 1   MNSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLS 60
           MNSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLS
Sbjct: 1   MNSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLS 60

Query: 61  XXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120
                       PLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTL
Sbjct: 61  QLLNQAAALQANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120

Query: 121 LGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKN 180
           LGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKN
Sbjct: 121 LGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKN 180

Query: 181 MVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTN 240
           MVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTN
Sbjct: 181 MVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTN 240

Query: 241 VHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFA 300
           VHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAY                  EARFA
Sbjct: 241 VHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFA 300

Query: 301 KEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAI 360
           KEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAI
Sbjct: 301 KEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAI 360

Query: 361 FGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGM 420
           FGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGM
Sbjct: 361 FGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGM 420

Query: 421 DLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGY 480
           DLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGY
Sbjct: 421 DLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGY 480

Query: 481 RAALYVGIGLASVGIFVSGAYAIEDWWTRRRERSVRIKLDEKHQE 525
           RAALYVGIGLASVGIFVSGAYAIEDWWTRRRERSVRIKLDEKHQE
Sbjct: 481 RAALYVGIGLASVGIFVSGAYAIEDWWTRRRERSVRIKLDEKHQE 525

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/492 (74%), Positives = 420/492 (85%)

Query: 23  DNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXXXXXXXXXXXXPLFDLLSEDL 82
           +  +     +  +SRLQNPDYFDK WKEY+FV+SSMLS            PLFD+LS+DL
Sbjct: 23  EERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLNQAATTQTNPLFDVLSKDL 82

Query: 83  KAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHN 142
            AK SQQ WLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGY VVVIWSLICGLSSYAHN
Sbjct: 83  NAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHN 142

Query: 143 VDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSG 202
           VDFF+VARSFQGLGIAFVLPNV GIVGNIYKPNT+AKN+VFS+IGACAPIGATLGC+FSG
Sbjct: 143 VDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFSLIGACAPIGATLGCVFSG 202

Query: 203 LIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFN 262
           LIG  ++ W WTFYAY I AALNGL+A ++IP+NIPTNV+++KMDW+GS +GV GLI+FN
Sbjct: 203 LIGARTDLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNEYKMDWIGSAIGVFGLILFN 262

Query: 263 FVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILASL 322
           FVWNQAP  GW SAY                  E RFAK+PLLP +VLFNRKLMMIL+SL
Sbjct: 263 FVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAKQPLLPHSVLFNRKLMMILSSL 322

Query: 323 FLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIIL 382
           F GWGSFGIWT+YYM+F+LNLRHY+PLWAGG+YFMFAI+G +A+ LVG+TIHKTGPA+IL
Sbjct: 323 FFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGIVASLLVGYTIHKTGPAVIL 382

Query: 383 LASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGM 442
             S++AFD GCIML+VTPV QTYFRM+LG M+ILSFGMDLSFPA+SIILSDQLPSQYQGM
Sbjct: 383 FLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLSFPAASIILSDQLPSQYQGM 442

Query: 443 AGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAYA 502
           AGSLV+TMI+YSMSLCLG+SGTAE QVNK+G DLLKGY+AALYVGIGLAS+G+ +SGA+ 
Sbjct: 443 AGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAALYVGIGLASLGVVISGAFM 502

Query: 503 IEDWWTRRRERS 514
           IEDWWT RR+R+
Sbjct: 503 IEDWWTSRRKRT 514

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/508 (60%), Positives = 379/508 (74%), Gaps = 1/508 (0%)

Query: 9   SKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXXXXXXXX 68
           S+ +     S      H D  +       +Q+P YF   WKEYLF+ +SM+S        
Sbjct: 12  SQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMMSQLLNQAGT 71

Query: 69  XXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVV 128
                L ++LS++  +  SQQ WLMASFPLVSGSFILVSGK+GDIYGLKKTLL GY V +
Sbjct: 72  TQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKTLLVGYVVTI 131

Query: 129 IWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGA 188
           IWSLICGL+SY  +V+FFI++R+FQGLGIAF+LPN+ GIVGNIY   T  KNMV S+IGA
Sbjct: 132 IWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRKNMVISLIGA 191

Query: 189 CAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDW 248
           CAPIGAT+G LFSGLIGT SE WAWTFYAYTI AA+N  ++ +VIP+ IPTNV    MDW
Sbjct: 192 CAPIGATMGVLFSGLIGTLSERWAWTFYAYTITAAINMGLSIWVIPNTIPTNVRGSSMDW 251

Query: 249 LGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRA 308
           +GS +G+ G+I+FNFVWNQ P  GWD+AY                  E ++A +PL+PR 
Sbjct: 252 IGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETKYANDPLIPRP 311

Query: 309 VLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFL 368
            + N +L+M L ++F GWGSFGIWT+YY  FVLNLR YTPLWAGGSYFMF I+G IAA  
Sbjct: 312 AMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMFLIWGIIAAIS 371

Query: 369 VGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASS 428
           VG+TI +  P++IL  S++AFD GCIMLSVTPVDQTYFRM LG M+ILSFGMDLSFPASS
Sbjct: 372 VGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSFGMDLSFPASS 431

Query: 429 IILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGI 488
           IILSD+LP + QGMAGSLV+TMINYSMS+CLG++GT E Q+NK+G DLLKGYRAALY+GI
Sbjct: 432 IILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLKGYRAALYLGI 491

Query: 489 GLASVGIFVSGAYAIEDWWTRRRERSVR 516
           GLAS+G+F+S  + +E+ + R R R+V+
Sbjct: 492 GLASLGVFISALFMLEN-YLRMRRRNVK 518

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/514 (56%), Positives = 380/514 (73%), Gaps = 2/514 (0%)

Query: 1   MNSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLS 60
           +  E + ++K+   +++S   + + E  D  +   S+ QNPDYF  +W+EYLF+ S M+S
Sbjct: 27  IEEECSSITKEEN-NEVSEDELPSSEQEDNTIGDHSKWQNPDYFQNKWQEYLFIFSCMMS 85

Query: 61  XXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120
                        + +++++  K++  ++ WL+ASFPLVSGSFIL+SG++GDIYGLKKTL
Sbjct: 86  QLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTL 145

Query: 121 LGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKN 180
           +GGY   +IWSLI G + Y+HN  FFI++R+FQGLGIAF+LPNV GIVGNIYKP+T+ KN
Sbjct: 146 IGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMGIVGNIYKPDTQRKN 205

Query: 181 MVFSMIGACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPT 239
           +V SMIGA APIGA +G LF+GLIGTE+ + W W FYA+ I +A+N  I+ Y IP+NIPT
Sbjct: 206 IVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAINLAISIYSIPNNIPT 265

Query: 240 NVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARF 299
           N+H F MDW+GS + V GLI+ NFVWNQ P  GW  AY                  E ++
Sbjct: 266 NIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIISIIALVLFFTYEIKY 325

Query: 300 AKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFA 359
           AK P+LP  V  NR ++MILA+LFLGWGSFGI+++YY +F+LNLRHY+ LWAG +YFMFA
Sbjct: 326 AKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFA 385

Query: 360 IFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFG 419
           I+GT+AA +VG  I +   ++IL  S+IAF++G IMLSVTPVDQTYFRM+LGTM+ILSFG
Sbjct: 386 IWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTYFRMNLGTMIILSFG 445

Query: 420 MDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKG 479
           MD+SFPA++IILSD L  QYQGMAGSL NTM+NYSMSLCLG+  T ERQ+NK G ++LKG
Sbjct: 446 MDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGKEILKG 505

Query: 480 YRAALYVGIGLASVGIFVSGAYAIEDWWTRRRER 513
           YRAA Y+G+GLA +GI +SG Y  E  W +R+ER
Sbjct: 506 YRAAEYLGVGLAGLGIVISGIYMAEVLWAKRKER 539

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/516 (55%), Positives = 363/516 (70%), Gaps = 3/516 (0%)

Query: 2   NSEYTPVSKQRTGSDISRKVVDN--HEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSML 59
           N    PV K    ++I   +      +  D ++ S  + QNP+YF   W+EYLF+ + M+
Sbjct: 18  NETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYLFIFTCMI 77

Query: 60  SXXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKT 119
           S             + ++LS+   ++ + ++WLMASFPLVSGSFIL+SG++GDIYGLKK 
Sbjct: 78  SQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKM 137

Query: 120 LLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAK 179
           LL GY +V+IWSLICG++ Y+ +  FFI++R+FQGLGIAFVLPNV GI+GNIY   T  K
Sbjct: 138 LLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVGGTFRK 197

Query: 180 NMVFSMIGACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIP 238
           N+V S +GA APIGATLGCLF+GLIGTE  + W W FYAY+I A +N +++ Y IP  IP
Sbjct: 198 NIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIYAIPSTIP 257

Query: 239 TNVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEAR 298
           TN+H F MDW+GS LGV GLI+ NFVWNQAP  GW+ AY                  E R
Sbjct: 258 TNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVVFIIYEIR 317

Query: 299 FAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMF 358
           FAK PLLPRAV+ +R ++ I+ +LF GWGSFGI+T+YY  F LN+R YT LWAGG+YFMF
Sbjct: 318 FAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWAGGTYFMF 377

Query: 359 AIFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSF 418
            I+G IAA LVG TI    P++ L  S++AF+VG IM SVTPV +TYFR  LGTM+ILSF
Sbjct: 378 LIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSF 437

Query: 419 GMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLK 478
           GMDLSFPASSII SD LP +YQGMAGSLVNT++NYSMSLCLG+  T E QVN DG  LLK
Sbjct: 438 GMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNSDGKHLLK 497

Query: 479 GYRAALYVGIGLASVGIFVSGAYAIEDWWTRRRERS 514
           GYR A Y+GIGLAS+   +SG Y +E +   RR R+
Sbjct: 498 GYRGAQYLGIGLASLACMISGLYMVESFIKGRRARA 533

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/507 (57%), Positives = 360/507 (71%), Gaps = 5/507 (0%)

Query: 2   NSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSX 61
           N +     K+   ++   +     E +D    + +  QNP YF  +W+EY F+ + ML+ 
Sbjct: 30  NDQTNVEEKKNCSTESEAEWCSESEFTD----NDTPWQNPTYFANRWQEYAFISTCMLAQ 85

Query: 62  XXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLL 121
                         ++L++   + A +Q WLMASFPLVSGSFILVSG++GDIYGLKKTL+
Sbjct: 86  LLNQAGQAQATAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLI 145

Query: 122 GGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNM 181
           GGY VV+IWSLICG ++Y HN  FFI+ R+FQGLGIAF+LPNV G++GNIYK NT  KN 
Sbjct: 146 GGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNF 205

Query: 182 VFSMIGACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTN 240
           V S +G CAPIGA LG ++SGLI  E+ + W W FYAY IV A+N ++A Y IP  +PTN
Sbjct: 206 VISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTN 265

Query: 241 VHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFA 300
           +H F MDW GS +GV G+I+FNFVWNQ P DGW+  Y                  E +FA
Sbjct: 266 IHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFA 325

Query: 301 KEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAI 360
           K PLLP  V+ NR + MIL ++F+GWGSFGIWT+YY AF LNLRHY+ +WAGG++FMF I
Sbjct: 326 KSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVI 385

Query: 361 FGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGM 420
           +GTIAAFLV  TI + GP+++L  S+  F VGCIMLSVTPV Q+Y++M+LG  +ILSFGM
Sbjct: 386 WGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGM 445

Query: 421 DLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGY 480
           DLSFPASSIILSD LPSQYQGMAGSLVNTM+NYS SLCLGV  TAE QVNK+GTD LKGY
Sbjct: 446 DLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGY 505

Query: 481 RAALYVGIGLASVGIFVSGAYAIEDWW 507
           RAALYVGIGL + G+ V+  Y  E  W
Sbjct: 506 RAALYVGIGLGACGMLVAFCYLFEVLW 532

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/512 (55%), Positives = 368/512 (71%), Gaps = 4/512 (0%)

Query: 3   SEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXX 62
           +E T + K     +I + V+   E   +     S+ QNPDYF  QW+EYLF+ S M+S  
Sbjct: 24  TEETSIIKHGDIEEIEKDVISQTETPQL---EHSKWQNPDYFQNQWQEYLFIFSCMMSQL 80

Query: 63  XXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLG 122
                      + +++++   ++  ++ WL+ASFPLVSGSFIL+SG++GDIYGLKKTL+G
Sbjct: 81  LNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIGDIYGLKKTLVG 140

Query: 123 GYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMV 182
           GY   +IWS+I GL+ Y+H+  FFIV+R+FQGL IAF+LPNV GIVGNIYKP++  KN+V
Sbjct: 141 GYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNIYKPDSNRKNIV 200

Query: 183 FSMIGACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNV 241
            SMIGA APIGA  G LF+GLIGTE  + W W FYA+ I +A N  I+ Y IP+++PTNV
Sbjct: 201 ISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISIYSIPNSVPTNV 260

Query: 242 HKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAK 301
           H F MDW+GS L V GLI+ NFVWNQ P  GW +AY                  E ++A+
Sbjct: 261 HGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLALFFTYEVKYAE 320

Query: 302 EPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIF 361
            PLLP  V  NR ++MILA+LFLGWGSFGI+++YY +F+LNLRHY+ LWAG +YFMFAI+
Sbjct: 321 SPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALWAGTTYFMFAIW 380

Query: 362 GTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMD 421
           GT+AA +VG  I K   A IL  S++AF++G IMLSVTPVDQTYFRM+LGTM+ILSFGMD
Sbjct: 381 GTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNLGTMIILSFGMD 440

Query: 422 LSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYR 481
           +SFPA++IILSD L  QYQGMAGSL NTM+NYSMSLCLG+  T ERQ+NK G DLLKGYR
Sbjct: 441 MSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQINKSGNDLLKGYR 500

Query: 482 AALYVGIGLASVGIFVSGAYAIEDWWTRRRER 513
            A Y+GIGLA +GI ++  Y  E  W +R++ 
Sbjct: 501 GAEYLGIGLAGLGIIITAIYLGEILWGKRKQH 532

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/513 (55%), Positives = 369/513 (71%), Gaps = 8/513 (1%)

Query: 8   VSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXXXXXXX 67
           ++++   SD S    D +++S  +    S L+NPDYF+   +EY F+ S MLS       
Sbjct: 16  IAEETIRSDCS----DANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCMLSQLLNLAG 71

Query: 68  XXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVV 127
                 + ++L+  L +  S + WL+ASFPLVSGSFILVSG++GDIYGLKK L+ GY ++
Sbjct: 72  TTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKKMLILGYVIL 131

Query: 128 VIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIG 187
           VIWSLI GLS Y+H+  FFI+AR+FQGLGI+ VLPNV G++G IYKP T  KNMV S++G
Sbjct: 132 VIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLKKNMVISIVG 191

Query: 188 ACAPIGATLGCLFSGLIGTESE-AWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKM 246
           A +PIGATLG LFSGL+ TESE +W W FYAYT+ A +N  I++Y IP+NIPTNV++  M
Sbjct: 192 AMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNIPTNVNRLSM 251

Query: 247 DWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLP 306
           DW+GSF GV GLI+FNFVWNQAP DGW+SAY                  E R+A+ PLLP
Sbjct: 252 DWIGSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYELRYAENPLLP 311

Query: 307 RAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAA 366
             ++ NR+L+MIL ++  GWGSFGIWT+YY +FVLNLR+Y+PLWAGGSYF+F I GTI A
Sbjct: 312 SEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFIFVISGTITA 371

Query: 367 FLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPA 426
              G  + K  PA++L  S++ F++GCI+ SVTPV QTYFR  LGTM+IL  GMDLSFPA
Sbjct: 372 ISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILPLGMDLSFPA 431

Query: 427 SSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYV 486
           SSIILSD LP+Q+QGMAGSLVNT+INYS SL LG++GT E+  NK+GTDLL+GYR ALY 
Sbjct: 432 SSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLLRGYRGALYF 491

Query: 487 GIGLASVGIFVSGAYAIE---DWWTRRRERSVR 516
           GI  + V + ++G Y +E   D +  R+E+   
Sbjct: 492 GIACSGVAVLIAGLYMVETIFDSYKDRKEKDCE 524

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/516 (54%), Positives = 368/516 (71%), Gaps = 4/516 (0%)

Query: 1   MNSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLS 60
           + +E +     + G+ ++  V+ N ED  M   ++ + QNP+YF   W+EYLF+ + M+S
Sbjct: 33  LEAEDSSPRNNKEGA-LTTIVLTNSEDEVM--KTKQKWQNPNYFKYPWQEYLFIFTCMIS 89

Query: 61  XXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120
                        + ++L++   + A+ ++WLMASFPLVSGSFIL+SG++GDI+GLK  L
Sbjct: 90  QLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMGDIFGLKNML 149

Query: 121 LGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKN 180
           L GY +++IWSLICGL+ Y+ +  FFIV+R+FQGLGIAFVLPNV GI+GN+Y   T  KN
Sbjct: 150 LIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNVYVGGTFRKN 209

Query: 181 MVFSMIGACAPIGATLGCLFSGLIGT-ESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPT 239
           +V S IGA APIGATLGC F+GLIGT     W W FYAYTI A +N +++ Y IP+NIPT
Sbjct: 210 IVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSIYAIPNNIPT 269

Query: 240 NVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARF 299
           NVH+F MDW+GS LGV GL++ N VWNQAP  GW+ AY                  E  F
Sbjct: 270 NVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLVLFGVYEIHF 329

Query: 300 AKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFA 359
           AK PLLP+AV+ +R ++ I+ SLF GWGSFGI+T+YY  F LN+RHYTPLWAGGSYFMF 
Sbjct: 330 AKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLWAGGSYFMFL 389

Query: 360 IFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFG 419
           I+G IAA LVG +I +  P++ L  +++AF+VG IM SVTPV +TYFRM +GTM+ILSFG
Sbjct: 390 IWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQMGTMIILSFG 449

Query: 420 MDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKG 479
           MDLSFPASSII SD LP +YQGMAGSLVNT++NYSMSLCLG+  T E Q++ DG  +LKG
Sbjct: 450 MDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLDPDGKHILKG 509

Query: 480 YRAALYVGIGLASVGIFVSGAYAIEDWWTRRRERSV 515
           YR A Y+GIGLAS+   +SG Y +E +    R ++V
Sbjct: 510 YRGAQYLGIGLASLACIISGLYMVECYIKDHRAKAV 545

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/511 (55%), Positives = 362/511 (70%), Gaps = 9/511 (1%)

Query: 4   EYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXXX 63
           E T   K  +G++ S  V     +         + Q+  YF  +W+EY+FV + M+S   
Sbjct: 30  ENTDSDKLGSGNETSTHVATTDPNC--------KWQDTTYFQNRWQEYIFVGTCMMSQLL 81

Query: 64  XXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGG 123
                     L ++L++   + A  Q WLMASFPLVSGSFIL+SG+VGDIYGLK +L+GG
Sbjct: 82  NQACIPQTLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGG 141

Query: 124 YAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVF 183
               +IW+LI G ++Y H+  FFIV+RSFQGLG+AF+LPNV G VGNIYKPNT  KN+V 
Sbjct: 142 NIFFIIWALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVI 201

Query: 184 SMIGACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVH 242
           S+IGACAP+GA +G  F+GLIGT++ + W W+FYA  I + L  L A Y IP++IPTNVH
Sbjct: 202 SLIGACAPVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVH 261

Query: 243 KFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKE 302
            F MDW+GS L V GLI+ NFVWNQ P DGW  AY                  E  +A  
Sbjct: 262 GFSMDWIGSGLAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAAS 321

Query: 303 PLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFG 362
           PLLPR +  NR ++MIL +LFLGWGSFGI+++YY AF+LNLRHY+ +WAGG+YFMFAI+G
Sbjct: 322 PLLPRVITQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWG 381

Query: 363 TIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDL 422
            +A+ +VG +I K   +IIL  S+IAFDVG IMLSVTPV QTYFRM+LGTM+ILSFGMD+
Sbjct: 382 VVASVVVGLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDM 441

Query: 423 SFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRA 482
           SFPA++IILSD LP+QYQGMAGSL NTM+NYSMSLCLG+  T E Q+N++G DLLKGYRA
Sbjct: 442 SFPAAAIILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRA 501

Query: 483 ALYVGIGLASVGIFVSGAYAIEDWWTRRRER 513
           A Y+GIG+AS+ + +S  Y  E  W  R+ER
Sbjct: 502 AEYLGIGIASLAVILSLIYMCERLWIDRKER 532

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/498 (56%), Positives = 359/498 (72%), Gaps = 2/498 (0%)

Query: 18  SRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXXXXXXXXXXXXPLFDL 77
           +  +VD  +     +    + QNP+YFD   KEYLF+ S  +S            P+ ++
Sbjct: 30  NNDIVDEKQCDTQAIDGNQKWQNPEYFDSTLKEYLFLCSCFVSQLLNQAGAIQTQPIMNI 89

Query: 78  LSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLS 137
           +++ L ++  +QAWLMA+FPL+SGSFIL+SG++GDIYGLKKTLL GY  +++WSLICGL+
Sbjct: 90  VADSLDSQNGKQAWLMAAFPLISGSFILISGRIGDIYGLKKTLLVGYLFLIVWSLICGLT 149

Query: 138 SYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLG 197
            YAH+  FFIV+R+FQGLGI+ +LPN+ GIVG+IY   +K KNMV S+IG  APIGATLG
Sbjct: 150 KYAHSDSFFIVSRAFQGLGISLILPNILGIVGSIYIAGSKRKNMVISLIGCMAPIGATLG 209

Query: 198 CLFSGLIGTE-SEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVC 256
            +FSGLIGTE +  W W FY+Y I AA+N +++ ++IP+ IPTNVH  KMDW+GS LGV 
Sbjct: 210 AVFSGLIGTEDANQWPWAFYSYAITAAINFVLSIWLIPNTIPTNVHGHKMDWIGSGLGVV 269

Query: 257 GLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAK-EPLLPRAVLFNRKL 315
           GLIM NFVWNQAP DGWDSAY                  E  F    PLLP+ VL + K 
Sbjct: 270 GLIMLNFVWNQAPIDGWDSAYLIVLLIISVLLLIAFFIYELHFVNGNPLLPKEVLKSPKT 329

Query: 316 MMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHK 375
           +++L +LF GWGSFGI+++YY  F LNLRHYTPLWAGG+YFMF I+G +AA +VG TI K
Sbjct: 330 IIVLFALFFGWGSFGIFSFYYFTFQLNLRHYTPLWAGGTYFMFLIWGIVAALVVGFTIKK 389

Query: 376 TGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQL 435
             P+IIL  S++AF+ G I++SVTP+ QTYFR  LG M+ILSFGMDLSFPASSI+LSD+L
Sbjct: 390 VYPSIILFLSMVAFNCGSIIMSVTPIHQTYFRNHLGMMIILSFGMDLSFPASSILLSDKL 449

Query: 436 PSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGI 495
           P QYQGMAGSLVNTM+NYSMS CLGV+G  E+ VN  G D+LKGYR A Y+GIGLAS+  
Sbjct: 450 PLQYQGMAGSLVNTMVNYSMSFCLGVAGVVEQHVNNHGKDVLKGYRGAFYLGIGLASMAC 509

Query: 496 FVSGAYAIEDWWTRRRER 513
            +SGA  + +    R+  
Sbjct: 510 IISGALMLSEIIQGRKNE 527

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  574 bits (1480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/504 (54%), Positives = 351/504 (69%), Gaps = 1/504 (0%)

Query: 2   NSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSX 61
           N   + V K          V  + +  + +   + R QNP+YF   W EYLF+ + M+S 
Sbjct: 21  NESVSAVKKSSRHDGNEETVTISTDHGEEMTVDKQRWQNPNYFKNSWHEYLFIFTCMISQ 80

Query: 62  XXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLL 121
                       + ++++    +  + + WLMASFPLVSGSFIL+SG++GDIYGLKK L 
Sbjct: 81  LLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSGSFILISGRLGDIYGLKKMLT 140

Query: 122 GGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNM 181
            GY V++IWSLICGL+ Y+ +  FFI++R+FQGLGIAFVLPNV GI+GNIY   T  KN+
Sbjct: 141 IGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIYVSGTFRKNI 200

Query: 182 VFSMIGACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTN 240
           V S++GA AP+GATLGCLF+GLIGT++ + W W FYAYTI + +N  ++ Y IP+NIPTN
Sbjct: 201 VISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTITSIINLALSVYSIPNNIPTN 260

Query: 241 VHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFA 300
           +  F MDW+GS LGV GL++ NFVWNQAP  GWD AY                  E RFA
Sbjct: 261 IQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIVLLVISVVFLVVFIIYENRFA 320

Query: 301 KEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAI 360
           K PLLPRAVL +R ++ I+ +LF GWGSFGI+T+YY  F LN+RHY+ +WAGG+YFMF I
Sbjct: 321 KSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYSAVWAGGTYFMFLI 380

Query: 361 FGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGM 420
           +G IAA LVG  I K  P++ L  S++AF++G IM SVTPV +TYFR  LGTM+ILSFGM
Sbjct: 381 WGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTPVHETYFRTQLGTMIILSFGM 440

Query: 421 DLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGY 480
           D SFPASSII SD LP +YQGMAGSLVNT++NYSMSLCLG+  T E  V+ DG  +LKGY
Sbjct: 441 DFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETHVDPDGKHVLKGY 500

Query: 481 RAALYVGIGLASVGIFVSGAYAIE 504
           R A Y+GIGLAS+   +SG Y +E
Sbjct: 501 RGAQYLGIGLASLACIISGLYMVE 524

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/507 (54%), Positives = 356/507 (70%), Gaps = 1/507 (0%)

Query: 9   SKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXXXXXXXX 68
           S +  GS+ + +        D ++    + QNP YF   W+EYLF+ + M+S        
Sbjct: 30  SSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKYAWQEYLFIFTCMISQLLNQAGT 89

Query: 69  XXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVV 128
                + ++LS+   ++ + ++WLMASFPLVSGSFIL+SG++GDIYGLKK LL GY +V+
Sbjct: 90  TQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGDIYGLKKMLLVGYVLVI 149

Query: 129 IWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGA 188
           IWSLICG+++Y+ +  FFI+ R+FQGLGIAFVLPNV GI+GNIY   T  KN+V S +GA
Sbjct: 150 IWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLGIIGNIYVGGTFRKNIVISFVGA 209

Query: 189 CAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMD 247
            APIGATLGCLF+GLIGTE+   W W FYA++I + +N  ++ Y IP+NIPTN+H F MD
Sbjct: 210 MAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLINFGLSIYAIPNNIPTNIHHFSMD 269

Query: 248 WLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPR 307
           W+GS LGV GLI+ NFVWNQAP  GW  AY                  E  FAK PLLP 
Sbjct: 270 WIGSVLGVIGLILLNFVWNQAPISGWSQAYIIVILIISVIFLAVFIIYEMWFAKSPLLPH 329

Query: 308 AVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAF 367
           AV+ +  ++ I+ +LF GWGSFGI+T+YY  F LN+RHYT LWAGG+YFMF I+G IAA 
Sbjct: 330 AVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRHYTALWAGGTYFMFLIWGIIAAL 389

Query: 368 LVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPAS 427
           LVG TI    P++ L  S++AF+VG IM SVTPV +TYFR  LGTM+ILSFGMDLSFPAS
Sbjct: 390 LVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETYFRTQLGTMIILSFGMDLSFPAS 449

Query: 428 SIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVG 487
           SII SD LP +YQGMAGSLVNT++NYSMSLCLG+  T E Q++ DG  LLKGYR A Y+G
Sbjct: 450 SIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQLDPDGKHLLKGYRGAQYLG 509

Query: 488 IGLASVGIFVSGAYAIEDWWTRRRERS 514
           IGLAS+   +SG Y +E +    + ++
Sbjct: 510 IGLASLACMISGLYMVESFINDHKAKA 536

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/506 (53%), Positives = 358/506 (70%), Gaps = 11/506 (2%)

Query: 20  KVVDNHEDSDML----------LASRSRLQNPDYFDKQWKEYLFVISSMLSXXXXXXXXX 69
           KVV + ED D+           +++ S  Q+P YF    +E +F+++ ML+         
Sbjct: 29  KVVVSSEDEDVTTVASSNKSTQVSNDSPWQDPTYFSSFGRELMFIVTCMLAQLLNQAGQT 88

Query: 70  XXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVI 129
               + ++LS+   +++ +QAWLMASFPLV+GSFIL+SG++GDIYGLKK L+ GY  +++
Sbjct: 89  HALTIMNVLSKSFNSESDKQAWLMASFPLVAGSFILISGRLGDIYGLKKMLMIGYVTIIV 148

Query: 130 WSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGAC 189
           WSLICGLS Y++N  FFI  R+FQGLGIAF+LPNV G+VG++YK  +  KN+V S IGAC
Sbjct: 149 WSLICGLSKYSNNDAFFITCRAFQGLGIAFILPNVMGLVGHVYKVGSTRKNLVISFIGAC 208

Query: 190 AP-IGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDW 248
           AP  G   G     ++  +SE W W FYA+ I   LN ++AWY IP+NIPTNVH F MDW
Sbjct: 209 APAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAFFLNMILAWYSIPNNIPTNVHGFSMDW 268

Query: 249 LGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRA 308
            GS L V GLI+FNFVWNQAPT GW +AY                  E ++AK PLLP A
Sbjct: 269 TGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALLIISVFFLVAFFVYEVKYAKVPLLPHA 328

Query: 309 VLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFL 368
           V  NR ++MIL ++FLGWGSFGIWT+YYM+F LNLRHY+P+W GG+YF+F IFGTIAAF+
Sbjct: 329 VTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTYFVFVIFGTIAAFM 388

Query: 369 VGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASS 428
           V  +I + GPA +L  +++AFDVG IM SV PV Q++++++ G   IL FGMDLSFPASS
Sbjct: 389 VALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVKQSFWKLNFGMQAILCFGMDLSFPASS 448

Query: 429 IILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGI 488
           IILSD LP +YQGMAGSLVNT+INYS SLCLG+  T E Q+NK+G DLLKGYR A+Y+G+
Sbjct: 449 IILSDGLPMEYQGMAGSLVNTVINYSASLCLGMGATVEHQINKNGKDLLKGYRGAIYLGV 508

Query: 489 GLASVGIFVSGAYAIEDWWTRRRERS 514
           GLAS+G+ +S  Y +E +W  RR+R 
Sbjct: 509 GLASLGVLISFTYMLETFWNNRRDRQ 534

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/504 (54%), Positives = 355/504 (70%), Gaps = 1/504 (0%)

Query: 11  QRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXXXXXXXXXX 70
           +R  S   + +    E    +    S  Q+P+YF  +W E LFV+S M+           
Sbjct: 24  ERNLSREDKMLTTEKEAPVFVEEPESPWQDPNYFKGKWDEVLFVLSCMMGQLLNQAGSTM 83

Query: 71  XXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIW 130
                 +L  +L + +++ +WLMASFPLVSGSFIL+SG++GDIYGLKK LL GY  + IW
Sbjct: 84  TLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILISGRLGDIYGLKKMLLLGYIWLTIW 143

Query: 131 SLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACA 190
           SLICGLSS++HN  FFI +R+FQGLGI+FVLPN+ GIVGNIYKP T+ KN+V S+IG CA
Sbjct: 144 SLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYKPGTRRKNIVISLIGMCA 203

Query: 191 PIGATLGCLFSGLIGTESEA-WAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWL 249
           PIGAT G LF+G++    ++ W W FYAYTI A L  +I+++VIP++IP NV+KF MDW+
Sbjct: 204 PIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFVIPNSIPVNVNKFAMDWI 263

Query: 250 GSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAV 309
           GS LGV GL++FNFVWNQ+   GW + Y                  E ++AK PLLP+ V
Sbjct: 264 GSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALFFIFEIKYAKVPLLPKEV 323

Query: 310 LFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLV 369
             +R ++MILASL  GWGSFGIW +YY  FVL LR+Y+P+WAGG++FM +I G IAA  V
Sbjct: 324 TESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAGGTFFMVSIVGCIAALTV 383

Query: 370 GHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSI 429
           G +I + GPA++L  S+IAF  G I+LSVTPV +TYFR  LG MVILSFGMDLSFPA+SI
Sbjct: 384 GFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGAMVILSFGMDLSFPAASI 443

Query: 430 ILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIG 489
           ILSD+L  QYQGMAGSLVNT++NYSMSL LG+ GT ERQ+NK G  LL+G+RAALY  IG
Sbjct: 444 ILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKSGDRLLEGFRAALYFAIG 503

Query: 490 LASVGIFVSGAYAIEDWWTRRRER 513
           + S+GI +SG + ++    R + R
Sbjct: 504 VGSLGILISGVFVLQKELMRSKSR 527

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/511 (52%), Positives = 352/511 (68%), Gaps = 3/511 (0%)

Query: 9   SKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXXXXXXXX 68
           ++ +  S   ++V  N  DS  +L   S  QNP+YF  ++KEY F+ + M++        
Sbjct: 23  NEDKNISHNEKEVYSNSTDS--VLDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQAGQ 80

Query: 69  XXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVV 128
                  +++SE   + + +Q WLMASFPLVSGSFIL+SG++GDIYGLKKT++GGY  ++
Sbjct: 81  TQVLSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMI 140

Query: 129 IWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGA 188
           IWSL+CG + + HN  FFIV R+FQGLGI+F+LPNV G++GNIYK  T  KN+V SMIG 
Sbjct: 141 IWSLLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMIGL 200

Query: 189 CAPIGATLGCLFSGLIGTE-SEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMD 247
            AP GA +G L+ GLI TE ++ W W FYAY +   +N ++A Y +P+ IPTNVH F MD
Sbjct: 201 TAPTGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFAMD 260

Query: 248 WLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPR 307
           W+GS +GV GLI+FNFVWNQ P  GWD AY                  E ++   PLLP 
Sbjct: 261 WIGSIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYELKYPISPLLPV 320

Query: 308 AVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAF 367
            V  N +++ IL+ LFLGWG+FGIWT+YY AF LNLR Y+P+W GG+YFMF I+GTIAA 
Sbjct: 321 EVTKNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGTIAAL 380

Query: 368 LVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPAS 427
           +V  TI K GPAI+L  S + F +G +MLSVTP+ Q Y+RM+LG  +IL FGMDLSFPAS
Sbjct: 381 IVAFTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLSFPAS 440

Query: 428 SIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVG 487
           SIILSD LP QYQGMAGSLVNT+INY+ SLCLG+  T ERQ+NK G DLLKGYR+ALY+ 
Sbjct: 441 SIILSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLLKGYRSALYLA 500

Query: 488 IGLASVGIFVSGAYAIEDWWTRRRERSVRIK 518
           +GL  +G  ++        W +RR+R   +K
Sbjct: 501 VGLGGLGSCIAFINLCYTLWMKRRDRLADLK 531

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/493 (53%), Positives = 343/493 (69%), Gaps = 1/493 (0%)

Query: 27  DSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXXXXXXXXXXXXPLFDLLSEDLKAKA 86
             D LL + +  QN  YF    KEY F+ + M +               +++SE   +  
Sbjct: 17  SCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQVLSTMNVISESFHSDV 76

Query: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFF 146
             Q WLMASFPLVSGSFIL+SG++GDIYGLKKT++GGY  ++IW+L+CG + Y H+  FF
Sbjct: 77  GTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWTLLCGFADYTHSDTFF 136

Query: 147 IVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGT 206
           IV R+FQGLGI+F+LPN+ G+VGNIYK  T  KN+V S+IG  AP GA +G L+ GLI T
Sbjct: 137 IVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITAPTGACMGALWGGLIAT 196

Query: 207 ES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFNFVW 265
           ES   W W FYAY + A +N ++A Y +P+N+PTNVH F MDW+G+ +GV GLI+FNFVW
Sbjct: 197 ESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWMGAIIGVVGLILFNFVW 256

Query: 266 NQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILASLFLG 325
           NQ P +GW   Y                  E +F   PLLPR V  N +++ IL  LFLG
Sbjct: 257 NQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREVTKNGQILTILGILFLG 316

Query: 326 WGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIILLAS 385
           WGSFGIWT+YY AF LNLR+Y+PLWAG ++FMF I+G+IAAF+VG TI++ GPA++L  S
Sbjct: 317 WGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIVGFTINRVGPAVLLFFS 376

Query: 386 VIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGS 445
            + F +G +MLSVTP+ QTY+RM++G  +ILSFGMDLSFPASSIILSD LP QYQGMAGS
Sbjct: 377 ALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSIILSDHLPMQYQGMAGS 436

Query: 446 LVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAYAIED 505
           LVNT+INYS SLCLG+  T ERQ+NK G +LL+GYR+ALY+ +GL  +G  V+      D
Sbjct: 437 LVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVGLGGLGACVAFLNLCYD 496

Query: 506 WWTRRRERSVRIK 518
            W +R+ R   I+
Sbjct: 497 LWRKRKSRLDDIR 509

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/460 (57%), Positives = 335/460 (72%), Gaps = 1/460 (0%)

Query: 27  DSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXXXXXXXXXXXXPLFDLLSEDLKAKA 86
           D++    + +  QNP YF  +WKEYLF+++ MLS               +++     A +
Sbjct: 58  DAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQAGQTQATSTMNVIGSAFNADS 117

Query: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFF 146
           S + WLMASFPLVSGSFILVSG++GDIYGLK+T++GG  V++IWSLICG ++Y+ +V FF
Sbjct: 118 SSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLIVMIIWSLICGFANYSSSVTFF 177

Query: 147 IVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGT 206
           I+ R+FQGLGIAFVLPNV G+VGNIYK  +  KN+V S IG CAP GA  G  ++GLI T
Sbjct: 178 IICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISCIGMCAPTGAAFGAFWAGLIAT 237

Query: 207 ESEA-WAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFNFVW 265
           ++E  W W FYAY     LN ++A Y IPD +P NVH F MDW GS +GV GLI+FNFVW
Sbjct: 238 KAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGFSMDWTGSVVGVIGLILFNFVW 297

Query: 266 NQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILASLFLG 325
           N+AP  GW+ AY                  E +FAK PLLP+AV  N  ++MIL+++F+G
Sbjct: 298 NEAPIVGWEKAYIIVLLIFSLLIIVVFFIYEIKFAKSPLLPQAVTHNHNIIMILSAMFMG 357

Query: 326 WGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIILLAS 385
           WGSFGIWT+YY AF+LNLR YTPL AG S+ MF ++GTIAAF V  TI + GP+++L  S
Sbjct: 358 WGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTIAAFTVAFTIKRVGPSVLLFCS 417

Query: 386 VIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGS 445
           ++AF VG IMLS+TPV QTY++M+ G  +IL+FGMDLSFPASSIILSD LP +YQGMAGS
Sbjct: 418 MVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSFPASSIILSDALPMEYQGMAGS 477

Query: 446 LVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALY 485
           LVNT++NYS SLCLG+  TAE QVNK+GTDLLKGYRAALY
Sbjct: 478 LVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRAALY 517

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/517 (51%), Positives = 354/517 (68%), Gaps = 10/517 (1%)

Query: 9   SKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXXXXXXXX 68
           S+    S +++ +  +  D+D      S  QNPDYF  +++E+ F+ S M+         
Sbjct: 37  SRSSLNSSLTQVLSTDTADND----ESSSYQNPDYFKNKYQEFGFIFSGMIGQLLSQAGL 92

Query: 69  XXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVV 128
                + ++L+++L + +S+QAWLM+SFPL  GSFILVSG++GDIYGLKK LLGGY +  
Sbjct: 93  TQTLSIMNVLAKELDSTSSRQAWLMSSFPLALGSFILVSGRLGDIYGLKKILLGGYIITT 152

Query: 129 IWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGA 188
           +WS+ICGLSSYAHN  FFI AR+FQGLG+AF LPN+ G++G IY+P    KNM+ S+IGA
Sbjct: 153 VWSIICGLSSYAHNDAFFITARAFQGLGLAFALPNMIGLIGTIYRPGCFRKNMIISIIGA 212

Query: 189 CAPIGATLGCLFSGL-IGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMD 247
            +P GATLG LF+GL +  +   W W+FYA+ +++ +N +I+WY IP++IPTN+H  KMD
Sbjct: 213 MSPTGATLGGLFAGLTVKYDKSNWPWSFYAFGLISFVNLIISWYCIPNSIPTNIHGLKMD 272

Query: 248 WLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPR 307
           WLGS LGV GLI+ NFV+NQAP  GW SAY                  E ++AK PL+P+
Sbjct: 273 WLGSVLGVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPK 332

Query: 308 AVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAF 367
           A+  NR ++MIL SLF GWGSFGIWT+YY +F LNLRHY+PLWAG SYF+F I G+  A 
Sbjct: 333 AISSNRGMLMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSYFIFVISGSTVAI 392

Query: 368 LVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPAS 427
           + G TI K  P+++   S++ F  G I+ + TPV+QT+FR  LG M +L  GMD SFPAS
Sbjct: 393 VCGLTIKKIKPSVLFCCSMMGFLGGNIIFAATPVNQTFFRNMLGCMFLLPLGMDFSFPAS 452

Query: 428 SIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVG 487
           SIILSD LP QYQGMAGSLVNT+INYS S+CLG++GT E + N  G DLL GYRAA+Y  
Sbjct: 453 SIILSDSLPMQYQGMAGSLVNTVINYSTSICLGMAGTVEMKHNSHGKDLLNGYRAAIYFA 512

Query: 488 IGLASVGIFVSGAYAIEDWWTRRRERSVRIKLDEKHQ 524
           IGLA + + VSG Y IE  W  R      + L+E  Q
Sbjct: 513 IGLAGLAVCVSGGYMIECLWKDR-----VLSLEENKQ 544

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/527 (51%), Positives = 363/527 (68%), Gaps = 19/527 (3%)

Query: 9   SKQRTGSDISRK--------VVDNHEDSDML----------LASRSRLQNPDYFDKQWKE 50
           S Q T S+I  K        VV + ED ++           + + S  Q+P YF    KE
Sbjct: 10  SVQGTDSEIDEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQVTNDSPWQDPTYFSSFGKE 69

Query: 51  YLFVISSMLSXXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKV 110
            +F+ + ML+             + ++LS+   ++A+ QAWLMASFPL +GSFIL+SG++
Sbjct: 70  LMFIATCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRL 129

Query: 111 GDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGN 170
           GDIYGLKK L+ GY +V++WS+I GLS Y+++  FFI +R+FQG+GIAF+LPN+ G+VG+
Sbjct: 130 GDIYGLKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGH 189

Query: 171 IYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIA 229
           +YK  +  KN+V S IGACAP G   G LF GLI TE    W W FYA+ I   L+ L+A
Sbjct: 190 VYKVGSFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMA 249

Query: 230 WYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXX 289
           WY IP+N+PTN+H   MDW GS L + GLI+FNFVWNQAP  GWD  Y            
Sbjct: 250 WYSIPNNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIFL 309

Query: 290 XXXXXXEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPL 349
                 E+++A+ PLLPRA+  NR ++MIL ++FLGWGSFGIWT+YY++F LNLRHY+P+
Sbjct: 310 VAFFVYESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPV 369

Query: 350 WAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMS 409
           W GG+YF+F IFG++AAF V  +I + GPA++L  S++AFD G IM SV PV+Q+Y++++
Sbjct: 370 WTGGTYFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLN 429

Query: 410 LGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQV 469
                IL FGMDLSFPASSIILSD LP QYQGMAGSLVNT+INYS SLCLG+ GT E Q+
Sbjct: 430 FAMQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQI 489

Query: 470 NKDGTDLLKGYRAALYVGIGLASVGIFVSGAYAIEDWWTRRRERSVR 516
           NK G DLLKGYRAA+Y+G+GLAS+G+ +S  Y +E+ W R R+   R
Sbjct: 490 NKSGNDLLKGYRAAVYLGVGLASLGVVISVTYMLENLWNRHRKSEDR 536

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/477 (51%), Positives = 338/477 (70%), Gaps = 1/477 (0%)

Query: 39  QNPDYFDKQWKEYLFVISSMLSXXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPL 98
           Q P YF  +  E+ F+ + ++              + ++++ED  ++ S+QAWL ASFPL
Sbjct: 66  QKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFPL 125

Query: 99  VSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIA 158
           VSGSFILV G+ GDIYGLKK LL GYA++ IWS+ICGL+ Y H+ DFFIVA++FQGLG++
Sbjct: 126 VSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGVS 185

Query: 159 FVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEA-WAWTFYA 217
           F+LPN+ G+VG IY+P +  KN+  S IGA AP+GAT G LFSG++  + +  W WTFYA
Sbjct: 186 FILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFYA 245

Query: 218 YTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAY 277
           + IV+ L G+  ++ +PDN+PTN +  KMDW+GS +GV GL++F+FVWNQAP DGWD AY
Sbjct: 246 FAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKAY 305

Query: 278 XXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYM 337
                             E  +A+ PLLP+A+  NR ++MIL ++F+GWG+FGIW++YY 
Sbjct: 306 IIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYYF 365

Query: 338 AFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLS 397
           +F LNLRH++P+W GG+YF F + G   A  VG  I    P+IIL+ S+  F +G ++ +
Sbjct: 366 SFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIFA 425

Query: 398 VTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSL 457
           VTP DQTY+R + G M++L  GMDLSFPASSIILSDQLP +YQGMAGSLVNTM+NYS S 
Sbjct: 426 VTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQSF 485

Query: 458 CLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAYAIEDWWTRRRERS 514
           CLGV+ T E+Q+N  G DLLKGYRAA Y G+G+ ++GI ++  Y  E +WT  +E++
Sbjct: 486 CLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFWTDYKEKT 542

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/516 (50%), Positives = 359/516 (69%), Gaps = 9/516 (1%)

Query: 6   TPVSKQRTGSDISRKVVDNHEDSDMLLASR--------SRLQNPDYFDKQWKEYLFVISS 57
           +PV+ + +  +  + +V   E+   + +S         S  Q+P YF    KE +F+ + 
Sbjct: 16  SPVNDKISMKEEDKVIVSTDEEVTTVASSSKSNQISNDSPWQDPTYFSSFGKELMFIGTC 75

Query: 58  MLSXXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLK 117
           ML+             + ++LS+   ++++ QAWLMASFPL +GSFIL+SG++GDIYGLK
Sbjct: 76  MLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFILISGRLGDIYGLK 135

Query: 118 KTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTK 177
           K L+ GY ++++WS+I GLS Y++N  FFI  R+FQG+GIAF+LPN+ G+VG++YK  + 
Sbjct: 136 KMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNIMGLVGHVYKVGSL 195

Query: 178 AKNMVFSMIGACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDN 236
            KN+V S+IGAC P GA  G +F GLI TE    W W FYA+ I   ++ L+AWY IP+N
Sbjct: 196 RKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATFISMLMAWYSIPNN 255

Query: 237 IPTNVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXE 296
           +PTNVH   MDW GS L V GLI+FNFVWN+AP  GWD AY                  E
Sbjct: 256 VPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLVVSVFFLVAFFVYE 315

Query: 297 ARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYF 356
            ++A+ PLLP AV  NR ++MIL ++F+GWGSFGIWT+YY++F LNLRHY+P+W GG+YF
Sbjct: 316 IKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYF 375

Query: 357 MFAIFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVIL 416
           +FAIFGTIAAF V  +I + GPA++L  +++AFD G IM SV PV+Q+Y++++     +L
Sbjct: 376 VFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAVL 435

Query: 417 SFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDL 476
            FGMDLSFPASSIILSD LP QYQGMAGSLVNT+INYS SLCLG+  T E Q+NK G ++
Sbjct: 436 CFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGATVEHQINKSGKNV 495

Query: 477 LKGYRAALYVGIGLASVGIFVSGAYAIEDWWTRRRE 512
           L+GYRAA+Y+GIGLAS+G+ +S  Y +E  W  R++
Sbjct: 496 LEGYRAAVYLGIGLASLGVLISVTYMLETVWNERKK 531

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  535 bits (1377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/511 (52%), Positives = 347/511 (67%), Gaps = 12/511 (2%)

Query: 18  SRKVVDNHEDSDM-----------LLASRSRLQNPDYFDKQWKEYLFVISSMLSXXXXXX 66
            RK     +D ++           L  + S  QNPDYF   +KEY+FV + M++      
Sbjct: 32  ERKTAIKEQDDEIGSDSTTTSSSSLQENNSSWQNPDYFSSSFKEYIFVATCMIANLLNQA 91

Query: 67  XXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAV 126
                    +++S+   +    Q WLMASFPLVSGSFIL+SG++GDIYGLK+ ++GG+  
Sbjct: 92  GQSQVLSAMNVISDSFHSSTGGQTWLMASFPLVSGSFILISGRLGDIYGLKRMMIGGFIF 151

Query: 127 VVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMI 186
           ++IWSLICG ++YAH+  FFIVAR+FQGLGI+F+LPNV G+VGNIYK  T  KN+V S+I
Sbjct: 152 MIIWSLICGFTNYAHSDTFFIVARAFQGLGISFILPNVMGLVGNIYKVGTLRKNVVISLI 211

Query: 187 GACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFK 245
           G  AP G+  G L+ GLI TE+ + W W FYAY + AA+  ++ +Y +PDNIPTNV+ F 
Sbjct: 212 GIMAPTGSCFGALWGGLIVTENPKQWPWIFYAYAVAAAVCLVMGYYTVPDNIPTNVNGFT 271

Query: 246 MDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLL 305
           MDW+GS LGV GLI+FNFVWNQ P  GW+ AY                  E ++AK PLL
Sbjct: 272 MDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYIIVLLIVSVIFLIAFFVYEIKYAKVPLL 331

Query: 306 PRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIA 365
           P+AV  N  ++ IL  LFLGWGSFGIWT+YY AF LNLR Y+P+W+GG++F+F IFGT+A
Sbjct: 332 PKAVTQNGHILTILTVLFLGWGSFGIWTFYYFAFQLNLREYSPVWSGGTFFVFIIFGTVA 391

Query: 366 AFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFP 425
           A  V  TI K GPAI+L  S I F  G I++SVTPV QTY+R + G  +IL FGMDL FP
Sbjct: 392 ATTVALTIKKVGPAILLFFSAIGFTCGSIIMSVTPVHQTYWRNTFGMQIILVFGMDLPFP 451

Query: 426 ASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALY 485
           ASSIILSD LP QYQGMA SLVNT++NYS SLCLG+  T ERQ+NK G DLLKGYRAALY
Sbjct: 452 ASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLCLGMGTTVERQINKSGDDLLKGYRAALY 511

Query: 486 VGIGLASVGIFVSGAYAIEDWWTRRRERSVR 516
            G+G+A +G  ++      D W++R  +  +
Sbjct: 512 FGVGIAGLGACIAFLNVCHDIWSKRNAKDPK 542

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/502 (55%), Positives = 356/502 (70%), Gaps = 8/502 (1%)

Query: 21  VVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXXXXXXXXXXXXPLFDLLSE 80
           V D HE+        S  QNP+YF+  +KE +F+IS M++               ++L++
Sbjct: 63  VDDCHEND-------SPFQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLAD 115

Query: 81  DLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYA 140
             K+ +S+Q WLMASFPLVSGSFIL+SG++GDIYGLKK L  GY ++ +WS+ICGL+ Y 
Sbjct: 116 YFKSNSSKQPWLMASFPLVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYT 175

Query: 141 HNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLF 200
           ++  FFIV RSFQGLGIAF+LPN+ G+VGNIYK  T  KN+V S IG  AP GA LG LF
Sbjct: 176 NSDAFFIVCRSFQGLGIAFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALF 235

Query: 201 SGLIGTE-SEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLI 259
            GLI TE +E W W FYA+ I + +N L+A Y IP+N+PTN++   MDW+GS LGV GL+
Sbjct: 236 GGLIVTEDAEQWPWVFYAFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLL 295

Query: 260 MFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMIL 319
           + N VWNQAP  GW  AY                  E ++A  PLLP +VL N+K++MIL
Sbjct: 296 LLNIVWNQAPIVGWGEAYIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMIL 355

Query: 320 ASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPA 379
           A+LF GWGSFGIWTYYY AF LNLR YTPLWAGG++FMF I+GT+AAF+V  TI K GPA
Sbjct: 356 AALFFGWGSFGIWTYYYYAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPA 415

Query: 380 IILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQY 439
           ++L  S++AFD G IMLSVTPV QTY+RM++G  +ILSFGMDLSFPASSIILSD LP QY
Sbjct: 416 VLLCFSMVAFDCGSIMLSVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQY 475

Query: 440 QGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSG 499
           QGMAGSLVNT++NYS SLCLG+  T E+Q N  G DLLKGYR+ALY+ IGLAS G+ VS 
Sbjct: 476 QGMAGSLVNTVVNYSTSLCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSL 535

Query: 500 AYAIEDWWTRRRERSVRIKLDE 521
            + + D   +R  + +  + + 
Sbjct: 536 VFLVTDIIAKRHRKRIESECES 557

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/516 (52%), Positives = 360/516 (69%), Gaps = 11/516 (2%)

Query: 12  RTGSDISRKVVDNHEDSDMLLASRSRL----------QNPDYFDKQWKEYLFVISSMLSX 61
           +T   +  KVV + ED ++   + S            Q+P YF    KE +F+ + ML+ 
Sbjct: 21  KTIMKVDDKVVISTEDEEVTTVTSSNESNQVTNDSPWQDPIYFSSFGKELMFIATCMLAQ 80

Query: 62  XXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLL 121
                       + ++LS+   ++++ QAWLMASFPL +GSFIL+SG++GDIYGLKK LL
Sbjct: 81  LLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGDIYGLKKMLL 140

Query: 122 GGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNM 181
            GY +++IWS+I GLS Y+++  FFI  R+FQGLGIAF+LPN+ G+VG++YK  +  KN+
Sbjct: 141 IGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVYKVGSLRKNL 200

Query: 182 VFSMIGACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTN 240
           V S+IGACAP G   G +F GLI TE  E W W FYA++I   ++ L+AWY IP+N+PTN
Sbjct: 201 VISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWYSIPNNVPTN 260

Query: 241 VHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFA 300
           VH   MDW GS L V GLI+FNFVWNQAP  GW  AY                  E ++A
Sbjct: 261 VHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIAFFVYEIKYA 320

Query: 301 KEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAI 360
           + PLLP AV  NR ++MIL ++FLGWGSFGIWT+YY++F LNLRHY+P+W GG+YF+F I
Sbjct: 321 EVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGTYFVFVI 380

Query: 361 FGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGM 420
           FG+IAAF V  +I + GPAI+L  +++AFD G IM SV PV+Q+Y++++     IL FGM
Sbjct: 381 FGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFAMQAILCFGM 440

Query: 421 DLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGY 480
           DLSFPASSIILSD LP QYQGMAGSLVNT+INYS SLCLG+  T ERQ+NK G +LLKGY
Sbjct: 441 DLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINKSGQNLLKGY 500

Query: 481 RAALYVGIGLASVGIFVSGAYAIEDWWTRRRERSVR 516
           RAA+Y+GIGLAS+G+ +S  Y +E++W + +E   +
Sbjct: 501 RAAIYLGIGLASLGLLISVTYMLENFWNKHKESEKK 536

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/526 (50%), Positives = 352/526 (66%), Gaps = 13/526 (2%)

Query: 1   MNSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLS 60
           MN     +S     SDI      N E+    L S +++ +P YF  +  EYLF+IS M+S
Sbjct: 59  MNEVIGSISSVSNDSDI------NSEN----LQSENKVLSPKYFKNRTHEYLFIISCMVS 108

Query: 61  XXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120
                        + ++L+E+L A+ S+QAWLMASF L  GSFILVSG++GDIYGLKK L
Sbjct: 109 QFMSQAGLTQALSIMNILAEELNAEKSRQAWLMASFTLSMGSFILVSGRLGDIYGLKKVL 168

Query: 121 LGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKN 180
           LGGYA++ IWSLICG SSY+HN  FFI +R+FQGLG+AFVLPN  G++G IY+P +  KN
Sbjct: 169 LGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGLGLAFVLPNSLGLIGVIYEPGSMKKN 228

Query: 181 MVFSMIGACAPIGATLGCLFSGLIGT-ESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPT 239
           M+   +GA +PIGATLG LF+G+IGT + + W W+FY++ IV+  N +++WY IP+NIPT
Sbjct: 229 MIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWSFYSFGIVSFCNMILSWYSIPNNIPT 288

Query: 240 NVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARF 299
           N++   MDW+G+ LG+ GL++ NFV+NQAP  GW SAY                  E ++
Sbjct: 289 NIYNLSMDWIGAILGIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCALVIFVVYEVKY 348

Query: 300 AKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFA 359
           AK PL+P+A+  NR ++MIL +LF GWG+FG WT+YY +FVLN+R YT  WAGGSYF+F 
Sbjct: 349 AKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTFYYFSFVLNVRGYTAAWAGGSYFIFI 408

Query: 360 IFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFG 419
           + G   A L G  + K  P++IL  S+I F  GC+ML+VTP+ Q+YF+  LG M +L  G
Sbjct: 409 VSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCVMLTVTPIHQSYFQNILGIMFVLPIG 468

Query: 420 MDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKG 479
           +DLSFPA+SIILSD LP QYQGMAGSLV T+ NYS S+CLG++G+ E   N +G ++LKG
Sbjct: 469 IDLSFPAASIILSDALPIQYQGMAGSLVYTITNYSTSICLGMAGSVEAYHNDNGQNILKG 528

Query: 480 YRAALYVGIGLASVGIFVSGAYAIEDWWTRRRERSVRIKLDEKHQE 525
           YR A+     LA +GI VSG Y + +  T R       K   KH E
Sbjct: 529 YRNAMIFADALAGLGIIVSGIYMVINLITIRENSKSTNK--PKHLE 572

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  519 bits (1337), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 257/524 (49%), Positives = 341/524 (65%), Gaps = 5/524 (0%)

Query: 4   EYTPVSKQRTGSDISRKVVDNH----EDSDMLLASRSRLQNPDYFDKQWKEYLFVISSML 59
           + T V+ Q +   +S  V  +     +D    +++ S+ Q+P YF   W+EY F+ + ML
Sbjct: 23  QTTTVTAQTSLDVLSDSVKKDQISITDDDVSSISNNSKWQDPTYFKSSWQEYTFIGTCML 82

Query: 60  SXXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKT 119
           +               ++L++ L +  + + WLMASF L SGSFILVSG++GDIYGLK T
Sbjct: 83  ANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASGSFILVSGRIGDIYGLKAT 142

Query: 120 LLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAK 179
            +GG  +  IWS++CG+S Y  NV FFI+ R+FQGLG+AFVLPNV G+VGNIY   +  K
Sbjct: 143 FIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVLPNVMGLVGNIYNVGSMRK 202

Query: 180 NMVFSMIGACAPIGATLGCLFSGLI-GTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIP 238
           N+V S IG  AP+G T G ++ GLI  +  + W W F+A  I   +N ++  Y IP+++P
Sbjct: 203 NIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAIAVFINLIMGIYSIPNHVP 262

Query: 239 TNVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEAR 298
           TN++  KMDW+GS LGV GLI+ NFVWNQAP  GW  AY                  E +
Sbjct: 263 TNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIVILIVAVFFLVAFFIYELK 322

Query: 299 FAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMF 358
            A+ PLLP  V  NR ++ I+ SLFLGWG+FGIWT+YY AF LNLRH++PLWAG ++F+F
Sbjct: 323 KAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFNLNLRHFSPLWAGSTHFVF 382

Query: 359 AIFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSF 418
            IFG++ A  V  TI+K GP+++   S I F  G I+ SVT  DQTY+R SLG  +IL+ 
Sbjct: 383 IIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTSPDQTYWRNSLGMQIILAL 442

Query: 419 GMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLK 478
           GMDLSFP SSIILSD LP QYQGM+GSLVNT+ NY+ SLCLG+  TAE Q N  G D+LK
Sbjct: 443 GMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLGMGTTAEVQYNNGGKDVLK 502

Query: 479 GYRAALYVGIGLASVGIFVSGAYAIEDWWTRRRERSVRIKLDEK 522
           GYRAALYV IGL ++G   S +Y  ED W R R+R    K ++K
Sbjct: 503 GYRAALYVAIGLGALGFAFSFSYMAEDLWIRYRKRRQNEKKEDK 546

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  506 bits (1302), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 255/486 (52%), Positives = 333/486 (68%), Gaps = 2/486 (0%)

Query: 1   MNSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLS 60
           M    T   K+   SDIS     N E  ++++  +S+ Q+P YF   ++EYLFV S M +
Sbjct: 1   MAESRTSSIKEHIQSDISIDKSSN-EKCEVIVREKSKWQDPGYFKNSFQEYLFVGSCMTT 59

Query: 61  XXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120
                        + ++LS+   +  S Q WL+ASFPLV+GSFIL+SG++GDIYGLKKTL
Sbjct: 60  QLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLKKTL 119

Query: 121 LGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKN 180
           +GGY  ++IWSLICG + Y+ +  F I+AR+FQGLGIAF LPNV G +GNIY   +  KN
Sbjct: 120 IGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSLRKN 179

Query: 181 MVFSMIGACAPIGATLGCLFSGLIGTESEA-WAWTFYAYTIVAALNGLIAWYVIPDNIPT 239
           MV S+I A AP+GA +G  F+GLI TES + W W+FYA+ I  + N LI+ Y IP NIPT
Sbjct: 180 MVISLIAASAPVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSNIPT 239

Query: 240 NVHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARF 299
           NV+ FKMDW+GS L V GLI+FNF WNQ P  GWD AY                  E  F
Sbjct: 240 NVNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYEINF 299

Query: 300 AKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFA 359
           A  PL+ R +  +R +++ + +LFLGWGS+GIW++YY +FVLNLRHY+P+WAGGSYF+F 
Sbjct: 300 APSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYFIFG 359

Query: 360 IFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFG 419
           IFG +A+  VG +I K    +ILL S++ F VG  +LSV PVDQ+YF+++L  M IL  G
Sbjct: 360 IFGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAILGVG 419

Query: 420 MDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKG 479
           +D SFPA++IILSD LP +YQGMAGSL  TM+NYSMSLCLG+  T ERQ+NKDG D+LKG
Sbjct: 420 LDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDVLKG 479

Query: 480 YRAALY 485
           YR+A Y
Sbjct: 480 YRSAEY 485

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  458 bits (1178), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 223/500 (44%), Positives = 315/500 (63%), Gaps = 1/500 (0%)

Query: 27  DSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXXXXXXXXXXXXPLFDLLSEDLKAKA 86
           D+   +     L+ PD F  +++E+ FV+  ++                ++L+E+L    
Sbjct: 99  DNKPFITESQNLRRPDIFKNRFQEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTK 158

Query: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFF 146
            +Q WLMA+FPL  G  IL+SG++GDI+GLKK LL GY +  IW+LICG SSYAH+ D F
Sbjct: 159 MRQPWLMAAFPLGLGCTILISGRLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLF 218

Query: 147 IVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGL-IG 205
           IV+R+FQGLG+A  LPN+  ++G IYKP+   KNM+F +IGA +PIGATLG +F+GL + 
Sbjct: 219 IVSRTFQGLGLACALPNMFELIGIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVK 278

Query: 206 TESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFNFVW 265
              + W W+FY++ IVA LNG+IAW+ IP++I  N    KMDW+GS LG+ GL++ NFV+
Sbjct: 279 YNIKNWPWSFYSFAIVAFLNGIIAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVF 338

Query: 266 NQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILASLFLG 325
           NQ P DGW SAY                  E   A  PL+P+ +  N +L++IL +LF G
Sbjct: 339 NQTPIDGWSSAYLIVLLVVSVVALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCG 398

Query: 326 WGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIILLAS 385
           WG F IWT+YY AF LNLRHY+PLWA  S F+  I GTI   +    + +  P I+L  S
Sbjct: 399 WGGFAIWTFYYFAFQLNLRHYSPLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFS 458

Query: 386 VIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGS 445
           ++ F  G I+ +VTP+ QT+FR   G+M +   GM  SFP++S++ ++ LP+ Y+ MAGS
Sbjct: 459 MLGFLGGNILFAVTPIHQTFFRNMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGS 518

Query: 446 LVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAYAIED 505
           LVN  INY+ S+C+G++G+A    N  G DLL G+RAA Y+ IGL+   +F+SG Y I  
Sbjct: 519 LVNVAINYATSICVGMAGSANVNHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGS 578

Query: 506 WWTRRRERSVRIKLDEKHQE 525
            WT R ++    KL     E
Sbjct: 579 IWTDRNQKMKENKLINTDSE 598

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  323 bits (827), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 175/444 (39%), Positives = 264/444 (59%), Gaps = 11/444 (2%)

Query: 84  AKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNV 143
           A   Q +W  +++ L  G+FIL++G++GDI+G KK  + G+    +WSL+ G S Y++ +
Sbjct: 78  ANPGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQI 137

Query: 144 DFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGL 203
            FF   R+FQG+G AF+LPN   I+G  YKP  + KNMVFS+ GA AP G  LG +FS +
Sbjct: 138 -FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRR-KNMVFSLFGASAPGGFVLGAVFSSM 195

Query: 204 IGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTN--VHKFKM----DWLGSFLGVCG 257
           +G +   W W ++   I   L  +  +Y+IP     N  V  FK+    D+ GS  GV G
Sbjct: 196 LG-QLAWWPWAYWLMGIACFLLAVAGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVG 254

Query: 258 LIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMM 317
           LI+FNF WNQ P  GW + Y                  E+R A  PLLP A L +     
Sbjct: 255 LILFNFAWNQGPVVGWQTPYTYALLIVGTVFLIIFAFIESR-AAFPLLPFAAL-SSDTAF 312

Query: 318 ILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTG 377
           +L+ +  GW SFGIW +Y   F+ + R  TPL +   +   AI G  AA + G  +  T 
Sbjct: 313 VLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTP 372

Query: 378 PAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPS 437
           P+ ++  ++ AF VG I+++  PV QTY+  +  +++++ +GMD+SFPA++I+LSD +P 
Sbjct: 373 PSTVMFFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPH 432

Query: 438 QYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFV 497
           ++QG+A SLVNT++NYS+S+ LG++GT E  VN  G ++LKGYR + Y+GIGL+  GIFV
Sbjct: 433 EHQGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFV 492

Query: 498 SGAYAIEDWWTRRRERSVRIKLDE 521
           +  YA+  +   ++  S +    E
Sbjct: 493 AATYAVSTFMKSKKRVSEKQHFIE 516

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  318 bits (815), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 174/443 (39%), Positives = 264/443 (59%), Gaps = 17/443 (3%)

Query: 88  QQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFI 147
           Q +W  +++ L  G+FIL++G++GDI+G KK  + G+    +WSL+ G S Y++ + FF 
Sbjct: 82  QLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNKI-FFD 140

Query: 148 VARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTE 207
             R+FQG+G AF+LPN   I+G  YK + K KNMVFS+ GACAP G  LG +FS L+G +
Sbjct: 141 CCRAFQGMGPAFLLPNAIAILGRTYK-SGKRKNMVFSLFGACAPGGFVLGAVFSSLLG-Q 198

Query: 208 SEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVH--KFKM----DWLGSFLGVCGLIMF 261
              W W ++   I      +  +++IP     + H   FK+    D+ GS  GV GLI+F
Sbjct: 199 LAWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLILF 258

Query: 262 NFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILAS 321
           NF WNQ P  GW + Y                  E+R A  PLLP A L +     +L+ 
Sbjct: 259 NFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESR-AAFPLLPFAAL-SSDTAFVLSC 316

Query: 322 LFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAII 381
           +  GW SFGIW +Y   F+ + R  TPL +   +   A+ G  AA   G+ + +T P+ +
Sbjct: 317 IAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPSTV 376

Query: 382 LLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQG 441
           +L ++ AF  G I+++  PV QTY+  +  +++++ +GMD+SFPA++I+LSD +P ++QG
Sbjct: 377 MLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQG 436

Query: 442 MAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAY 501
           +A SLVNT++NYS+S+ LG++GT E  VN  G   LKGYR + Y+GIGL+ +GIFV+  Y
Sbjct: 437 LAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAAIY 496

Query: 502 AIEDWWTRRRERSVRIKLDEKHQ 524
           A   W T ++ +    +  EK  
Sbjct: 497 A---WSTFKKSKK---RTSEKQH 513

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  317 bits (812), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/445 (39%), Positives = 268/445 (60%), Gaps = 16/445 (3%)

Query: 85  KASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVD 144
            A Q +W  +++ L  G+FIL++G++GDI+G KK  + G+    +WSL+ G S Y++ + 
Sbjct: 78  NAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYSNQI- 136

Query: 145 FFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLI 204
           FF   R+FQG+G AF+LPN   I+G  YKP  + KNMVFS+ GA AP G  LG +FS ++
Sbjct: 137 FFDCCRAFQGMGPAFLLPNAIAILGRTYKPGRR-KNMVFSLFGASAPGGFFLGAVFSSML 195

Query: 205 GTESEAWAWTFYAYTIVAALNGLIAWYVIPDN-IPT-NVHKFKM----DWLGSFLGVCGL 258
           G +   W W ++   I   +  +  ++VIP   +P+ +   FK+    D+ GS  GV GL
Sbjct: 196 G-QLAWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGL 254

Query: 259 IMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMI 318
           I+FNF WNQ P  GW + Y                  E+R A  PLLP A L +     +
Sbjct: 255 ILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESR-AAFPLLPFAAL-SSDTAFV 312

Query: 319 LASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGP 378
           L+ +  GW SFGIW +Y   F+ + R  TPL +   +   AI G  AA   G  +  T P
Sbjct: 313 LSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCAAVTTGFLLSHTPP 372

Query: 379 AIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQ 438
           + ++L ++ AF VG I+++  PV QTY+  +  +++++ +GMD+SFPA++I+LSD +P +
Sbjct: 373 STVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHE 432

Query: 439 YQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVS 498
           +QG+A SLVNT++NYS+S+ LG++GT E +VN  G   LKGYR + Y+GIGL+ +GIFV+
Sbjct: 433 HQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWYMGIGLSGLGIFVA 492

Query: 499 GAYAIEDWWTRRRERSVRIKLDEKH 523
             YA    W+   +   RI  +++H
Sbjct: 493 ATYA----WSTFMKSKKRIS-EKQH 512

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  313 bits (803), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 170/439 (38%), Positives = 263/439 (59%), Gaps = 11/439 (2%)

Query: 88  QQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFI 147
           Q +W  +S+ L  G+FIL++G++GDI+G +K  + G+    +WSL+ G S Y++ + FF 
Sbjct: 82  QLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSLLAGFSVYSNKI-FFD 140

Query: 148 VARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTE 207
             R+FQG+G AF+LPN   I+G  YKP  K KNMVFS+ GA AP G  LG +FS ++G +
Sbjct: 141 CCRAFQGMGPAFLLPNAIAILGRTYKPG-KRKNMVFSLFGASAPGGFVLGAVFSSMLG-Q 198

Query: 208 SEAWAWTFYAYTIVAALNGLIAWYVIPD------NIPTNVHKFKMDWLGSFLGVCGLIMF 261
              W W ++   I   L  +  ++VIP       + P+     ++D+ GS  GV GLI+F
Sbjct: 199 LAWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNMLERVDFAGSVTGVIGLILF 258

Query: 262 NFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILAS 321
           NF WNQ P  GW++ Y                  E+R A  PLLP A L +     +L  
Sbjct: 259 NFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESR-AAYPLLPFAAL-SSDAAFVLGC 316

Query: 322 LFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAII 381
           +  GW SFGIW +Y   F+   R  +PL +   +   AI G  AA   G  +  T  + +
Sbjct: 317 IAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFCAAVTTGFLLSHTPASTV 376

Query: 382 LLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQG 441
           +L ++ AF VG I+++  PV QTY+  +  +++++ +GMD+SFPA++I+LS+ +P ++QG
Sbjct: 377 MLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSNSMPHEHQG 436

Query: 442 MAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAY 501
           +A SLVNT++NYS+S+ LG++GT E QVN  G + LKGYR + Y+GIGL+ +GIFV+  Y
Sbjct: 437 LAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYRCSWYMGIGLSGLGIFVAAVY 496

Query: 502 AIEDWWTRRRERSVRIKLD 520
           A   +   +++ S +  ++
Sbjct: 497 ASSTFLKSKKKASEKQYIE 515

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  311 bits (796), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 193/518 (37%), Positives = 294/518 (56%), Gaps = 32/518 (6%)

Query: 17  ISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYL---FVISSMLSXXXXXXX--XXXX 71
           +S K +++HE+ D LL     LQN     ++W   L   F I  + S             
Sbjct: 1   MSSKKLNSHEEQDSLL-----LQN----SREWTSLLKEGFAIMVLCSAQLMTQAGLAQSI 51

Query: 72  XPLFDLLSEDLKAK-ASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIW 130
            PL  ++ +    K   Q +W  ++F L  G+FIL++G++GD +G KK  + G+    +W
Sbjct: 52  VPL-QIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALW 110

Query: 131 SLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACA 190
           S++ G S Y++ + FF   R+FQG+G AF LPN   I+   Y+P  K +NM+FS+ GACA
Sbjct: 111 SILAGFSVYSNQI-FFDCCRAFQGIGPAFTLPNAIAIIARTYRPGRK-QNMIFSLFGACA 168

Query: 191 PIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHK-----FK 245
           P G  +G +FS L+ +E   W W ++   I   L G+  + VIP + P +  +      +
Sbjct: 169 PSGFVVGAVFSSLL-SEFAWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVER 227

Query: 246 MDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLL 305
           +D  GS  GV GLI+FNF WNQ P  GW+++Y                  E+R AK PLL
Sbjct: 228 IDVAGSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLL 286

Query: 306 PRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIA 365
           P   L +   + ++  +  GW SFGIW YY    + NLR   PL +   +   AI G  A
Sbjct: 287 PVRKL-SSDTIFVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCA 345

Query: 366 AFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFP 425
           A      + +T P+ +++ ++IAF VG I+++  PV QTY+  +  +++++ +GMD+SFP
Sbjct: 346 AMSTEFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFP 405

Query: 426 ASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALY 485
           A++IILS  +P+ +QG+A SLVNT+INYS+S+ LG +GT E Q++    DLLKGYR A Y
Sbjct: 406 AATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYY 465

Query: 486 VGIGLASVGIFVSGAYAIEDWWTRRRERSVRIKLDEKH 523
           +GIGLA +G+ V+ +YAI  +   R +RS    L EK+
Sbjct: 466 MGIGLAGLGLGVAISYAIFHY--SRLKRS----LSEKY 497

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  307 bits (786), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 174/503 (34%), Positives = 290/503 (57%), Gaps = 12/503 (2%)

Query: 1   MNSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLS 60
           MN ++    +    S+ + + +  +++S      R        F    KEY FV + +++
Sbjct: 1   MNKKHDKEDQYVFFSECTERSISCNQESSKEAYDRCSWLKSSNFHFLCKEYAFVFTGVMA 60

Query: 61  XXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTL 120
                       PL ++LS+    K     +L+ S+P+V GSF+L+ G++G+++G K+TL
Sbjct: 61  QAFNQAGGTMILPLVNVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGYKETL 115

Query: 121 LGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKA-- 178
           LGGY ++++ SL+ GLS Y+ +  F+++ R+FQG+G+A +LPN +      Y+   KA  
Sbjct: 116 LGGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQAKAHR 175

Query: 179 KNMVFSMIGACAPIGATLGCLFSGLIGTESEA-WAWTFYAYTIVAALNGLIAWYVIPDNI 237
           K ++ ++IG  A  GA LG   SG+  T SE+ W+W +Y YTI A L   +++Y +PDNI
Sbjct: 176 KTILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSVPDNI 235

Query: 238 PTNVHKFKMDWLGSFLG-VCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXE 296
            T  +K  ++ LG F    CGL+M N   N A     + ++                  E
Sbjct: 236 -TKKNKPCLNGLGWFSNRSCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLLLLFLVFE 294

Query: 297 ARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYF 356
            +F+++P+  + +  N  + ++LAS+F GWG++GIW+ Y+  F+LNLR+Y+PL AG +Y 
Sbjct: 295 LKFSEDPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPLAAGSTYL 354

Query: 357 MFAIFGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVIL 416
              I G +A   +   + +TGP + LL S + F    I+LSVTP+ Q+YFR +LG+M+ L
Sbjct: 355 TLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRSTLGSMIFL 414

Query: 417 SFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDL 476
           + G+D SFP+S+IIL ++LPS+Y  M   L N + NY++S   G+  +A R ++    +L
Sbjct: 415 ALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSLSS--IEL 472

Query: 477 LKGYRAALYVGIGLASVGIFVSG 499
           +K YR   Y  IGL+++G+F +G
Sbjct: 473 IKYYRYVYYFAIGLSAIGLFAAG 495

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  297 bits (761), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 163/434 (37%), Positives = 252/434 (58%), Gaps = 10/434 (2%)

Query: 88  QQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFI 147
           Q +W  A++ L  G+FIL++G++GD+YG KK  + G+    +WSL+ G S Y++ + FF 
Sbjct: 84  QLSWFAAAYSLTVGTFILIAGRLGDVYGHKKFFIIGFFWYALWSLLAGFSVYSNQI-FFD 142

Query: 148 VARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTE 207
             R+FQG+G A +LPN   I+G  Y P  + K M+ S+ GA AP G  LG +FS + G +
Sbjct: 143 CCRAFQGIGPALLLPNAIAILGRTYVPGRR-KAMILSLFGATAPAGFVLGAVFSSIFG-Q 200

Query: 208 SEAWAWTFYAYTIVAALNGLIAWYVIP----DNIPTNVHKF-KMDWLGSFLGVCGLIMFN 262
              W W ++A  IV     +    VIP      + T+V  + ++D  GS  GV GL++ N
Sbjct: 201 LTWWPWAYWAMGIVCFFLAVAGILVIPRMPLPELDTSVSTYQRLDIPGSVTGVIGLVLLN 260

Query: 263 FVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILASL 322
           F WNQ P  GW + Y                  E+R A  PLLP + L +     +L  +
Sbjct: 261 FAWNQGPVVGWQTPYTYSLLIVSAVFLCVFAFIESR-APHPLLPLSAL-SSDAAFVLGCV 318

Query: 323 FLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAIIL 382
             GW SFGIW YY+  F+  LR ++PL     +   AI G  AA   G  I +   ++++
Sbjct: 319 GAGWSSFGIWIYYFWLFLEELRGHSPLLTSAQFAPVAISGLCAALTTGFVITRVRASLVM 378

Query: 383 LASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGM 442
           L ++ AF VG I+++  PV Q Y+  +  +++++ +GMD+SFPA++I+LSD +P ++QG+
Sbjct: 379 LFAMTAFTVGGILIATAPVKQVYWAQAFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGL 438

Query: 443 AGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAYA 502
           A SLVN ++NYS+S+ LG++GT E +VN  G +LLKGYR A Y+GIGL+  GI ++  Y 
Sbjct: 439 AASLVNVVVNYSISIGLGLAGTVEGRVNNGGANLLKGYRGAWYMGIGLSGFGILIAFMYE 498

Query: 503 IEDWWTRRRERSVR 516
              +   ++  S +
Sbjct: 499 YHTFKKSKKMPSEK 512

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  295 bits (756), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 174/505 (34%), Positives = 278/505 (55%), Gaps = 19/505 (3%)

Query: 24  NHEDSDMLLASRSRLQNPDYFDKQWKEYLFV-ISSMLSXXXXXXXXXXXXPLFDLLSEDL 82
            +E+ + L   +S ++ P    +   E LFV I S               P+  + +   
Sbjct: 16  KNEEGESLQLVQSHVEKPQSLMR---EALFVGILSCAQLMTQAGLAQSIAPVRIIGNSFG 72

Query: 83  KAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHN 142
            +   Q +W  A++ L  G+FIL++G++GD++G KK  + G+    +WSL+ G S Y++ 
Sbjct: 73  ISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWSLLAGFSVYSNQ 132

Query: 143 VDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSG 202
           + FF   R+ QG+G AF+LPN   I+G  Y P  K K MVFS+ GA AP G  LG +FS 
Sbjct: 133 I-FFDCCRALQGIGPAFLLPNSIAILGRTYTPG-KRKQMVFSIFGATAPGGFVLGSVFSS 190

Query: 203 LIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKF-----KMDWLGSFLGVCG 257
           +  ++   W W ++A      + G+    VIP   P  +        ++D  G+  G+ G
Sbjct: 191 IF-SQLAWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILERIDAAGATTGILG 249

Query: 258 LIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMM 317
           L + NF WNQ P  GW + Y                  E+R A+ PLLP A L +  L  
Sbjct: 250 LALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESR-ARFPLLPFAAL-STDLAY 307

Query: 318 ILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTG 377
           +L  +  GW SFGIW +Y+  F+ + R  +PL     +   AI G  AA   G+ +    
Sbjct: 308 VLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCAALTTGYILSHVP 367

Query: 378 PAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPS 437
              ++L ++IAF VG ++++  P++QTY+  +  +++I+ +GMD+SFPA++I++S+ +P 
Sbjct: 368 ACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFPAATIMISNAMPH 427

Query: 438 QYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFV 497
           ++QG+A SLVNT++NYS+SL LG +GT E +VN  G + L+GYR A Y+GIGL+ +G+ V
Sbjct: 428 EHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWYMGIGLSGLGVLV 487

Query: 498 SGAYAIEDWWTRRRERSVRIKLDEK 522
           +  YA   W T ++ +    +L EK
Sbjct: 488 AIVYA---WSTLKKFK--EEQLSEK 507

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  212 bits (539), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 144/471 (30%), Positives = 233/471 (49%), Gaps = 24/471 (5%)

Query: 73  PLFDLLSEDLK-AKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWS 131
           P  D++ E  K    S   W    +    GSF+L++GK+GD+ G K   L GYA + +WS
Sbjct: 101 PQMDVIVEWFKLTHPSDSGWCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGYAWLALWS 160

Query: 132 LICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAP 191
           L+ G S Y  +  FF   R+ QG+G AF   +   I+G  Y P  K KN +FS  GAC  
Sbjct: 161 LLTGFSRYCPSSHFFFFCRAAQGIGAAFTFTSALSILGKSYPP-CKRKNFIFSFFGACGS 219

Query: 192 IGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNI-----PTNVHKFKM 246
            G  LG +FS L  T+   W+W +++  I   +  +++ + IP ++      +NV  F  
Sbjct: 220 FGVVLGMVFSALF-TQLAHWSWAYWSMAIACVVIIILSIFFIPGDVVEKHETSNV--FYF 276

Query: 247 DWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLP 306
           D+LG+FL V GL++F+  WNQAPT G+   Y                  E +   +PLLP
Sbjct: 277 DYLGAFLFVTGLVLFSVAWNQAPTYGFGRTYVYVLLIVSVVILALAMYVETK-VDDPLLP 335

Query: 307 RAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAA 366
              +    L ++LA +F  + SF +W  Y   F L  +  T L A       A+ G  AA
Sbjct: 336 WTHISANTLKVLLA-IFFAYASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGVFAA 394

Query: 367 FLVGHTIH-KTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFP 425
                 ++      I +L S++AF V  I+++     QTY+     T +++SFG+D+SFP
Sbjct: 395 LFSALLLNIHVQVQIRMLISLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLDISFP 454

Query: 426 ASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKD-----GTDLLKGY 480
           +++++LS+++P +++G+  SLV  ++NY+ +L    + +  R    D     G    K  
Sbjct: 455 SATLLLSNRIPDKFKGLGASLVGAVLNYATALGPPTAASVLRYQCPDCMAHKGNAFTKTI 514

Query: 481 RAALYVGIGLASVGIFVSGAYAIEDWWT------RRRERSVRIKLDEKHQE 525
               YVGIG A +G  V+    I ++          R+ S+ +  + + Q+
Sbjct: 515 NIIGYVGIGTAGLGTLVAIFGVITEYPKVAGKKGEDRKHSLTLTTNVRSQQ 565

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  193 bits (490), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 130/433 (30%), Positives = 223/433 (51%), Gaps = 18/433 (4%)

Query: 103 FILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAH-NVDFFIVARSFQGLGIAFVL 161
           F++++GK+GDI G K   + GYA + +WSL+ G S YA  N  FF   R  QG+G AF+ 
Sbjct: 104 FVIIAGKLGDINGHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLT 163

Query: 162 PNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIV 221
           P    ++G  Y P  K KN VFS  GAC P G   G +FS L  T+   WAWT+++  + 
Sbjct: 164 PTGLALLGKHYPP-CKRKNYVFSFYGACGPFGIVAGSVFSALF-TQLTTWAWTYWSMAVT 221

Query: 222 AALNGLIAWYVIP-DNIPTNVHK--FKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYX 278
             +  ++++  IP DN P       +  D++G F G+ G+I+F+ VWNQAP   + + Y 
Sbjct: 222 CLIITILSYIFIPKDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPYV 281

Query: 279 XXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMA 338
                            ++R  K+PL+P   + +  +  ++  +F G+  F IW +Y   
Sbjct: 282 YSLLIVSVVFMTMALIIDSR-VKDPLIPWKSMCSNVIKALIV-VFFGFLGFTIWLFYSWR 339

Query: 339 FVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAII-LLASVIAFDVGCIMLS 397
           F L  ++ + L A   +    I G  AA      ++K  P  + LL +V AF +  I++S
Sbjct: 340 FYLVAKNDSLLLAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILIS 399

Query: 398 VTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSL 457
              + +TY+  +    VI++ G+D++FP+++++LS+ + ++ QG+A +L  T +NY  +L
Sbjct: 400 TMTLQETYWGNAFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTAL 459

Query: 458 CLGVSG-----TAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGAYAIEDWWTRR-- 510
             GV+        +  + +     +     A YV IG A + + V+   +I +++  R  
Sbjct: 460 GPGVATLIITYQCDDCLARSDGRFVHAVHIAGYVAIGTAGIAVVVAIFGSITEYYKERMD 519

Query: 511 --RERSVRIKLDE 521
             RE+   I  ++
Sbjct: 520 DLREKKRPISSEQ 532

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  174 bits (440), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 151/545 (27%), Positives = 250/545 (45%), Gaps = 36/545 (6%)

Query: 2   NSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSX 61
           NS  + +  QRT    S       +D       +    NP     + +E +F++    S 
Sbjct: 30  NSTASSLHSQRTKEQCSNLQPAQAQD-------QLESMNPPPGPSRLRECMFIVIIASSQ 82

Query: 62  XXXXXXXXXXXPLFDLLSE--DLKAKASQQA-WLMASFPLVSGSFILVSGKVGDIYGLKK 118
                         D ++    L A  S +A W  A+F +  G+FI+ +GK+ D+ G K 
Sbjct: 83  FISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAFAITCGTFIIPAGKLCDLIGSKT 142

Query: 119 TLLGGYAVVVIWSLICGLSSYAH--NVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNT 176
             + GYA   +WSL+ G+S YA      FF   R  QG+G A + P+   ++G  Y P+ 
Sbjct: 143 VFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGIGAAALFPSSLALLGKYYPPSC 202

Query: 177 KAKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIA-WYVIPD 235
           K KN+VFS+ G C P+G  +G +FS +  T+   W+W +++  IV+A   LI+ +Y+ PD
Sbjct: 203 K-KNIVFSLYGFCVPLGVVVGGVFSAIF-TQLAHWSWNYWSMAIVSAFFTLISCFYIPPD 260

Query: 236 NIPTN---------VHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXX 286
            I  +          H  K D+LG+FL V  L++F   WNQA    + S           
Sbjct: 261 EIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLFAVCWNQATGFKFKSVQVYVTLIVSL 320

Query: 287 XXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHY 346
                    E  +  +P++P   +  + +  +L  +F  + SF IW +Y   +   +R+ 
Sbjct: 321 VCFVAMVIVE-FYVDDPIIPARKIHPQTIKALLV-VFFSYLSFTIWLFYLWKYFTVVRND 378

Query: 347 TPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAII-LLASVIAFDVGCIMLSVTPVDQTY 405
           T L     +   +I G IAA      I    P  I LLA   +F +  I+       ++Y
Sbjct: 379 TVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQIRLLAGACSFLLAHILFITLSRTESY 438

Query: 406 FRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGT- 464
           +     T++I+S G+D+SFP+++++LS+ +P + +G++ +LV T +NY   +   ++ T 
Sbjct: 439 WARPFLTIIIISIGLDISFPSATLLLSNGVPQELRGISAALVGTALNYGTGIGPPIAQTI 498

Query: 465 AERQVNK-----DGTDLLKGYRAALYVGIGLASVGIFVS--GAYAIEDWWTRR-RERSVR 516
              Q +K     D    +K    A  VGIG + + + V   G      W T    +R V 
Sbjct: 499 IGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIAVVVGLYGTVTEYSWETHSYSKRCVE 558

Query: 517 IKLDE 521
              DE
Sbjct: 559 PYDDE 563

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  155 bits (391), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 113/199 (56%), Gaps = 35/199 (17%)

Query: 58  MLSXXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLK 117
           M+S            PL ++LS   ++  ++Q  L+AS PLVSGSFILVSGKVGDIYGLK
Sbjct: 1   MMSQLLNQVGTTQTLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLK 60

Query: 118 KTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTK 177
            TLL GYA V++WS ICGL+ YA +V FF++AR+FQGLG+AFVLPNV G V N+Y   + 
Sbjct: 61  NTLLFGYATVIVWSFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSI 120

Query: 178 AKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNI 237
            KNMV                                 YAYT+  +LN  +  + +P NI
Sbjct: 121 RKNMV---------------------------------YAYTVAVSLNMALCVWALPWNI 147

Query: 238 PTNVHKFKMDWLGSFLGVC 256
           PTNV    M  LG  + +C
Sbjct: 148 PTNVRGQAM--LGYSMPMC 164

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 6/44 (13%)

Query: 434 QLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLL 477
            +P+  +G A      M+ YSM +CLG++GT E +V+K G D L
Sbjct: 146 NIPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  160 bits (406), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 134/488 (27%), Positives = 227/488 (46%), Gaps = 29/488 (5%)

Query: 46  KQW-KEYLFVISSMLSXXXXXXXXXXXXPLFDLLSEDLK---AKASQQAWLMASFPLVSG 101
           K W +E   VI  + S            P+   L E  +   AK     W  AS+ L S 
Sbjct: 33  KTWIREIFLVIILISSQLVTLIGAVQGVPIAAYLRERYRIEPAKGGLVGWANASYMLGSA 92

Query: 102 SFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAH-NVDFFIVARSFQGLGIAFV 160
             +L++GK+GD+ G K+ ++ G+  + IWSLI G S Y   N  F+  AR+ QG+G  F+
Sbjct: 93  VMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTARALQGIGSGFI 152

Query: 161 LPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTI 220
           +PN   I+G  Y      K ++FS+ G     G  +G  FS L    ++ WAW ++A   
Sbjct: 153 VPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLTK-WAWNYWALAC 211

Query: 221 VAALNGLIA-WYVIPDNIPTNVHK-------FKMDWLGSFLGVCGLIMFNFVWNQAPTDG 272
           V  L  + A  ++ PDNI   VHK        + D+LG+  GV GL++F+  + QA   G
Sbjct: 212 VCVLYTVGAILFIPPDNI---VHKPNSKPLYKRFDYLGAITGVSGLVLFDVAFTQASALG 268

Query: 273 WDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIW 332
           W   +                  + R   +PL+P   L    +++IL  ++ G+ SF IW
Sbjct: 269 WSPPHTYITLIIGVILILIAMFVDWR-VDDPLVPLQHL-RADVVVILICVYFGFLSFVIW 326

Query: 333 TYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHT---IHKTGPAIILLASVIAF 389
             ++  F   + + +PL         AI G+I A +   T   ++   P +++++ V   
Sbjct: 327 ANWFWQFYELVHNDSPLRIAAKLVPLAI-GSIPAAIFTVTCLQLNIKAPTMMVISMVCFL 385

Query: 390 DVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNT 449
               +M +VTP + TY+     + +I  F +D++ P ++++ SD +  + QG+A SL+ T
Sbjct: 386 VPNILMATVTP-NTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKESQGIAASLIIT 444

Query: 450 MINYSMSLCLGVSGTAERQVNKDGTDLLKG-----YRAALYVGIGLASVGIFVSGAYAIE 504
           +I+Y++S+    +      V   G D   G       +    GI L+ +G+  +    + 
Sbjct: 445 VISYAISIGPSYTAMVMWYVAPLGNDSTPGGFTHSLHSNFICGIVLSGIGLVTAVIAGLI 504

Query: 505 DWWTRRRE 512
           D+   R  
Sbjct: 505 DYKITRTH 512

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 113/474 (23%), Positives = 217/474 (45%), Gaps = 67/474 (14%)

Query: 88  QQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYA-HNVDFF 146
           Q  W+ ASF +  G+FI+++GK+ DI   +   + GY    +W+LI G +SY   N+ F 
Sbjct: 112 QLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKNMIFL 171

Query: 147 IVARSFQGLGIAFVLPNVTGIVGNIY--------------------KPN----------- 175
            + R  QG+G A + P+   ++   Y                     P+           
Sbjct: 172 YICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNLSSDD 231

Query: 176 ---------------TKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTI 220
                            +K++ FS+ GACAP+G  +G +FS  I T+   W W +++ +I
Sbjct: 232 DNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSA-IFTQLATWPWNYWSMSI 290

Query: 221 VAALNGLIAWY--VIP------DNIPTNVHKFK-MDWLGSFLGVCGLIMFNFVWNQAPTD 271
           V  L  +++++  V+P      D+ P ++  +K  D+LG  LG+  LI+F   W+QA   
Sbjct: 291 VTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWDQATMY 350

Query: 272 GWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGI 331
            + + +                  E  F   P++P   +    +  +L  +F  + SF  
Sbjct: 351 KFKTIHVYLTLLFSLVSFIAMIIWEYYF-NNPIIPIRQIHPGTIKALLV-VFFSYISFTQ 408

Query: 332 WTYYYMAFVLNLRHYTPLWAGGSYFMFAIFGTIAA-FLVGHTIHKTGPAIILLASVIAFD 390
           W +Y       ++  +P+     +   ++ G I+A F +   + +    I LLA   +F 
Sbjct: 409 WLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLLAGASSFL 468

Query: 391 VGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTM 450
           +  I+L    +D +Y+     +++ +S G+D+SFP+++++L++ +P + QG+  +LV ++
Sbjct: 469 LSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGICAALVGSV 528

Query: 451 INYSMSLCLGVSGT-AERQVN------KDGTDLLKGYRAALYVGIGLASVGIFV 497
           +NY  ++   ++ T  + Q         D    LKG   A  VG+G + + + +
Sbjct: 529 LNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGVGCSGIAVLI 582

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 99/498 (19%), Positives = 182/498 (36%), Gaps = 59/498 (11%)

Query: 74  LFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLI 133
           L D L++      +  +W + S+ +    FI   G++GDI G         +   I SL+
Sbjct: 51  LIDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLL 110

Query: 134 CGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMI--GACAP 191
           C +     N   F V R+ QG+  A ++P    ++  I  P  K +   FS++  G  + 
Sbjct: 111 CAV---MPNFPAFAVFRAIQGICAAGLVPCAYALI-PILAPKEKVQKY-FSIVSCGFSST 165

Query: 192 IGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVI---------PDNIPTNVH 242
           IG  LG +  G        +   FY    V +L  +IA++           P  I     
Sbjct: 166 IG--LGLIIGGAFAATKIGYRGIFYLTFAVMSLISVIAFFFTYNVENFDKKPQKIQAQTS 223

Query: 243 KFKMDWLGSFLGVCGLIMF-------NFVWNQAPTD--------------GWDSAYXXXX 281
              +D++GS + V G I+           WN+  T                W+  Y    
Sbjct: 224 VKSLDFIGSLIFVAGSILIVVGLTEGGESWNRPVTYVTLIIGILLFFGFFVWNCTYAKIV 283

Query: 282 XXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVL 341
                         E     + L+P  VLF +  + I+ +  L         Y    +  
Sbjct: 284 RGIRFVGIDTSKYFEKV---QLLIPVDVLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQ 340

Query: 342 NLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAI-ILLASVIAFDVGCIMLSVTP 400
                +PL AG       I   +   L      K  P + + L   +A     I++ +  
Sbjct: 341 YAEKDSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGVALGFSLALAGSIILIQLHL 400

Query: 401 V-DQTYFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCL 459
           + D  ++++   +  ++ FG+ + +P +  I     P Q +G+A  +  T     + +  
Sbjct: 401 IKDNVFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITF 460

Query: 460 GVSGTAERQVN--KDGTDLLKGYRAAL----YVGIGLASVGIFVSGAYAIEDWWTRRRER 513
            V  +    +N  K   D ++ +R       Y  + + ++G  V+ A  I D  T   + 
Sbjct: 461 SVMASVLGDINEMKGKEDAIQNFRTGFQNCSYFTVAVGALGFLVT-AICIRDIHTPNDDI 519

Query: 514 S--------VRIKLDEKH 523
           S         +I++D++ 
Sbjct: 520 SDLESSIHRTKIEMDQEK 537

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 95/474 (20%), Positives = 173/474 (36%), Gaps = 55/474 (11%)

Query: 74  LFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLI 133
           L D L++      +  +W + S+ +    FI   G++GDI G         +   + SL+
Sbjct: 51  LIDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVLSLL 110

Query: 134 CGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMI--GACAP 191
           C +     N   F V R+ QG+  A ++P    ++  I  P  K +   FS++  G  + 
Sbjct: 111 CAV---MPNFPAFAVFRAIQGICAAGLVPCAYALI-PILAPKEKVQKY-FSIVSCGFSST 165

Query: 192 IGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVI-----------PDNIPTN 240
           IG  LG +  G   T    +   FY    V  L  +IA++              D   T+
Sbjct: 166 IG--LGLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKLNKKPQKDQASTS 223

Query: 241 VHKFKMDWLGSFLGVCGLIMF-------NFVWNQAPTD--------------GWDSAYXX 279
           V    +D++GS + V G I+           WN+  T                W+  Y  
Sbjct: 224 VK--SLDFIGSLIFVAGSILIVVGLTEGGESWNRPVTYVTLVIGIILFFGFFVWNCTYTK 281

Query: 280 XXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAF 339
                           E     + L+P  VLF +  + I+ +  L         Y    +
Sbjct: 282 IVRGFKYCGIDTSKYFEKV---QLLIPIDVLFMKNFIPIVLAFALNNACLFSCLYIIDQY 338

Query: 340 VLNLRHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAI-ILLASVIAFDVGCIMLSV 398
                  +PL AG       I   I   L      K  P + + +   +A     I++ +
Sbjct: 339 SQYAERNSPLLAGVKLVPLIICMVIGNALCAFESTKLRPRVGVAIGFFLALAGSIILIQL 398

Query: 399 TPVDQTYF-RMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSL 457
             V +  F ++      ++ FG+ + +P +  I     P + +G+A  +  T     + +
Sbjct: 399 HLVKEDLFWKIFFSAQALVGFGVAIFYPYALQIAVGGAPDESRGIASGVAQTFGQLGIEI 458

Query: 458 CLGVSGTAERQVN--KDGTDLLKGYRAAL----YVGIGLASVGIFVSGAYAIED 505
              V  +    +N  K  ++ ++ +R       Y  + + ++G  V+ A  I D
Sbjct: 459 TFSVMASVLGNINEMKGKSNAIQKFRTGFQNCSYFTVAVGALGFLVT-AICIRD 511

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 86/185 (46%), Gaps = 18/185 (9%)

Query: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVV-IWSLICGLSSYAHNVDF 145
           +Q  W + S+ +    FI   G+VGDI G    ++  ++V+  I+SL+C +     N   
Sbjct: 58  TQSGWALTSYVITFAGFIAFFGRVGDIVG-NGIMMCVFSVIFGIFSLLCAV---VPNFIA 113

Query: 146 FIVARSFQGLGIAFVLPNVTGIVGNIYK-PNTKAKNMVFSMIGACAPIGATLGCLFSGLI 204
           F V R+FQG+  A ++P    +V  +++ PN +     FS++ +     A +G +  G  
Sbjct: 114 FTVFRAFQGMAGAGIVPCAYALVNKMFQGPNLQRY---FSILSSVISAMAGVGFIIGGAF 170

Query: 205 GTESEAWAWTFY-----AYTIVAALNGLIAWYVIPDNIPTNVHKF----KMDWLGSFLGV 255
           G  +  +   FY     +    A +  LI +  +  N  +   KF    K+D +G  L +
Sbjct: 171 GETALGYKSFFYFLFAASLATAAVICVLIGYPELLLNRHSYKEKFQRVYKLDVIGCLLFI 230

Query: 256 CGLIM 260
            G I+
Sbjct: 231 SGSIL 235

>Kwal_26.6697 s26 complement(26786..28519) [1734 bp, 577 aa] {ON}
           YBR293W - Hypothetical ORF [contig 381] FULL
          Length = 577

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 93/434 (21%), Positives = 178/434 (41%), Gaps = 60/434 (13%)

Query: 80  EDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSY 139
           ED+K      +W+  ++ +   SF  + G   D  G ++ L     +  +  L CGL+S 
Sbjct: 78  EDVKV----SSWITTAYLVTCTSFQPLYGSFSDTLGRRRCLFFANTIFALGCLGCGLTST 133

Query: 140 AHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFS--MIGACAPIGATLG 197
            +++   I+ R+  G+G   ++   T +  +I     +     F   ++G  A +GA+ G
Sbjct: 134 IYSL---IIMRAVTGIGGGGLITLSTIVNSDIIPAKKRGMYQSFQNILVGTGAVVGASCG 190

Query: 198 CLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDN-----------IPTNVHKFK- 245
               G I + S  W W F     ++    ++A+  + D            +P+NV K K 
Sbjct: 191 ----GEIAS-SMGWRWCFLLQVPISIGGAVMAYLFVQDQDVVDKNPRSGALPSNVSKIKK 245

Query: 246 MDWLGSFLGVCGLI--MFNFVWNQAPTDG---WDSAYXXXXXXXXXXXXXXXXXXEARFA 300
           +D+LG+FL + GL+  +     N +  +G   W S                    E    
Sbjct: 246 IDFLGAFLLISGLVSQLIFLTINSSAQEGKSTWLSGRSLALGLVTAVSLILFAYVEKTTT 305

Query: 301 KEPLLPRAVLFN-RKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFA 359
             P++P  +L       +++  + +G+ S+        A++  L  Y  +  G +     
Sbjct: 306 ANPIIPHDLLGQWYSTTVLIVGVLVGFVSY--------AYIFTLPLYFQVVVGDTAAEAG 357

Query: 360 IFGTIAAFL--VGHTIH-------KTGPAIILLA-SVIAFDVGCIMLSVTPVDQTYFRMS 409
           +  T+ +F   +G  I        K  P ++++  S++ F   C +L + P    Y+  S
Sbjct: 358 LRLTVPSFCTPIGGVIMGISMKDPKRLPGLLIVGISLMLFGNLCFLL-IKPTTP-YWLTS 415

Query: 410 LGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCL-GVSGTA--- 465
           L  +V  + G  ++FP++        P   Q  A +   T+  +    C+ GV+GT+   
Sbjct: 416 L-LLVPANIGQGITFPSTLFSFLFAFPPYKQATATA---TLYLFRSVGCVWGVAGTSSLI 471

Query: 466 ERQVNKDGTDLLKG 479
           +  V K  T  L+G
Sbjct: 472 QSVVRKQATKRLQG 485

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 89/386 (23%), Positives = 151/386 (39%), Gaps = 53/386 (13%)

Query: 90  AWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVA 149
           +W+  ++ L S +F  + GK+ DI+G +  L+    V  + +LICG+S    N+   ++ 
Sbjct: 178 SWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGALICGMSK---NLWVLVLG 234

Query: 150 RSFQGLGIAFVLPNVTGIVGNIYKPNTKA-----KNMVFSMIGACAPIGATLGCLFSGLI 204
           R   G+G   +    +    +I    ++A      N+ F +  AC       G L  GL 
Sbjct: 235 RFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFGLGTAC-------GGLVGGLF 287

Query: 205 GTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVH------------KFKM-DWLGS 251
              +  W   F     +  L+       +    P + H            K +M DW G+
Sbjct: 288 ADRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPKPVDAHKGAGQRSIPWTTKLRMVDWTGT 347

Query: 252 FLGVCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLF 311
              V  L  F  V +     G D  +                  E   A +P+LP   L 
Sbjct: 348 VTLVVFLFCFTLVCS---LYGEDLPHLYLIFVVILLSGSYFIYHELYVATDPILPIRFLE 404

Query: 312 NRKLMMILAS---LFLGWGSFGIWTYYYMAFVLNL------RHYTPLWAGGSYFMFAIFG 362
           NR ++    S     +G  + G +   Y A VLN+      +   P     S+F  A FG
Sbjct: 405 NRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNMGPTDIGKRIVP-----SFFSTA-FG 458

Query: 363 TIAAFLVGHTIHKTGPAI-ILLASVIAFDVGCIMLS-VTPVDQTYFRMSLGTMVILSFGM 420
           ++ A   G+ + +TG     LLA  +   +G + +S VTP   T+ +  L   +I  FG 
Sbjct: 459 SLGA---GYYMKRTGKYYWFLLAFCLVGVLGQVQISYVTPSISTWRQYCL--YMIPGFGS 513

Query: 421 DLSFPASSIILSDQLPSQYQGMAGSL 446
            +    + + L   +P ++Q    S+
Sbjct: 514 AVLLTVTLLALIVAVPQRHQAATTSI 539

>ZYRO0F14652g Chr6 complement(1207106..1208806) [1701 bp, 566 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 566

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 53/115 (46%), Gaps = 2/115 (1%)

Query: 137 SSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATL 196
           +S   N+    V R FQ  G +  +   TG V +I  P  + K + + M+G    +G  L
Sbjct: 183 ASVPANIGALYVLRVFQAFGSSSAISLGTGTVTDITPPKHRGKAIGYFMMGPN--MGPIL 240

Query: 197 GCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGS 251
             + SGLI  ES+AW W F   +I++ +  +    ++P+ +   V      W  S
Sbjct: 241 APIISGLILMESDAWRWLFGFTSIMSGIAFIAVVLILPETLRCIVGNGDQRWKKS 295

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 57/123 (46%), Gaps = 8/123 (6%)

Query: 121 LGGYAVVVIWSLICGL------SSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKP 174
            GG   + I+SL+  L      ++   ++    + R FQ +G + V+P   G V ++  P
Sbjct: 173 FGGRKFLYIFSLMIALIANVLLAAVPKHLAALYILRVFQAIGTSAVIPLGVGTVSDLISP 232

Query: 175 NTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIP 234
             +AK + + M+G    +G  LG +F GLI      W W F   +I   +  ++    +P
Sbjct: 233 MNRAKGVSYFMLG--PNMGPILGPIFGGLILMNGNQWRWLFGFTSITTGVGLILIVTFLP 290

Query: 235 DNI 237
           + +
Sbjct: 291 ETL 293

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 63/254 (24%), Positives = 109/254 (42%), Gaps = 30/254 (11%)

Query: 26  EDSDMLLASRSRLQNPDYFDKQWKEY-------LFVISSMLSXXXXXXXXXXXXPLFDLL 78
           ++S  LL      Q+ D  D+++ +Y         ++S  L              + + +
Sbjct: 5   DESTRLLPDE---QHCDALDEEYTKYNLSLPKFPILVSLWLGSFLSSIDSTIVANIMNKV 61

Query: 79  SEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSS 138
           +E+ +    +Q W+  SF L + +F  + GK+ DI G K  LL   +    + L C L+S
Sbjct: 62  AEEFQESQEKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFALLTALS---FFGLGCFLTS 117

Query: 139 YAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKA-----KNMVFSMIGACAPIG 193
            + N+  F +AR+  G+G   +    +  VG+I     +       N+VF   G    +G
Sbjct: 118 LSTNIKQFAIARAICGIGGGGINAISSITVGDICTAKDRGIYQGYANIVF---GMGQLLG 174

Query: 194 ATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFK------MD 247
           A +G LF   IG    A  W      I+A + G +   +   ++P    +FK      +D
Sbjct: 175 APVGGLFIATIGW--RALFWIQVPLVIIAIILGEMYVNIKLVHVPPPSERFKWKNISRID 232

Query: 248 WLGSFLGVCGLIMF 261
           +LGSF  V  +  F
Sbjct: 233 FLGSFTLVSSITCF 246

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 88/463 (19%), Positives = 164/463 (35%), Gaps = 46/463 (9%)

Query: 74  LFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLI 133
           L D L++      +  +W + S+ +    FI   G++GDI G             I SL+
Sbjct: 51  LIDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLL 110

Query: 134 CGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIG 193
           C +     N   F V R+ QG+  A ++P    ++  +       K       G  + IG
Sbjct: 111 CAV---MPNFPAFAVFRAIQGISAAGLVPCAYALIPMLAPEEEVQKYFSIVSCGFSSTIG 167

Query: 194 ATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVI--------PDNIPTNVHKFK 245
             LG +  G        +   FY    V  L  ++A++          P       ++ +
Sbjct: 168 --LGLIIGGAFAATKIGYKGIFYLTFAVMFLISIVAFFFTYGVENLSEPPRKDQATNRVR 225

Query: 246 -MDWLGSFLGVCGLIMF-------NFVWNQAPT--------------DGWDSAYXXXXXX 283
            +D++GS + V G I+           WN+  T                W+ +Y      
Sbjct: 226 SLDFIGSLIFVTGSILIVVGLTEGGESWNRPATYVTLVIGIILFFGFFFWNCSYARIVRG 285

Query: 284 XXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNL 343
                       E     + L+P  VLF +  + I+ +  L         Y    +    
Sbjct: 286 IRCCGIDTSRYFE---KVQLLIPVDVLFMKNFIPIVLAFALNNACLFSCIYIIDQYSQYE 342

Query: 344 RHYTPLWAGGSYFMFAIFGTIAAFLVGHTIHKTGPAI-ILLASVIAFDVGCIMLSVTPVD 402
              +PL+AG       I   I   L      K  P + ++L   +A     I+  +  + 
Sbjct: 343 EKNSPLYAGVKLVPLIICMVIGNGLCAFESTKLKPKVGVVLGFSLALAGSIILTQLHLIK 402

Query: 403 QTYF-RMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTM----INYSMSL 457
           +  F ++   +  ++ FG+ + +P +  I     P + +G+A  +  T     I  + S+
Sbjct: 403 EDMFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSV 462

Query: 458 CLGVSGTAERQVNKDGTD--LLKGYRAALYVGIGLASVGIFVS 498
              V G  +    K G       G++   Y  + + ++G  V+
Sbjct: 463 MASVLGNIDGIRGKSGASQKFRTGFQNCTYFTVAVGALGFLVT 505

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 88/199 (44%), Gaps = 22/199 (11%)

Query: 22  VDNHEDSDMLLASRSRLQNPDY---FDKQWKEYLF-------VISSMLSXXXXXXXXXXX 71
           +D  +++  LL  RS +++ +     ++Q+ EY         ++S  L            
Sbjct: 1   MDPLDETSSLLPIRSSIEDGEEDNGLEEQYHEYNLSLPKFPILLSLWLGSFLSSLDSTIV 60

Query: 72  XPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWS 131
             + + ++E+ +    +Q W+  SF L + +F  + GK+ DI G K  +L  +     + 
Sbjct: 61  ANIMNKVAEEFEESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSH---FFFG 116

Query: 132 LICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKA-----KNMVFSMI 186
           L C L+ +A N+  F +AR+  G+G   V    +  V +I     +       N+VF   
Sbjct: 117 LGCFLTCFAQNITQFSIARAICGIGAGGVNAMSSITVSDICSTRERGIYQGYANIVF--- 173

Query: 187 GACAPIGATLGCLFSGLIG 205
           G    +GA LG LF   +G
Sbjct: 174 GLGQLLGAPLGGLFIDSVG 192

>Ecym_7399 Chr7 complement(820280..821971) [1692 bp, 563 aa] {ON}
           similar to Ashbya gossypii ABL040W
          Length = 563

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 88/199 (44%), Gaps = 23/199 (11%)

Query: 78  LSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLS 137
           ++E+ K     Q W+  SF L S  F  + GK+ D+ G +  L+  Y++ +   L C ++
Sbjct: 74  VTEEFKESHRIQ-WVATSFLLTSTVFQPIYGKLSDVTGRRFVLVLAYSLFL---LGCLVT 129

Query: 138 SYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLG 197
           +YA N+  F   R+  G+G   +       +G+++  + K +++  S       IG  LG
Sbjct: 130 AYARNIWEFAFGRAICGIGAGGIPTMCVITMGDMF--SVKEQSIYQSYAHIIYTIGEVLG 187

Query: 198 CLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDN-----IPTNVHKF------KM 246
               G I  E+  W   F A   V  L   I   +  D+     IP +  +       +M
Sbjct: 188 APIGG-IALETVGWRAIFLAQ--VPVLTICIYLTLCDDDLAQQHIPPHGERLTWKNISRM 244

Query: 247 DWLGSFL---GVCGLIMFN 262
           D  GS L    +CG+I+ +
Sbjct: 245 DLSGSILLIISLCGVILLS 263

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 69/143 (48%), Gaps = 7/143 (4%)

Query: 74  LFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLI 133
           L+D + ++    A+   WLMA + L +  F+L+ G++  + GLK +L+    +    SL+
Sbjct: 30  LYDTIGQEFNDYANV-GWLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGSLM 88

Query: 134 CGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIG 193
            G    A+++   I AR   G G + +   V G+  +I +   +A+  V +++G    + 
Sbjct: 89  AG---AANSMGMLIGARVISGFGGSGIESLVYGVGTSIVEEKHRAR--VITVLGIAYMLA 143

Query: 194 ATLGCLFSGLIGTESEAWAWTFY 216
              G    G +  E  +W W FY
Sbjct: 144 EGAGPFVGGGL-AEHVSWRWCFY 165

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 114/288 (39%), Gaps = 32/288 (11%)

Query: 85  KASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVD 144
           ++ ++ W+  SF L + +F  + G+  DI G K  LL   +  ++ +L   L+ +A NV 
Sbjct: 77  ESDKKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLLGTL---LTCFARNVT 133

Query: 145 FFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLI 204
            F +AR+  G+G   +    +  V +I    TK + M           G  LG    GLI
Sbjct: 134 EFAIARAICGMGGGGIGAMSSITVSDI--CTTKERGMYQGYANVIFGAGQVLGAPVGGLI 191

Query: 205 GTESEAWAWTFYAYTIVAALNGLIAWYVIP---DNIPTNVHKF------KMDWLGSFLGV 255
             E+  W   F A  +   +  ++A+  I     +IP    +F      ++D  GS +  
Sbjct: 192 -METFNWRIIFAAQVVAIMICMILAYRNINLKLLHIPPFHQRFTRKNLSRIDLFGSSMLS 250

Query: 256 CGLIMFNFVWNQAPTDG-WDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVL---F 311
           C L+ F  +++   +   W                      E   A E LLP  +L   F
Sbjct: 251 CSLVSFLMLFSSGVSRSLW--------FLLTLVSLTLFCINERYIATERLLPNGILRGHF 302

Query: 312 NRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFA 359
               ++I+ S F+ +        Y M   L L     +   G + +FA
Sbjct: 303 GLSALLIVVSSFMMFAEL-----YRMPVYLQLIQDISVSRSGIFLLFA 345

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 87/381 (22%), Positives = 155/381 (40%), Gaps = 48/381 (12%)

Query: 90  AWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVA 149
           +W+  S+ L S +   + GK+ D  G K  L+    V  I  LICG+S+   ++ + +V 
Sbjct: 120 SWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLICGMST---SIWWVVVG 176

Query: 150 RSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESE 209
           R   G+G   +    + ++ ++     +A        G C  I   LG    GL+G   +
Sbjct: 177 RFVSGIGGCGLTCLASMVISDLVPLRERAVYQ-----GLCNFIFG-LGTASGGLVGAAFQ 230

Query: 210 AW--AWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKF------KMDWLGSFLGVCGLIMF 261
            W  A+T      +A+   ++++  +P     +  +        +DW G    VC L +F
Sbjct: 231 DWRMAFTIQCPISLASCALIVSYLELPPRHEDDKDRHWTSKLRDLDWAGVVTLVCFLFLF 290

Query: 262 NFVWNQAPTD-GWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLMMILA 320
             V +    +  +DS                    E   A +P+LP A L  R    +L 
Sbjct: 291 MLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPVLPIAFLKYRS---VLG 347

Query: 321 SLFLGWGSF--GIWTYYYM----AFVLNLRHYTPLWAGG----SYFMFAIFGTIAAFLVG 370
           S    W +    + T YY+    A VLN++   P   G     S+F  A FG++ A   G
Sbjct: 348 SSLANWFAMMSMLTTNYYLPVYWASVLNMK---PTDIGKRSIPSFFSVA-FGSLGA---G 400

Query: 371 HTIHKTGPAIILLASVIAFDV-GCIMLSV----TPVDQTYFRMSLGTMVILSFGMDLSFP 425
             + +TG     L +     + G + +++    TPV Q Y       +V+ SFG+ +   
Sbjct: 401 IYMKRTGKYYWFLLAFCGIGILGQLKINLLTPATPVWQQYL-----LLVVPSFGLSVLIT 455

Query: 426 ASSIILSDQLPSQYQGMAGSL 446
            + + +   +P ++     S+
Sbjct: 456 VTLLAMISAVPHEHHAATTSI 476

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query: 84  AKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNV 143
           +++S++ W+  SF L + +F  + GK+ DI G K  LL  +     + + C L+ +A NV
Sbjct: 68  SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAH---FFFGIGCLLTCFARNV 124

Query: 144 DFFIVARSFQGLG 156
             F +AR+  G+G
Sbjct: 125 TEFSIARAICGIG 137

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 47/83 (56%), Gaps = 4/83 (4%)

Query: 74  LFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLI 133
           + + ++ED  +++S++ W+  SF L + +F  + GK+ DI G K  LL        + L 
Sbjct: 59  IMNRVAEDF-SESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALL---IAQFFFGLG 114

Query: 134 CGLSSYAHNVDFFIVARSFQGLG 156
           C L+ +A NV  F +AR+  G+G
Sbjct: 115 CLLTCFARNVTEFSIARAICGIG 137

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 60/127 (47%), Gaps = 11/127 (8%)

Query: 84  AKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNV 143
           A++ ++ W+  SF L + +F  + GK+ DI G K  +L  +     + L C L+ +A NV
Sbjct: 75  AESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAH---FFFGLGCLLTCFAQNV 131

Query: 144 DFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKA-----KNMVFSMIGACAPIGATLGC 198
             F +AR+  G+G   +    +    +I     +       N+VF   G    +GA LG 
Sbjct: 132 TQFSIARAICGMGAGGINAMSSITTSDICTTRERGIFQGYANIVF---GMGQVLGAPLGG 188

Query: 199 LFSGLIG 205
           LF   IG
Sbjct: 189 LFLDHIG 195

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 84  AKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNV 143
           +++S++ W+  SF L + +F  + GK+ DI G K  LL        + L C L+ +A NV
Sbjct: 68  SESSKKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAQ---FFFGLGCLLTCFARNV 124

Query: 144 DFFIVARSFQGLG 156
             F +AR+  G+G
Sbjct: 125 TEFSIARAICGIG 137

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 63/279 (22%), Positives = 111/279 (39%), Gaps = 36/279 (12%)

Query: 90  AWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVA 149
           +W+  ++ L S +F  + GK+ DI+G K  L+    V ++  L+CGL+     +   + A
Sbjct: 117 SWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGL---VGA 173

Query: 150 RSFQGLGIAFVLPNVTGIVGNIYKPNTKA-----KNMVFSMIGACAPIGATLGCLFSGLI 204
           R   G+G   V    +  + +I     +A      N  F +  AC   G  +G  FS   
Sbjct: 174 RFISGIGGGGVTSMCSITISDIVPLRDRALYQGMCNFFFGLGTAC---GGVVGGWFS--- 227

Query: 205 GTESEAWAWTFYAYTIVAALNGLI--AWYVIPD-----NIPTNVHK--FKMDWLGSFLGV 255
                 W   F     ++AL+ L+   +  +P      N P ++      +DW+G+   V
Sbjct: 228 -DHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKNKLLSVDWIGASALV 286

Query: 256 CGLIMFNFVWNQAPTD-GWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRK 314
             L +F    +    +  ++S                    E   AK+P+LP + L NR 
Sbjct: 287 VFLSLFLVTASLGGKEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRS 346

Query: 315 LMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGG 353
              +L S F  W        + M  ++   +Y P++  G
Sbjct: 347 ---VLGSSFSNW--------FCMMAMMTTSYYLPIYYSG 374

>CAGL0J09020g Chr10 (889269..891839) [2571 bp, 856 aa] {ON} highly
           similar to uniprot|P10870 Saccharomyces cerevisiae
           YDL194w SNF3 or uniprot|Q12300 Saccharomyces cerevisiae
           YDL138w RGT2
          Length = 856

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 42/76 (55%), Gaps = 5/76 (6%)

Query: 87  SQQAWLMASFPLVSGSFI--LVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVD 144
           +QQ  ++ SF L  G+F+  L +  + D YG KKT++  ++  V++SL   L   AHN+ 
Sbjct: 162 AQQLAILVSF-LSLGTFVGALSAPVISDKYGRKKTIM--FSTAVVFSLGNSLQVGAHNIQ 218

Query: 145 FFIVARSFQGLGIAFV 160
             I  R   GLG+  V
Sbjct: 219 LLIAGRVISGLGVGLV 234

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/195 (26%), Positives = 88/195 (45%), Gaps = 28/195 (14%)

Query: 84  AKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNV 143
           +++ ++ W+  SF L + +F  + GK+ D+ G K  LL  Y  +VI    C L+  A NV
Sbjct: 67  SESDKKQWIATSFLLTNTAFQPLYGKLSDVTGRKFALLMAYFFLVIG---CLLTCLARNV 123

Query: 144 DFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKA-----KNMVFSMIGACAPIGATLGC 198
             F VAR+  G+G   +    +  V +I     +       N+VF   G    +GA LG 
Sbjct: 124 TEFAVARAICGIGGGGINACSSITVSDICTAKERGIYQGYANIVF---GMGQMLGAPLGG 180

Query: 199 LFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIP---DNIPTNVHKF------KMDWL 249
           LF   IG     W   F     V  ++  +A+  +     ++P    +F      ++D+L
Sbjct: 181 LFIDTIG-----WRAIFGIQVPVVMVSAFLAYRNVNIKLSHVPPISERFTRKNLSRIDFL 235

Query: 250 GSFL---GVCGLIMF 261
           GS      +CG+++ 
Sbjct: 236 GSVTLASTICGVLVL 250

>ZYRO0E10230g Chr5 complement(850980..852656) [1677 bp, 558 aa] {ON}
           weakly similar to uniprot|Q07824 Saccharomyces
           cerevisiae YLL028W TPO1 Proton- motive-force-dependent
           multidrug transporter of the major facilitator
           superfamily able to transport eight different compounds
           including polyamines quinidine cycloheximide and
           nystatin involved in excess spermidine detoxification
          Length = 558

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/242 (21%), Positives = 99/242 (40%), Gaps = 19/242 (7%)

Query: 6   TPVSKQRTGSD---ISRKVVDNHEDSDMLLASRSR-LQNPDYFDK------QWKEYLFVI 55
           +PV    +G+    IS       E S +   +  R LQ  + +DK      QWK++  V 
Sbjct: 25  SPVEDNSSGTSPTGISPAEKFRQESSSIHTVNGKRVLQEYEVYDKLGYEFPQWKKWSIVT 84

Query: 56  SSMLSXXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYG 115
              +                 L+S++    +         F +  G    +     + YG
Sbjct: 85  VIFVCQLSMNFNGSVYPHALSLISKEFHVSSQAANTSQMIFKVAYGFGCELWAPWSEEYG 144

Query: 116 LKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVT-GIVGNIYKP 174
            +  +        IW ++ G    A N    IVAR F G GI+    +VT G+V ++++P
Sbjct: 145 RRNIMQLSLFFTNIWQILGG---KAPNFGTIIVAR-FLG-GISQAGGSVTLGVVADMWQP 199

Query: 175 NTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIP 234
                 + + ++ +   +GA +G +F GL+  E  +W W F+   I   +  L+ ++++P
Sbjct: 200 QDHGYAVAYVVLASV--LGAVIGPVFGGLM-EEHLSWHWNFWIQLIFGGVTQLLHFFLVP 256

Query: 235 DN 236
           + 
Sbjct: 257 ET 258

>Suva_4.431 Chr4 (759282..761000) [1719 bp, 572 aa] {ON} YBR180W
           (REAL)
          Length = 572

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/188 (21%), Positives = 80/188 (42%), Gaps = 4/188 (2%)

Query: 73  PLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSL 132
           P   LL  +    A+     +++F  V     L  G + D  G K   +   ++++  ++
Sbjct: 132 PALPLLQREFDVSATTINSTVSAFMAVFSVGPLFWGALADFGGRKFLYMVSLSLMLAVNI 191

Query: 133 ICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPI 192
           I  L++   N+    V R FQ    + V+    G V ++  P  + K + + M+G    +
Sbjct: 192 I--LAAVPANIAALFVLRVFQAFASSSVISLGAGTVTDVVPPKHRGKAIAYFMMGPN--M 247

Query: 193 GATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSF 252
           G  +  + +GLI  +   W W F   +I+A +  ++   ++P+ +   V      W    
Sbjct: 248 GPIIAPIVAGLILMKGNYWRWLFGFTSIMAGIALILVTALLPETLRCIVGNGDPKWCERK 307

Query: 253 LGVCGLIM 260
            GV G ++
Sbjct: 308 KGVEGKVL 315

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 63/130 (48%), Gaps = 6/130 (4%)

Query: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFF 146
           S+  WL   + L +   +L+ G++    G K T+L    +  I SLI  L+S   +++  
Sbjct: 96  SEIGWLFTGYSLPNALLVLIWGRIATPIGFKATMLFAIVIFEIGSLISALAS---SMNML 152

Query: 147 IVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGT 206
           I  R   G+G    + +++ ++G+     +K + M+ +++ +   I + +G    G+  T
Sbjct: 153 IGGRVIAGIG-GCGIQSLSFVIGSTLVEESK-RGMLIAILSSSFAIASVVGPFLGGVF-T 209

Query: 207 ESEAWAWTFY 216
            S  W W FY
Sbjct: 210 SSVTWRWCFY 219

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 77/419 (18%), Positives = 155/419 (36%), Gaps = 40/419 (9%)

Query: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFF 146
           +  +W + ++ +    FI   G+VGDI G     +    +  I SLIC +    +N   F
Sbjct: 60  TTASWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAV---VNNFGTF 116

Query: 147 IVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGT 206
            V R+ QG+  A ++P+   ++  +   +       F+++         +G +  G    
Sbjct: 117 AVFRALQGIAAAGIVPSGYALIPTL--SDEHEVQSFFAIVSCGFSTSFGIGFIIGGAFTL 174

Query: 207 ESEAWAWTFYAYTIVAALNGLIAWYVI---PDNIPTNVHKFK---------MDWLGSFLG 254
               +   FY    V  +  +I+++ I    +  P      K         +D++GSF+ 
Sbjct: 175 TRIGYKGIFYLTFAVMLVISIISYFSIGTSANQKPCTKDSPKTTKWSDALSLDFIGSFMF 234

Query: 255 VCGLIMFNFVWNQAPTDGWD--SAYXXXXXXXXXXXXXX-------XXXXEARFAKEP-- 303
           +   I+   V      + W   SAY                           + A  P  
Sbjct: 235 ISSTILI-VVGLTEGGESWKKPSAYVTLIVGIALFVLFFIWNICYGVLVKNLKSASNPKV 293

Query: 304 ---------LLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGS 354
                    L+P+ VL  +  + I  ++F  +G      Y    +   +   +PL A   
Sbjct: 294 YNYFRTIQVLIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVK 353

Query: 355 YFMFAIFGTIAAFLVGHTIHKTGP-AIILLASVIAFDVGCIMLSVTPV-DQTYFRMSLGT 412
                +   I   ++        P   ++L   I F    I++ +  + D  Y+++   +
Sbjct: 354 LLPLVVSMLIPNVVIAIKSDLISPRKAVVLGFFIMFIGSIILIQLHLITDNLYWKIFFCS 413

Query: 413 MVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNK 471
             +++FG  + FP S  IL    P +Y+G+A  ++ T   + + +   V  +    +N+
Sbjct: 414 QSLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINE 472

>ACL172C Chr3 complement(58313..60208) [1896 bp, 631 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR043C
          Length = 631

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 69/137 (50%), Gaps = 12/137 (8%)

Query: 110 VGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVG 169
           + D  G +   +  +A++V++S+    ++++ N++ FI+ R   G   A V     G + 
Sbjct: 154 LADKNGRRTVYVLSFALLVVFSVG---TAFSRNIETFIILRILCGAASASVQSVGAGTIA 210

Query: 170 NIYKPNTKAKNMVFSMIGAC-APIGATLGCLFSGLIGTESEAWAW--TFYAYTIVAALNG 226
           ++Y P  + +N+ +  +G   AP+   L  + S L+      W+W  T +   I+AAL  
Sbjct: 211 DLYVPEERGRNLGYYYLGPLMAPL---LSPIVSSLLVNR---WSWRSTQWFMVILAALTF 264

Query: 227 LIAWYVIPDNIPTNVHK 243
           L+  + +P+ + T  +K
Sbjct: 265 LLLVFALPETLRTQDNK 281

>Suva_14.276 Chr14 (502686..504374) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 64/134 (47%), Gaps = 12/134 (8%)

Query: 106 VSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVT 165
           V G + D +G +  +LGG  V V+ S+  GL+  A +    I  R  Q +GI+  +   +
Sbjct: 155 VCGGLADCFGRRPIILGGMLVYVVASV--GLAC-APSYGVIIFLRCVQSIGISPTIAISS 211

Query: 166 GIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEA-WAWT--FYAYTIVA 222
           G+VG+    + +      + +GA +     LG  F  LIG    A W W   F+  TI  
Sbjct: 212 GVVGDFTLKHERG-----TFVGATSGF-VLLGQCFGSLIGAVLTARWDWRSIFWFLTIGC 265

Query: 223 ALNGLIAWYVIPDN 236
               LIA++++P+ 
Sbjct: 266 GTCFLIAFFILPET 279

>TPHA0I01760 Chr9 (388160..390121) [1962 bp, 653 aa] {ON} Anc_8.570
           YBR180W
          Length = 653

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 63/144 (43%), Gaps = 4/144 (2%)

Query: 108 GKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGI 167
           G   D+ G K   L    +V + +L+  L+    N+    V R FQ  G + V+   +G 
Sbjct: 167 GVYADVCGRKWLYLCSLILVTVINLL--LAVLPANLASLFVLRVFQAFGSSSVITLGSGT 224

Query: 168 VGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGL 227
           V +I     + K + + M+G    +G  LG + +GLI    + W W F    I++A+  L
Sbjct: 225 VTDITPMKHRGKAIAYFMLGP--NMGPILGPIIAGLILINGDYWRWLFGFTCIMSAIGFL 282

Query: 228 IAWYVIPDNIPTNVHKFKMDWLGS 251
           +    +P+ +   V      W  S
Sbjct: 283 LVLIFLPETLRCIVGNGDPRWRNS 306

>CAGL0M06281g Chr13 (651932..653560) [1629 bp, 542 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180w DTR1
          Length = 542

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 62/141 (43%), Gaps = 4/141 (2%)

Query: 108 GKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGI 167
           G + D  G K   +   +++VI +++  L+S    +   I  R  Q    + V+    G 
Sbjct: 136 GALADKGGRKILYIISISLMVIINIL--LASVPKKIGSLIFLRIIQAFASSSVISLGAGT 193

Query: 168 VGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGL 227
           V ++  P  + K M + M+G    +G  L  + +GLI  ++  W W F    IV+ L  +
Sbjct: 194 VADLTPPKDRGKAMAYFMLGP--NLGPILAPIIAGLILLDNNNWRWLFGFLCIVSGLGLI 251

Query: 228 IAWYVIPDNIPTNVHKFKMDW 248
           +   ++P+ +   V      W
Sbjct: 252 MVILLLPETLRCIVGNGDRQW 272

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 109/267 (40%), Gaps = 22/267 (8%)

Query: 91  WLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVAR 150
           W+  S+ L S  F  + GK+ DI+G K  L+    +     +ICG+S   ++++  +  R
Sbjct: 436 WVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMS---NSLNMLVWGR 492

Query: 151 SFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACA---PIGATLGCLFSGLIGTE 207
              G+G   +    T  V +I    ++A   V+   G C     +G   G +  G+    
Sbjct: 493 FVAGIGGGGITSMTTITVSDIVPLRSRA---VYQ--GICNFFFGLGTAFGGVIGGIFVDH 547

Query: 208 SEAWAWTFYAYTIVAALNGLI--AWYVIP--DNIPTNVHK--FKMDWLGSFLGVCGLIMF 261
              W   F++   V+ L+ L+  ++ V+P   N   ++ +   ++DWLGS   +  L  F
Sbjct: 548 QYGWRMVFWSQVPVSGLSTLLICSFLVVPRIKNYEVSLGRKLMRVDWLGSISMILWLTSF 607

Query: 262 NFVWNQ--APTDGWDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAVLFNRKLM-MI 318
             +       +   DS                    E   A +P+LP   L NR ++   
Sbjct: 608 LLITTMMGGISLDIDSDQFHYLIMFSSVSAIIFVLTELFVASDPVLPLRFLSNRSVLGAS 667

Query: 319 LASLFLGWGSFGIWTYY--YMAFVLNL 343
           L + F   G   I  Y   Y A VL++
Sbjct: 668 LGNFFCVMGFMTICFYLPIYFASVLDI 694

>TDEL0A05130 Chr1 complement(910315..912114) [1800 bp, 599 aa] {ON}
           Anc_8.570 YBR180W
          Length = 599

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 49/107 (45%), Gaps = 2/107 (1%)

Query: 142 NVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFS 201
           N+    V R FQ  G + V+   TG V +I  P  + K + + M+G    +G  L  + S
Sbjct: 223 NIVALFVLRVFQAFGSSSVIALGTGTVSDISPPKDRGKAIAYFMMGPN--MGPILAPIIS 280

Query: 202 GLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDW 248
           GLI    + W W F   +I++ +  L+   ++P+ +   V      W
Sbjct: 281 GLILIRGDYWRWLFGFTSIMSGIALLLVLALLPETLRCIVGNGDQRW 327

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 99/242 (40%), Gaps = 30/242 (12%)

Query: 26  EDSDMLLA-SRSRLQNPDYFDKQW------------KEYLFVISSMLSXXXXXXXXXXXX 72
           +++D+LLA   S +     FD  +            K  + VI+  L             
Sbjct: 3   QETDLLLAPCLSPIPEIPTFDSSYDAAANHSVLTETKTRIIVIALFLGSFLSALDTTIVS 62

Query: 73  PLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSL 132
            L   ++ DL A +SQ +W+  S+ L   +F  + GK+ DI+G K  L+    V  I   
Sbjct: 63  TLLPTIASDLDA-SSQMSWIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCA 121

Query: 133 ICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKA-----KNMVFSMIG 187
           +CG S +  N+      R   G+G   +    T    +I     +       N+ FS+  
Sbjct: 122 LCG-SPWTTNIWILSAGRFIAGIGGGGLTTLSTITTSDIIPLRKRGVYQGLGNICFSL-- 178

Query: 188 ACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMD 247
            CA  G+ LG +    IG     W W F     +A ++GL+  +V+   +P++     + 
Sbjct: 179 GCAS-GSVLGAVLQQGIG-----WRWAFLIQVPIALISGLLIVFVL--ELPSDSPGRGLI 230

Query: 248 WL 249
           WL
Sbjct: 231 WL 232

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 60/130 (46%), Gaps = 6/130 (4%)

Query: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFF 146
           S+  WL+  + L +  F L+ G+   I+G K TL+    +  I SL+  +S   +++D  
Sbjct: 55  SKIGWLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLVIAVS---NSMDMI 111

Query: 147 IVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGT 206
           I  R   G G + +   V  I  ++   +T+    + +++     + + LG    G + T
Sbjct: 112 IGGRVIAGCGASGIQTLVFAIATSLVDEHTRGT--IVTLLSLSYAVASALGPYIGGAL-T 168

Query: 207 ESEAWAWTFY 216
           E   W W FY
Sbjct: 169 EYVTWRWCFY 178

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 84  AKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNV 143
           +++S++ W+  SF L + +F  + GK+ DI G +  LL        + L C ++ +A NV
Sbjct: 68  SESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQ---FFFGLGCLMTCFARNV 124

Query: 144 DFFIVARSFQGLG 156
             F +AR+  G+G
Sbjct: 125 TEFSIARAVCGIG 137

>Smik_2.320 Chr2 (575945..577663) [1719 bp, 572 aa] {ON} YBR180W
           (REAL)
          Length = 572

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 73/165 (44%), Gaps = 4/165 (2%)

Query: 73  PLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSL 132
           P   LL  +    A+     ++ F  V     L  G + D  G K   +   ++++I ++
Sbjct: 132 PALPLLQREFGVSATTINATVSVFMAVFSVGPLFWGALADFGGRKFLYMASLSLMLIVNI 191

Query: 133 ICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPI 192
           +  L++   N+    V R FQ    + V+    G V ++  P  + K + + M+G    +
Sbjct: 192 L--LAAVPVNIAALFVLRVFQAFASSSVISLGAGTVTDVVPPKHRGKAIAYFMMGPN--M 247

Query: 193 GATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNI 237
           G  +  + +GLI  + + W W F    I+A +  ++   ++P+ +
Sbjct: 248 GPIIAPIVAGLILMKGDYWRWLFGFTAIIAGIALILVSALLPETL 292

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 93/247 (37%), Gaps = 36/247 (14%)

Query: 88  QQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFI 147
           + +W+  S+ L S +   + GK+ D  G K  L+   AV  I  LICGLS+    V   +
Sbjct: 122 KASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAV---V 178

Query: 148 VARSFQGLGIAFVLPNVTGIVGNIYKPNTKA-----KNMVFSMIGACAPIGATLGCLFSG 202
             R   G+G   +    T I+ ++     +A      N VF            LG    G
Sbjct: 179 AGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFG-----------LGTASGG 227

Query: 203 LIGTESEAWAWTFYAYTIVAALNG--LIAWYVIPDNIPT------NVHKFKMDWLGSFLG 254
           L+G     W   F     ++ L+G  ++ +  +P           +    ++DW G+   
Sbjct: 228 LVGAYFRDWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWAGA--- 284

Query: 255 VCGLIMFNFVWNQAPTDG-----WDSAYXXXXXXXXXXXXXXXXXXEARFAKEPLLPRAV 309
              LI F F++    + G     + S                    E R A +P+LP   
Sbjct: 285 -TSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVTF 343

Query: 310 LFNRKLM 316
           L +R ++
Sbjct: 344 LRDRSVL 350

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 38/85 (44%), Gaps = 3/85 (3%)

Query: 74  LFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLI 133
           L D LS       +  +W + S+ +    FI   G++GDI G  +          I SL+
Sbjct: 51  LIDELSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILSLL 110

Query: 134 CGLSSYAHNVDFFIVARSFQGLGIA 158
           CGL     N + F V R+ QG+  A
Sbjct: 111 CGL---MPNFEAFAVMRALQGIAAA 132

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 86/194 (44%), Gaps = 24/194 (12%)

Query: 74  LFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLI 133
           L D ++ + +A     +W+ AS+ L +  F  + GK+ DI+G K  LL    +  +  L+
Sbjct: 175 LLDYIASEFEA-LPYISWIAASYLLSACIFQPLYGKLSDIFGRKAILLFSNLMFGLGCLV 233

Query: 134 CGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIG 193
           CG    A  V + +  R   G+G   +    + I+ +I    ++A      +   C  +G
Sbjct: 234 CGT---APTVWWLLAGRFVAGIGGGGLTSMPSIIISDIVPLRSRASYQ--DLFNICYVLG 288

Query: 194 ATLGCLFSGLIGTESEAWAWTFYAYTIVAALNG--LIAWYVIP-------------DNIP 238
            TLG    G +  E   W   F    + A ++G  + A+ ++P             +++ 
Sbjct: 289 ITLGGSMGGWLA-EYGGWRLVFLLQVVAALISGCFIQAFLILPKVHHGNGIALANKESLK 347

Query: 239 TNVHKFKMDWLGSF 252
           T +  + MDWLG+F
Sbjct: 348 TKL--YMMDWLGTF 359

>KLTH0B10384g Chr2 complement(877070..878725) [1656 bp, 551 aa] {ON}
           similar to uniprot|P15365 Saccharomyces cerevisiae
           YJR152W DAL5 Allantoin permease ureidosuccinate permease
           expression is constitutive but sensitive to nitrogen
           catabolite repression
          Length = 551

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 75/168 (44%), Gaps = 16/168 (9%)

Query: 78  LSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGY--AVVVIWSLICG 135
           +  DLK   +Q +W+  SF L    F++        + L++  L     A ++ W L+  
Sbjct: 132 IKTDLKMVGNQYSWVGTSFYL---GFLVFEAPCS--WTLQRLPLSKITSAYIIAWGLLLC 186

Query: 136 LSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGAT 195
           L+S   +   FI+ R+  G+  + + P +   +   YK + +      S++ AC  +G  
Sbjct: 187 LTSLVKSYPTFILTRTLLGVLESSITPAMVLFMSQWYKKDEQFFRT--SILIACNAVGGL 244

Query: 196 LGCLFS------GLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDN 236
           +G   S       L GT S +AW   F    ++  + GL+  ++IPD 
Sbjct: 245 VGASVSYRLYERQLAGTLSMDAWRILFIIVGLITIVTGLMVLFIIPDT 292

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 68/143 (47%), Gaps = 7/143 (4%)

Query: 74  LFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLI 133
           L++ + E  K  A +  WL+  + L +  F L+ G++  I GLK +L     +  I SLI
Sbjct: 30  LYETIGEKFKDYA-RIGWLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLI 88

Query: 134 CGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIG 193
             +S   +++   I  R   G G + +  ++  +VG       + + MV +++G    + 
Sbjct: 89  VAVS---NSMGMIIGGRVVAGCGGSGI-QSLVFVVGTSLVEE-RNRGMVITVLGLAFAVA 143

Query: 194 ATLGCLFSGLIGTESEAWAWTFY 216
             +G +  G   TE+ +W W FY
Sbjct: 144 FAVGPVIGGAF-TENVSWRWCFY 165

>Kwal_14.782 s14 (42720..44195) [1476 bp, 491 aa] {ON} YGR260W
           (TNA1) - Tna1p is a high affinity nicotinic acid plasma
           membrane permease [contig 245] FULL
          Length = 491

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 52/116 (44%), Gaps = 5/116 (4%)

Query: 126 VVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSM 185
           +V  WS+I   S +  +    +  R   G       P +T ++  +YKP  +AK + F  
Sbjct: 123 LVFCWSVITLSSGFVQSYGSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKRIAF-F 181

Query: 186 IGACAPIGATLGCLFSGLIGTES----EAWAWTFYAYTIVAALNGLIAWYVIPDNI 237
            G+ A  GA  G + +GL   +S    E W W +    +++       ++ +PDN+
Sbjct: 182 FGSSALSGAFGGLIATGLASVKSTSGLEGWRWLYIIEGLISVCATAWLFFGLPDNL 237

>KNAG0A03540 Chr1 (450487..452103) [1617 bp, 538 aa] {ON} Anc_8.570
           YBR180W
          Length = 538

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 52/253 (20%), Positives = 104/253 (41%), Gaps = 19/253 (7%)

Query: 7   PVSKQRTGSDISRKVVD--NHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXX-- 62
           P ++Q  G+      +D  + ++++  LA+    +N   F       +FVI + +     
Sbjct: 31  PATEQGNGTPNHSAFLDAIDLKENEESLANVQTQRNYTCFTNGQIFLIFVIITFIGFLGP 90

Query: 63  XXXXXXXXXXPLFDLL----SEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKK 118
                     PLF  +    +  + A  S    + A  PL+ G++        D+ G K 
Sbjct: 91  MSGNIYIPALPLFQTIFHTSTSTINATVSVFMAVFAVGPLLWGAY-------ADVGGRKI 143

Query: 119 TLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKA 178
             L   A++ I +++  L+S + N+    + R  Q    + V+    G V ++  P+ + 
Sbjct: 144 LYLLSLALMFIVNVL--LASLSPNIVALFILRIAQAFASSSVIALGAGTVTDLIVPSARG 201

Query: 179 KNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIP 238
           K + + M+G    +G  +  + +GLI   ++ W W F    I++ +  L  W  +P+ + 
Sbjct: 202 KAIGYFMMGP--NMGPVIAPIVAGLILINTDRWRWLFGFCAIMSGVALLCVWIFLPETLR 259

Query: 239 TNVHKFKMDWLGS 251
             V      W G 
Sbjct: 260 CIVGNGDPSWKGE 272

>TDEL0D06570 Chr4 complement(1183554..1185254) [1701 bp, 566 aa]
           {ON} 
          Length = 566

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 97/238 (40%), Gaps = 21/238 (8%)

Query: 1   MNSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLS 60
            N E    +  R  S+  R+++  +E  D L  S S         K+W     +  + LS
Sbjct: 20  QNREKQRETNSRGSSEDPRRILREYECYDKLGYSFST-------RKKWTILTIIFITQLS 72

Query: 61  XXXXXXXXXXXXPLF-DLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKT 119
                       PL         +A  + Q   + S+      +   S + G    ++ +
Sbjct: 73  MNFNASAYPHAIPLIAKEFGVSTQAANTSQMIFLVSYGFGCELWAPWSEEYGRWRVMQLS 132

Query: 120 LLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVT-GIVGNIYKPNTKA 178
           LL       IW ++ GL   A N    IVAR   G+ +A    +VT G+V +++ P    
Sbjct: 133 LL----FSNIWQILGGL---APNFGTIIVARFLGGMSLA--GGSVTLGVVADMFDPIDHG 183

Query: 179 KNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDN 236
             + F ++ +    G+ +G +F GL+  E  +W W F+   I   +  ++ ++++P+ 
Sbjct: 184 YAVAFIVLSSVC--GSVIGPIFGGLM-QEHLSWHWNFWIQLIFNGVAQILHFFIVPET 238

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 13/117 (11%)

Query: 85  KASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVD 144
           ++ ++ W++ SF L + +F  + GK+ D+ G K  L+  ++  ++  L   LS    N+ 
Sbjct: 73  ESDKKQWIVTSFLLTNTAFQPLYGKLSDLAGRKTALMVAHSFFLVGCLFTALS---RNLV 129

Query: 145 FFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKA-----KNMVF---SMIGACAPIG 193
            F +AR+  G+G   +    +  V +I  P  +       N+VF   SM+G   PIG
Sbjct: 130 EFSIARAVCGMGAGGISALSSISVSDICTPKERGVYQGYANVVFGTGSMLG--GPIG 184

>Smik_1.1 Chr1 complement(4254..6038) [1785 bp, 594 aa] {ON} YAL067C
           (REAL)
          Length = 594

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 54/122 (44%), Gaps = 11/122 (9%)

Query: 128 VIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTG---IVGNIYKPNTKAKNMVFS 184
           + WSL+   ++Y ++V      R F G   AF  P+      + G+ YK +   +   F 
Sbjct: 213 LCWSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGSFYKHDEMVRRSAFY 269

Query: 185 MIGACAPI---GATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTN 240
            +G    I   G     ++S L G    E W W F    IV+ + GLI +Y +P + P N
Sbjct: 270 YLGQYIGILSAGGIQSAVYSSLNGVNGLEGWRWNFIIDAIVSVVVGLIGFYALPGD-PYN 328

Query: 241 VH 242
            +
Sbjct: 329 CY 330

>KLTH0B10054g Chr2 complement(839166..840677) [1512 bp, 503 aa] {ON}
           weakly similar to uniprot|P53322 Saccharomyces
           cerevisiae YGR260W TNA1 High affinity nicotinic acid
           plasma membrane permease
          Length = 503

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 51/116 (43%), Gaps = 5/116 (4%)

Query: 126 VVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSM 185
           +V  WS+I   S +  +    +  R   G       P +T ++  +YKP  +AK + F  
Sbjct: 135 LVFCWSVITLSSGFVKSYHSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKRIAF-F 193

Query: 186 IGACAPIGATLGCLFSGLIGTES----EAWAWTFYAYTIVAALNGLIAWYVIPDNI 237
            G+ A  GA  G + +GL    +    E W W +    +++       ++ +PDN+
Sbjct: 194 FGSSALSGAFGGLIATGLASVNNAGGLEGWRWLYIIEGLISVCASFWLFFGLPDNL 249

>KLTH0E00462g Chr5 (45358..46869) [1512 bp, 503 aa] {ON} weakly
           similar to uniprot|P53322 Saccharomyces cerevisiae
           YGR260W TNA1 High affinity nicotinic acid plasma
           membrane permease
          Length = 503

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 51/116 (43%), Gaps = 5/116 (4%)

Query: 126 VVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSM 185
           +V  WS+I   S +  +    +  R   G       P +T ++  +YKP  +AK + F  
Sbjct: 135 LVFCWSVITLSSGFVKSYHSLLATRILLGTFEGGFFPAMTLLITMMYKPKEQAKRIAF-F 193

Query: 186 IGACAPIGATLGCLFSGLIGTES----EAWAWTFYAYTIVAALNGLIAWYVIPDNI 237
            G+ A  GA  G + +GL    +    E W W +    +++       ++ +PDN+
Sbjct: 194 FGSSALSGAFGGLIATGLASVNNAGGLEGWRWLYIIEGLISVCASFWLFFGLPDNL 249

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 83/405 (20%), Positives = 156/405 (38%), Gaps = 41/405 (10%)

Query: 90  AWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVA 149
           +W+  ++ L S +F  + GK+ DI+G K  L+       + SLICGLS        ++VA
Sbjct: 159 SWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICGLSPSFE----WLVA 214

Query: 150 RSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESE 209
             F        + +++ I  +   P  + + +   +      +G  LG +  G     S 
Sbjct: 215 GRFIAGIGGGGITSMSSITTSDIVP-LRNRALYQGICNFYFGLGTALGGVVGGWFSDRSV 273

Query: 210 AWAWTFYAYTIVAALNG--LIAWYVIPDNIP-------------TNVHKFKMDWLGSFLG 254
            W  +F     +A  +   +I +  +P                   V    +DW+G+   
Sbjct: 274 GWRMSFLIQLPIAFFSTILIILFLRLPKESKGRGLQVDGNYFSTIKVRLSAVDWIGATTL 333

Query: 255 VCGLIMFNFVWNQAPTDGWDSAYXXXXXXXXXXXXXXXXX----XEARFAKEPLLPRAVL 310
           V  L +F+F+   A   G +  Y                      E + AK+P+LP   L
Sbjct: 334 V--LFLFSFMIT-ASLGGKEIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFL 390

Query: 311 FNRKLMMILASLFLGWGSFGIWTYY---YMAFVLNLRHYTPLWAGGSY---FMFAIFGTI 364
            +R ++    S +    +    +YY   Y A VLN++   P   G      F    FG++
Sbjct: 391 KDRSVLGSSLSNWFCMMALMTVSYYLPIYFAGVLNMK---PTDIGKRIIPNFFSTAFGSL 447

Query: 365 AAFLVGHTIHKTGPAI-ILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGMDLS 423
            A   G+ + KTG     +++  +   +GC+ +     D + F+     M I   G  + 
Sbjct: 448 GA---GYYMKKTGKYYWFVISFCVLASIGCLQIVWIQPDISVFK-QYTLMFIPGLGASVL 503

Query: 424 FPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQ 468
              + + +   +P  +Q +  S+     +   +L + + G   R+
Sbjct: 504 ITVALLAMIAAVPHNHQAVTTSISYAFRSTGCTLGVSIGGAIFRE 548

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 69/138 (50%), Gaps = 14/138 (10%)

Query: 106 VSGKVGDIYGLKKTLLGGYAVVVIWSLICGLS-SYAHNVDFFIVARSFQGLGIAFVLPNV 164
           +SG + D+YG +  +L G  + V+ S+  GL+ S ++ V  F+  R  Q  GI+ ++   
Sbjct: 152 ISGGLADVYGRRPIILAGMLIYVVASI--GLACSNSYGVIVFL--RCVQSAGISPLIAIS 207

Query: 165 TGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIG---TESEAWAWTFYAYTIV 221
           +G+VG+    + +      S +GA +   A +G  F  LIG   T +  W   F+  TI 
Sbjct: 208 SGVVGDFTTKSERG-----SFVGAVSGF-ALMGQAFGSLIGAGLTAAYDWRAIFWFLTIG 261

Query: 222 AALNGLIAWYVIPDNIPT 239
                +I ++++P+   T
Sbjct: 262 CGTCFVINFFLLPETKRT 279

>ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} similar
           to gnl|GLV|DEHA0A14894g Debaryomyces hansenii
           DEHA0A14894g and weakly similar to YLL028W
           uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton- motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 595

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 9/112 (8%)

Query: 129 IWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVT-GIVGNIYKPNTKAKNMVFSMIG 187
           +W ++ GL   A N    IVAR F G GI+    +VT G+  +++ P      + F ++ 
Sbjct: 194 VWQILGGL---APNFGSIIVAR-FLG-GISLAGGSVTLGVAADMWDPADHGYAVAFVVL- 247

Query: 188 ACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPT 239
            C+  G  +G +F GL+  E  +W W F+   I   +  ++ ++++P+   T
Sbjct: 248 -CSVGGTVIGPIFGGLM-EEHLSWHWNFWIQLIFNGVTQVLHFFIVPETRST 297

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 63/140 (45%), Gaps = 9/140 (6%)

Query: 80  EDLKAK---ASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGL 136
           ED+  K    S+  W+ A + L +    L+ G++  I G K  +L    +  I SLI G+
Sbjct: 103 EDVAKKFGAYSKTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGV 162

Query: 137 SSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATL 196
              A++++  I  R   G+G + +      I  N+   + + + ++ + + +   + + +
Sbjct: 163 ---ANSMNMLIGGRVIAGVGGSGIQSLAFVIGSNLV--DERRRGLIIACMSSAFAVASVI 217

Query: 197 GCLFSGLIGTESEAWAWTFY 216
           G    G   T +  W W FY
Sbjct: 218 GPFLGGAFTTHA-TWRWCFY 236

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 77/172 (44%), Gaps = 12/172 (6%)

Query: 73  PLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSL 132
           P    L ++     ++    +  + L  G    VSG + D++G +  +LGG  + V+ S+
Sbjct: 123 PALRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASI 182

Query: 133 ICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPI 192
             GL+  A +       R  Q +GI+  +   +G+VG+    + +      + +GA + +
Sbjct: 183 --GLAC-APSYGVICFLRCIQSIGISPTIAISSGVVGDFTLKHERG-----TFVGATSGL 234

Query: 193 GATLGCLFSGLIGTESEA-WAWT--FYAYTIVAALNGLIAWYVIPDNIPTNV 241
              LG  F  LIG    A W W   F+   I + +  ++A + +P+   T V
Sbjct: 235 -VLLGQCFGSLIGAVLTARWDWRAIFWFLAIGSGVALIVAAFTLPETKRTIV 285

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 61/130 (46%), Gaps = 6/130 (4%)

Query: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFF 146
           S+  WL   + L +   +L+ G++  + G K + L   A +VI+ +   +S+ A+++D  
Sbjct: 78  SKVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTL---AAIVIFEVGSLVSALANSMDML 134

Query: 147 IVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGT 206
           I  R   G+G + V   V  I   + +   + + ++ +++ +   I + +G    G   T
Sbjct: 135 IGGRVIAGIGGSGVQSLVFVISSTLVEE--RNRGLIIAVMSSSFGIASVVGPFLGGAFTT 192

Query: 207 ESEAWAWTFY 216
               W W FY
Sbjct: 193 HV-TWRWCFY 201

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 50/119 (42%), Gaps = 2/119 (1%)

Query: 136 LSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGAT 195
           L+S   N+    + R  Q +G +  +   TG V +I  P  + K++   M+G    +G  
Sbjct: 217 LASLPANIIALYLVRVLQVVGASAAISLGTGTVADISPPKHRGKSVALFMLGPN--MGPI 274

Query: 196 LGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLG 254
           +  + +GLI   S  W W F    I   +  +I   ++P+ +   V      W  S  G
Sbjct: 275 IAPIIAGLILMNSNQWRWLFGFSAICTGVALMIVIVILPETLRCIVGNNDPKWSRSQRG 333

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 69/139 (49%), Gaps = 12/139 (8%)

Query: 106 VSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVT 165
           +SG + D++G +  +L G  + V+ S+  GL+  A +    +  R  Q +GI+  +   +
Sbjct: 145 ISGGLADVFGRRPVILIGMLIYVVASI--GLAC-APSYGVIVFLRIIQSIGISPTIAISS 201

Query: 166 GIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTE-SEAWAWT--FYAYTIVA 222
           G+VG+    + +      + +GA + +   LG  F  LIG   + AW W   F+  TI  
Sbjct: 202 GVVGDFTLKHERG-----TFVGATSGL-VLLGQCFGSLIGAVLAAAWNWRAIFWFLTIGC 255

Query: 223 ALNGLIAWYVIPDNIPTNV 241
             + +IA+ ++P+   T V
Sbjct: 256 GTSFIIAFLLLPETKRTLV 274

>AGR195W Chr7 (1120597..1122456) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR180W (DTR1)
          Length = 619

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 2/101 (1%)

Query: 148 VARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTE 207
           V R  Q    +  L    G V +I  P  + K + + M+G  A  G  L  + +GLI  +
Sbjct: 254 VLRVVQAFASSSALSLGAGTVSDITPPKNRGKAIAYFMLGPNA--GPILAPIIAGLILFD 311

Query: 208 SEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDW 248
           ++ W W F   +I+A +  L+    +P+ +   V    + W
Sbjct: 312 NDRWRWLFGFTSIMAGIGFLLVCVFLPETLRCIVGNGDVRW 352

>YAL067C Chr1 complement(7235..9016) [1782 bp, 593 aa] {ON}
           SEO1Putative permease, member of the allantoate
           transporter subfamily of the major facilitator
           superfamily; mutation confers resistance to ethionine
           sulfoxide
          Length = 593

 Score = 38.1 bits (87), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 54/122 (44%), Gaps = 11/122 (9%)

Query: 128 VIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTG---IVGNIYKPNTKAKNMVFS 184
           + WSL+   ++Y ++V      R F G   AF  P+      + G+ YK +   +   F 
Sbjct: 212 LCWSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGSFYKHDEMVRRSAFY 268

Query: 185 MIGACAPI---GATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTN 240
            +G    I   G     ++S L G    E W W F    IV+ + GLI +Y +P + P N
Sbjct: 269 YLGQYIGILSAGGIQSAVYSSLNGVNGLEGWRWNFIIDAIVSVVVGLIGFYSLPGD-PYN 327

Query: 241 VH 242
            +
Sbjct: 328 CY 329

>Kwal_56.22949 s56 complement(342503..344431) [1929 bp, 642 aa] {ON}
           YBR043C (AQR2) - YBR043C [contig 184] FULL
          Length = 642

 Score = 38.1 bits (87), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 51/105 (48%), Gaps = 12/105 (11%)

Query: 127 VVIWSLICGL---SSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVF 183
           V+ ++L+C     S+ A N++ FIV R   G   A V     G V ++YKP  + K + +
Sbjct: 162 VLSFTLLCAFCIGSALAPNIEAFIVFRMLCGASSASVQSVGAGTVADLYKPEDRGKRLGY 221

Query: 184 SMIGACAPIGATLGCLFSGLIGT-ESEAWAW--TFYAYTIVAALN 225
             +GA       +  L S +IG+     W+W  T +   I+A +N
Sbjct: 222 YYLGAL------MAPLLSPIIGSLLVNRWSWRSTQWFMVILAGVN 260

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 30/141 (21%), Positives = 67/141 (47%), Gaps = 7/141 (4%)

Query: 76  DLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICG 135
           ++++E  K   S+  W+++ + L      L+ G+   I G K +LL    +    SLI  
Sbjct: 143 EVIAEQFK-DYSKSGWIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGSLISA 201

Query: 136 LSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGAT 195
           +S   ++++  I  R   G+G + +  ++  ++ +   P+ +++ ++ S++     + A 
Sbjct: 202 IS---NSMNMLIGGRVVAGIGGSGI-QSLCFVIASTLTPD-RSRVIIISVLSCSYAVAAV 256

Query: 196 LGCLFSGLIGTESEAWAWTFY 216
           +G    G + T    W W FY
Sbjct: 257 VGPFLGGALTTH-VTWRWCFY 276

>KAFR0J01620 Chr10 complement(300964..302676) [1713 bp, 570 aa] {ON}
           Anc_2.241 YIL121W
          Length = 570

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 20/141 (14%)

Query: 115 GLKKTLLGGYA------VVVIWSLI-----CGLSSYAHNVDFFIVARSFQGLGIAFVLPN 163
           GL  +L+GG A       VV+WS++     C   + + N    I+ R  Q  GI+ V+  
Sbjct: 125 GLSPSLMGGLADSLGRRPVVLWSVVIYFGACIGLALSQNYTQIIILRCLQAAGISPVIAI 184

Query: 164 VTGIVGNIYKPNTKAKNMVF-SMIGACAPIGATLGCLFSGLIGTESEAWAWT--FYAYTI 220
            +GI+G++    TKA+   +   +     +G+ LG L    +   S  W W   F+   I
Sbjct: 185 NSGIMGDV---TTKAERGGYVGYVAGFQILGSALGALIGAAL---SSRWDWRAIFWFLAI 238

Query: 221 VAALNGLIAWYVIPDNIPTNV 241
            +    L++++V+P+   T V
Sbjct: 239 GSGACALVSFFVLPETKRTVV 259

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 78/182 (42%), Gaps = 17/182 (9%)

Query: 90  AWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVA 149
           +W+ AS+ + S SF  + G   D+ G +K L     +  I  L CG+S    N+ +    
Sbjct: 105 SWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGISI---NILWLSFM 161

Query: 150 RSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESE 209
           R+F G+G   ++   T IV +   P +K + +  +       +GA  G  F G+I T S 
Sbjct: 162 RAFTGIGGGGLITLST-IVNSDMIPTSK-RGIFQAFQNLLLGLGAICGASFGGVI-TSSI 218

Query: 210 AWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFK-----------MDWLGSFLGVCGL 258
            W W F     ++    LI    + +       K K           +D+ G+FL + GL
Sbjct: 219 GWRWCFLLQVPISLAGALIGHLYVRNQDEYERRKSKESSQTKEMLKHIDFSGAFLIIIGL 278

Query: 259 IM 260
            +
Sbjct: 279 TL 280

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 76/178 (42%), Gaps = 12/178 (6%)

Query: 73  PLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSL 132
           P    L ++     SQ    +  + L  G     SG + D YG +  +LGG  V V+ S+
Sbjct: 135 PALRQLEKEFHLNESQVNVTVVVYLLFQGIAPTFSGGLADRYGRRPIILGGMLVYVVASI 194

Query: 133 ICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAP- 191
             GL+  A +    +  R  Q +GI+  +   +G+V +      +      + +GA +  
Sbjct: 195 --GLAR-APSYGVIVFLRIVQSIGISPTIAISSGVVSDYTLKRERG-----TFVGATSGF 246

Query: 192 --IGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMD 247
             IG  +G L   +I    + W   F+   I    + LIA++++P+   T V    ++
Sbjct: 247 VLIGQGIGPLLGAVIAARWD-WRAIFWFLVIGCGTSMLIAFFLLPETKRTIVGNLSIE 303

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 49/241 (20%), Positives = 98/241 (40%), Gaps = 10/241 (4%)

Query: 1   MNSEYTPVSKQRTGSDISRKVVD--NHEDSDMLLASRSRLQNPDY--FDKQWKEYLFVIS 56
           + SE     K +    I +++    + E++ +  A+RS+ + P Y  F K+ +  +F++ 
Sbjct: 87  IESEEDIEKKSKEELKIEKRIATATSTEETSLKSANRSK-EPPPYTAFSKKQRLIIFLVI 145

Query: 57  SMLSXXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGL 116
            +              P   LL E     A+     ++ F  V     L      D  G 
Sbjct: 146 -IYVGFLGPLSGNIYIPALPLLQESFNVSATTINATVSVFMAVFSVGPLFWALFADFGGR 204

Query: 117 KKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNT 176
           K   +    + +I +++  LS+   N+      R  Q  G + V+    G V +I  P +
Sbjct: 205 KFLYIVSLLLTIIVNIL--LSAVPTNIGALFFLRIAQAFGSSSVMSLGIGTVSDITPPKS 262

Query: 177 KAKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDN 236
           + + + + M+G    +G  L  + +GLI   S  W W F    I++ +   +   ++P+ 
Sbjct: 263 RGRAVSYFMLGPN--MGPILAPIIAGLILMSSNNWRWLFGFICIISGIALFLVVLLLPET 320

Query: 237 I 237
           +
Sbjct: 321 L 321

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 75/172 (43%), Gaps = 12/172 (6%)

Query: 73  PLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSL 132
           P    L +      ++    +  + L  G    +SG + D+YG +  +LGG  + V+ S+
Sbjct: 112 PALKELEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASI 171

Query: 133 ICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAP- 191
             G++  A +    +  R  Q +GI+  +   +G+V +      +      + +GA +  
Sbjct: 172 --GIAK-APSYGVIVFLRCIQSIGISPTIAISSGVVSDFTVKRERG-----TFVGATSGL 223

Query: 192 --IGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNV 241
             IG  +G L   +I T +  W   F+  TI      +I ++++P+   T V
Sbjct: 224 VLIGQGIGPLLGAVI-TAALHWRAVFWFLTIGCGSCMIIGFFLLPETKRTIV 274

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 85  KASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVD 144
           +AS+  W+  ++ L + +   + GK  D+ G KK LL    V ++  ++CG    A  ++
Sbjct: 81  EASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCLLFAEVVFIVGLVMCG---AARTIE 137

Query: 145 FFIVARSFQGLG 156
             IVAR+  G+G
Sbjct: 138 ELIVARAICGVG 149

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 37.7 bits (86), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 40/200 (20%), Positives = 83/200 (41%), Gaps = 8/200 (4%)

Query: 18  SRKVVDNHEDS-DMLLASRSRLQNPDYFDKQWKEYLFVISSMLSXXXXXXXXXXXXPLFD 76
           S+++    E S   ++    ++ + D   K +  Y  + S  L+             + +
Sbjct: 9   SKELCTQAESSTSEVVEQNKKVVSQDQVVKGFALYACLGSLTLALFLSALDILIVSTIIE 68

Query: 77  LLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGL 136
            +S D   + S+  WL+  + L +    LV G+   I G K ++L    +  + SL+   
Sbjct: 69  TVSRDFN-EYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSLV--- 124

Query: 137 SSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATL 196
           S+ A++++  I  R   G+G + +      I+  +   N +++ M  S++     + + +
Sbjct: 125 SALANSMNMLIGGRVISGVGGSGLQTLCFLIISTLV--NERSRGMAISVLSCSFAVASIV 182

Query: 197 GCLFSGLIGTESEAWAWTFY 216
           G    G   T    W W FY
Sbjct: 183 GPFLGGAFTTH-VTWRWCFY 201

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 37.4 bits (85), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 81/196 (41%), Gaps = 18/196 (9%)

Query: 78  LSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLS 137
           L E  K   +  +W + S+ +    FI   G++GDI G          +  ++SL+C + 
Sbjct: 54  LGETYKLGYTGASWALTSYAITFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFSLLCAV- 112

Query: 138 SYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLG 197
               +   F V R+ QG+  A ++P    ++  + +P    K       G  + IG  +G
Sbjct: 113 --VRDFPTFAVFRALQGISAAGIVPCGYALIPLLAEPQDIQKFFSIVSCGFSSTIG--IG 168

Query: 198 CLFSGLIGTESEAWAWTFY---AYTIVAALNGLIAWYVIP---------DNIPTNVHKF- 244
            +  G        +A  FY   A  +V ++      Y I          ++IP +  K  
Sbjct: 169 LIVGGAFALTKVGYAGIFYLSFAGMLVVSIAASFYTYRIEERKFLEVKVEDIPHDHPKVA 228

Query: 245 KMDWLGSFLGVCGLIM 260
            +D++GS + V G ++
Sbjct: 229 SLDFVGSLIFVSGSVL 244

>ZYRO0G15422g Chr7 (1253872..1255500) [1629 bp, 542 aa] {ON} similar
           to uniprot|Q2UJ53 Aspergillus oryzae AO090003001353
           Synaptic vesicle transporter SVOP and related
           transporters and weakly similar to YBR008C
           uniprot|P38124 Saccharomyces cerevisiae YBR008C FLR1
           Plasma membrane multidrug transporter member of the
           major facilitator superfamily involved in efflux of
           fluconazole diazaborine benomyl methotrexate and other
           drugs
          Length = 542

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 9/112 (8%)

Query: 129 IWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVT-GIVGNIYKPNTKAKNMVFSMIG 187
           IW ++ G    A N    IVAR   GL  A    +VT G+V +++ P+     + + ++ 
Sbjct: 136 IWQILGG---KAPNFGAIIVARGLCGLSQAG--GSVTLGVVADLWDPSEHGYAVAYIVLA 190

Query: 188 ACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPT 239
           +    G+ LG +F GL+  E  +W W F+   I   ++ ++ ++++P+   T
Sbjct: 191 SVG--GSVLGPVFGGLM-QEHLSWHWNFWIQLIFNGVSQILHFFLVPETRAT 239

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 37.4 bits (85), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 59/130 (45%), Gaps = 6/130 (4%)

Query: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFF 146
           S+  W+ A + L S    L+ G++  + G K ++L    +  + SL+  L   A+++D  
Sbjct: 90  SKTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSLVAAL---ANSMDML 146

Query: 147 IVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGT 206
           I  R   GLG + +      I+  + + + +   ++ + +G+   I + +G    G   T
Sbjct: 147 IGGRVIAGLGGSGIQTLCFVIISTLVEESKRG--LLIACMGSAFGIASVVGPFLGGAFTT 204

Query: 207 ESEAWAWTFY 216
               W W F+
Sbjct: 205 HV-TWRWCFW 213

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 37.4 bits (85), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 85  KASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVD 144
           ++ ++ W+  SF L + +F  + GK+ DI G K  LL  +     + L C L+ +A NV 
Sbjct: 84  ESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHT---FFCLGCLLTCFARNVT 140

Query: 145 FFIVARS 151
            F +AR+
Sbjct: 141 EFSIARA 147

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 37.4 bits (85), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 42/196 (21%), Positives = 85/196 (43%), Gaps = 19/196 (9%)

Query: 22  VDNHEDSDMLLASRSRLQNPDYFDKQWKEYLF-------VISSMLSXXXXXXXXXXXXPL 74
           ++N +++  LL         D  ++++ E+         V+S  L              +
Sbjct: 1   MENLDETTGLLEQTPDTTEQDALEQEYHEHNLSLPKLPIVLSLWLGSFLSSLDGTIVANI 60

Query: 75  FDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLIC 134
            + ++E+ +    +Q W+  S+ L + +F  + GK+ D+ G K  +L  +     + L C
Sbjct: 61  MNRVAEEFQESDKKQ-WIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTAH---FFFGLGC 116

Query: 135 GLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKA-----KNMVFSMIGAC 189
            L+ +A++V  F +AR+  G+G   +    +  V +I     +       N+VF   G  
Sbjct: 117 LLTCFANSVTQFAIARAICGVGGGGINAMSSITVSDICTQRERGIYQGYANIVF---GLG 173

Query: 190 APIGATLGCLFSGLIG 205
             +GA +G LF   +G
Sbjct: 174 QILGAPIGGLFIDTLG 189

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 37.4 bits (85), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFF 146
           S+ +W+  S+ L S +F  + GKV DI+G K  L+      +I  L+CGLS    +  + 
Sbjct: 146 SKVSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLS---KSFWWL 202

Query: 147 IVARSFQGLG 156
           ++AR   G+G
Sbjct: 203 VIARFVAGVG 212

>Suva_12.245 Chr12 (391999..393774) [1776 bp, 591 aa] {ON} YAL067C
           (REAL)
          Length = 591

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 56/125 (44%), Gaps = 11/125 (8%)

Query: 125 AVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTG---IVGNIYKPNTKAKNM 181
           A+ + WSL+   ++Y ++V      R F G   AF  P+      + G+ YK +   +  
Sbjct: 207 ALDLSWSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGSFYKHDEMVRRS 263

Query: 182 VFSMIGACAPI---GATLGCLFSGLIGTESEA-WAWTFYAYTIVAALNGLIAWYVIPDNI 237
            F  +G    I   G     +FS L G    A W W F    IV+   G+I +YV+P + 
Sbjct: 264 AFYYLGQYLGILSAGGIQSAVFSSLNGVNGLAGWRWNFIIDAIVSVAVGIIGFYVLPGD- 322

Query: 238 PTNVH 242
           P N +
Sbjct: 323 PYNCY 327

>KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 566

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 70/175 (40%), Gaps = 11/175 (6%)

Query: 74  LFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLI 133
           +F L +  + A  S    + A  PL+  SF        D  G K   +    + V+ +++
Sbjct: 138 VFGLSATAINATVSVFMAVFAVGPLIWASF-------ADFGGRKILYMISLLMTVVVNVL 190

Query: 134 CGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIG 193
             L+S   NV      R  Q    + V+    G V +I  P  + K + + M+G    +G
Sbjct: 191 --LASVPVNVGALFTLRVVQAFASSSVMALGAGTVSDIRPPKVRGKAIAYFMLGP--NMG 246

Query: 194 ATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDW 248
             L  + +GLI      W W F    I++    L+   ++P+ +   V    + W
Sbjct: 247 PILAPIIAGLILMHGSYWRWLFGFTCILSGFGLLMVVVLLPETLRCIVGNGDIKW 301

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 76/181 (41%), Gaps = 17/181 (9%)

Query: 74  LFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLI 133
           L   ++ DL A +SQ +W+  ++ L   +F  + GK+ DI+G K  L+       +   I
Sbjct: 64  LLPTIASDLDA-SSQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAI 122

Query: 134 CGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKA-----KNMVFSMIGA 188
           CG S + +NV      R   G+G        T    +I     +       N+ FS+   
Sbjct: 123 CG-SPWTNNVWVLSTGRFVAGIGGGGQATLSTITTSDIIPLRKRGVYQGLVNICFSL--G 179

Query: 189 CAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDW 248
           CA  G+ LG +    IG     W W F     +A +  L+   V+  ++P +     + W
Sbjct: 180 CAS-GSVLGAVLQQGIG-----WRWAFLVQVPMALVCALMIAVVL--DLPADSPGRGLLW 231

Query: 249 L 249
           L
Sbjct: 232 L 232

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 85  KASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVD 144
           +AS   W+  ++ L + +   + GK+ DI G +K LL G  +  +  L+C   ++A+ + 
Sbjct: 93  QASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEVIFALGVLLC---NFANTIP 149

Query: 145 FFIVARSFQGLG 156
              +AR+  G+G
Sbjct: 150 QLAIARAICGIG 161

>NCAS0B02010 Chr2 (328296..329888) [1593 bp, 530 aa] {ON} Anc_8.570
          Length = 530

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 71/176 (40%), Gaps = 4/176 (2%)

Query: 73  PLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSL 132
           P    L +D    ++     ++ F  V     L  G   D+ G K   +    ++VI ++
Sbjct: 90  PALPTLQKDFNVSSTVINATVSVFMAVFAVGPLFWGLFADVGGRKVLYICSILLMVIVNI 149

Query: 133 ICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPI 192
           +  L+S   ++    V R  Q  G + V+    G V +I  P  + + + + MIG    +
Sbjct: 150 L--LASIPAHISSLFVLRIVQAFGSSSVITLGAGTVTDITPPKQRGRAIGYFMIGP--NM 205

Query: 193 GATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDW 248
           G  L  + +GLI  +   W W F    I+  +  L+    +P+ +   V      W
Sbjct: 206 GPVLAPIIAGLILMKGNYWRWLFGLTGIMGGVGLLLIVAFLPETLRCIVGNADPGW 261

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 3/72 (4%)

Query: 85  KASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVD 144
           +AS   W+  ++ L + S   + GK  D+ G KK LL    V +I  ++CG+   A  V 
Sbjct: 84  EASLVTWVATAYMLTTCSVQPLYGKTSDLLGRKKCLLFAEVVFIIGLVLCGM---ARTVK 140

Query: 145 FFIVARSFQGLG 156
              +AR+  G+G
Sbjct: 141 ELAIARAICGIG 152

>YBR180W Chr2 (589741..591459) [1719 bp, 572 aa] {ON}  DTR1Putative
           dityrosine transporter, required for spore wall
           synthesis; expressed during sporulation; member of the
           major facilitator superfamily (DHA1 family) of multidrug
           resistance transporters
          Length = 572

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 51/262 (19%), Positives = 102/262 (38%), Gaps = 32/262 (12%)

Query: 1   MNSEYTPVSKQRTGSDISRKVVDNHEDSDMLLA-----------------SRSRLQNPD- 42
           +N  +  V+++R  ++I   V   H DS   L+                 S+SR  +PD 
Sbjct: 38  INESWDQVNQKR--ANIDHDVFHEHPDSSPSLSAQKAKTKEEEVAVKSSNSQSRDPSPDT 95

Query: 43  -------YFDKQWKEYLFVISSMLSXXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMAS 95
                  YF K  +  +     +              P   LL  +    A+     ++ 
Sbjct: 96  QAHIPYTYFSKD-QRLIIFGIIIFIGFLGPMSGNIYIPALPLLQREYDVSATTINATVSV 154

Query: 96  FPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGL 155
           F  V     L  G + D  G K   +   ++++I +++  L++   N+    V R FQ  
Sbjct: 155 FMAVFSVGPLFWGALADFGGRKFLYMVSLSLMLIVNIL--LAAVPVNIAALFVLRIFQAF 212

Query: 156 GIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTF 215
             + V+    G V ++  P  + K + + M+G    +G  +  + +GLI  +   W W F
Sbjct: 213 ASSSVISLGAGTVTDVVPPKHRGKAIAYFMMGPN--MGPIIAPIVAGLILMKGNYWRWLF 270

Query: 216 YAYTIVAALNGLIAWYVIPDNI 237
              +I+  +  ++   ++P+ +
Sbjct: 271 GFTSIMTGIALILVTALLPETL 292

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/130 (23%), Positives = 62/130 (47%), Gaps = 6/130 (4%)

Query: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFF 146
           S+  WL   + L +    L+ G++    G K+T+L    +  I SLI   S+ A+++   
Sbjct: 102 SEIGWLFTGYSLPNALLALIWGRIATPIGFKETMLFAIVIFEIGSLI---SALANSMSML 158

Query: 147 IVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGT 206
           I  R   G+G    + +++ ++G+     ++ + ++ +++     I + +G    G+  T
Sbjct: 159 IGGRVIAGVG-GCGIQSLSFVIGSTLVEESQ-RGILIAVLSCSFAIASVVGPFLGGVF-T 215

Query: 207 ESEAWAWTFY 216
            S  W W FY
Sbjct: 216 SSVTWRWCFY 225

>Ecym_7063 Chr7 complement(130980..132842) [1863 bp, 620 aa] {ON}
           similar to Ashbya gossypii AGR195W
          Length = 620

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 48/113 (42%), Gaps = 2/113 (1%)

Query: 136 LSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGAT 195
           L+S   N+      R  Q    + V+    G V +I  P  + K + + M+G  A  G  
Sbjct: 245 LASIPTNIGALYFLRIAQAFASSSVISLGAGTVSDITSPKDRGKAVAYFMLGPNA--GPV 302

Query: 196 LGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDW 248
           L  + +G+I    + W W F   +I+A +  ++    +P+ +   V    + W
Sbjct: 303 LAPIIAGIILMNGDNWRWLFGFTSIMAGVGFMLVCLFLPETLRCIVGNGDLRW 355

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 39/68 (57%), Gaps = 3/68 (4%)

Query: 84  AKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNV 143
           A++ ++ W+  S+ L + +F  + GK+ DI G K  ++  +     ++L C L+ +A NV
Sbjct: 74  AESDKKQWIATSYLLTNTAFQPLYGKLSDITGRKVAVITAH---FFFALGCLLTCFAQNV 130

Query: 144 DFFIVARS 151
             F +AR+
Sbjct: 131 TQFSIARA 138

>Skud_2.306 Chr2 (557166..558884) [1719 bp, 572 aa] {ON} YBR180W
           (REAL)
          Length = 572

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 45/246 (18%), Positives = 98/246 (39%), Gaps = 16/246 (6%)

Query: 2   NSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQN--PD--------YFDKQWKEY 51
            SE  P  +  +   IS + ++  E+   + +S S+ +N  P+        YF K  +  
Sbjct: 53  KSEIVP-EQSHSSPSISAQKINTKEEEIAIRSSNSQSKNLSPEPKADIPYTYFSKD-RRL 110

Query: 52  LFVISSMLSXXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVG 111
           +     +              P   LL  +    ++     +++F  V     L  G + 
Sbjct: 111 VIFGIIIFIGFLGPMSGNIYIPALPLLQREFDVSSTTINATVSAFMAVFSVGPLFWGALA 170

Query: 112 DIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNI 171
           D  G K   +   ++++  +++  L++   N+    V R FQ    + V+    G V ++
Sbjct: 171 DFGGRKFLYMVSLSLMLTVNIL--LAAVPANIAALFVLRVFQAFSSSSVISLGAGTVTDV 228

Query: 172 YKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWY 231
             P  + K + + M+G    +G  +  + +GLI  +   W W F   +I+  +  ++   
Sbjct: 229 VPPKHRGKAIAYFMMGPN--MGPIIAPIVAGLILMKGNYWRWLFGFTSIMTGIALILVSA 286

Query: 232 VIPDNI 237
            +P+ +
Sbjct: 287 FLPETL 292

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 34/170 (20%), Positives = 69/170 (40%), Gaps = 5/170 (2%)

Query: 48  WKEYLFVISSMLSXXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVS 107
           +K++LF++S+  S                 +S D      Q  W +    ++     ++ 
Sbjct: 71  YKQWLFILSAFASFTWEAFDFFTVTLNVKKISHDFDVTTKQVTWGITLVLMLRVVGAVLF 130

Query: 108 GKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGI 167
           G +GD YG K + +     +++  +I G     HN  +F++AR+F G+ +  +  N    
Sbjct: 131 GYIGDRYGRKVSFIINLFFMMVLEIITGF--IKHNFKYFLIARAFFGVVLGGIFGNSAAQ 188

Query: 168 VGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFS-GLIGTESEAWAWTFY 216
             +   P  +A + +         +G  L  +F+  L  T  + W   F+
Sbjct: 189 CFDDCPP--EAHSFISGFFQQGYTLGYLLAVIFTRALADTTKDRWRSCFW 236

>KLLA0B06798g Chr2 (596500..598491) [1992 bp, 663 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 663

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 64/145 (44%), Gaps = 19/145 (13%)

Query: 96  FPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGL 155
           FP+   S   + G+   +Y L  TLL  + +          S+ + N+  FIV R  QG 
Sbjct: 162 FPIWWSSLSEIEGR-RTVYVLSFTLLTAFTIG---------SALSPNISAFIVFRMLQGA 211

Query: 156 GIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGT-ESEAWAW- 213
             A V     G + +++ P  + KN+ +  +G        +  L S +IG      W+W 
Sbjct: 212 SSASVQSVGAGTISDLFIPEERGKNLGYYYLGTL------MAPLLSPIIGALLVNRWSWR 265

Query: 214 -TFYAYTIVAALNGLIAWYVIPDNI 237
            T +   I+A +N L+   ++P+ +
Sbjct: 266 STQWFMVILAVVNVLLFTLLLPETL 290

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 62/140 (44%), Gaps = 14/140 (10%)

Query: 106 VSGKVGDIYGLKKTLLGGYAVVVIWSL-ICGLSSYAHNVDFFIVARSFQGLGIAFVLPNV 164
           VSG + DIYG +  +L G  V V+ S+ I   +SY       I  R  Q  GI+ ++   
Sbjct: 153 VSGGLADIYGRRPVILFGMLVYVVASIGIAACNSYG----VIIFLRCLQSTGISPLIAIS 208

Query: 165 TGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEA---WAWTFYAYTIV 221
           +G VG+      KA+   F  +GA + +   +G  F  LIG    A   W   F+   I 
Sbjct: 209 SGAVGDF---TVKAERGTF--VGAVSGL-VLMGQAFGSLIGAALAAAYNWRAIFWFLAIG 262

Query: 222 AALNGLIAWYVIPDNIPTNV 241
                 IA  V+P+   T V
Sbjct: 263 CGACMAIAGIVLPETKRTLV 282

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 84/216 (38%), Gaps = 21/216 (9%)

Query: 10  KQRTGSD---ISRKVVDNHEDSDMLLA-SRSRLQNPDYFD-------KQWKEYLFVISSM 58
           ++R GSD   + R   D   D+D   + S S + N   FD          ++ L V+   
Sbjct: 17  EEREGSDNNNVDRSSSDAISDNDAERSNSHSEIDNESNFDMVPYSRFSHKQKMLLVVQCA 76

Query: 59  LSXXXXXXXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKK 118
            +            P+  ++              +  + +  G    + G + D +G + 
Sbjct: 77  FTGFFSTVAGSIYYPVLTIIERKFNITEELANVTIVVYFIFQGVAPSIMGGLADTFGRRP 136

Query: 119 TLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKA 178
            +L  +A++  +    GL+  AHN    +  R  Q  GI+ V+   +GI+G++    TK 
Sbjct: 137 IVL--WAILAYFCACIGLAC-AHNYAQILALRCLQAAGISPVIAINSGIMGDV---TTKV 190

Query: 179 KNMVFSMIGACAPIGATLGCLFSGLIGTE-SEAWAW 213
           +   +  +G  A     +G  F  LIG   S  W W
Sbjct: 191 ERGGY--VGLVAGF-QVVGTAFGALIGAGLSSKWGW 223

>TDEL0C02370 Chr3 (416622..418817) [2196 bp, 731 aa] {ON} Anc_7.309
           YDL194W
          Length = 731

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 46/85 (54%), Gaps = 5/85 (5%)

Query: 78  LSEDLKAKASQQAWLMASFPLVSGSFI--LVSGKVGDIYGLKKTLLGGYAVVVIWSLICG 135
           L+ D +  ++++  ++ SF L  G+FI  L +  + D YG K T++  ++ VV++ +   
Sbjct: 132 LAPDHEGFSAREMAIIVSF-LSLGTFIGALSAPLLSDSYGRKATII--FSTVVVFLIGNS 188

Query: 136 LSSYAHNVDFFIVARSFQGLGIAFV 160
           L   AH+V   I  R   GLGI  +
Sbjct: 189 LQVAAHSVKLLIAGRVISGLGIGLI 213

>NDAI0C05670 Chr3 complement(1310115..1311617) [1503 bp, 500 aa]
           {ON} Anc_8.570
          Length = 500

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 51/114 (44%), Gaps = 4/114 (3%)

Query: 136 LSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGAT 195
           L++   ++      R  Q  G + V+    G V +I  P  + K + + M+G    IG  
Sbjct: 115 LAAVPSHIGALFAMRVVQAFGSSSVITLGAGTVTDITPPKHRGKAIAYFMMGP--NIGPV 172

Query: 196 LGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYV-IPDNIPTNVHKFKMDW 248
           +  + +GLI  + + W W F  +T + +  GL A  + +P+ +   V  +   W
Sbjct: 173 IAPIIAGLILMKGDYWRWLF-GFTAIMSGIGLFAIIIFLPETLRCIVGNYDPRW 225

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 35.0 bits (79), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 43/78 (55%), Gaps = 4/78 (5%)

Query: 74  LFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLI 133
           + + ++E+ +    +Q W+  SF L + +F  + GK+ DI G +  LL  +     + L 
Sbjct: 56  IMNRVAEEFEESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRRFALLTAH---FFFGLG 111

Query: 134 CGLSSYAHNVDFFIVARS 151
           C L+ +A +V+ F +AR+
Sbjct: 112 CLLTCFAQSVEQFALARA 129

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 35.0 bits (79), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 69/141 (48%), Gaps = 16/141 (11%)

Query: 106 VSGKVGDIYGLKKTLLGGYAVVVIWSLICGLS-SYAHNVDFFIVARSFQGLGIAFVLPNV 164
           +SG + D+YG +  +L G  + V  S+  GL+ S ++ V  F+  R  Q  GI+ ++   
Sbjct: 141 ISGGLADVYGRRPVILMGMLIYVCASI--GLACSQSYGVIVFL--RCLQSAGISPIIAIN 196

Query: 165 TGIVGNIYKPNTKAKNMVFSMIGACAPIGATL-GCLFSGLIG---TESEAWAWTFYAYTI 220
           +G+VG+    + +      + +GA +  G TL G  F  LIG   T +  W   F+  TI
Sbjct: 197 SGVVGDFTLKHERG-----TFVGAVS--GFTLMGQAFGSLIGAALTAAFDWRAIFWFLTI 249

Query: 221 VAALNGLIAWYVIPDNIPTNV 241
                 +I + ++P+   T V
Sbjct: 250 GCGTCMIINFLILPETKRTLV 270

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 90  AWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLS 137
           +W+  ++ L S +F  + GK+ DI+G K  L+    +  +  LICGLS
Sbjct: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS 214

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 49/184 (26%), Positives = 83/184 (45%), Gaps = 22/184 (11%)

Query: 296 EARFAKEPLLPRAVLFNRKLMMILASLFLGWGS-FGIWTYYYM-----AFVLNLRHYTPL 349
           E   +K+P+LP A L NR    IL S    W S  G+ T  Y      A VLN++   P 
Sbjct: 382 ETYVSKDPILPVAFLKNR---TILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMK---PT 435

Query: 350 WAGG----SYFMFAIFGTIAAFLVGHTIHKTGPAIILLASVIAFD-VGCIMLSVTPVDQT 404
             G     S+F  A+ G++ A   G+ + KTG    LL +  A   VG + +S+   +  
Sbjct: 436 DMGKRTIPSFFSTAL-GSLGA---GYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIA 491

Query: 405 YFRMSLGTMVILSFGMDLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGT 464
            +R  +  +VI  FG+ +    + + +   +P ++Q    S+     +   +L + + G 
Sbjct: 492 VWRQYI-LLVIPGFGLSVLITVTLLAMIAAVPHEHQAATTSISYAFRSTGCTLGVSIGGA 550

Query: 465 AERQ 468
             R+
Sbjct: 551 IFRK 554

>Ecym_7258 Chr7 complement(543654..545570) [1917 bp, 638 aa] {ON}
           similar to Ashbya gossypii AGL069C
          Length = 638

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 73/165 (44%), Gaps = 12/165 (7%)

Query: 75  FDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLIC 134
           F  LS +L+   SQ ++L+    L  G   + +     ++G +   L G  + +I S+ C
Sbjct: 139 FSKLSAELQVPLSQISYLVGPMMLSLGVGSIFASPTAVLFGKRLVYLVGILIFMIGSIGC 198

Query: 135 GLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNM---VFSMIGACAP 191
             S+   + ++ +++R   G G++ V    +  +  IY  + +A  +      ++G    
Sbjct: 199 ACST---SFNWLLISRVVSGFGLSTVESLPSATIAEIYFAHERAYRLGIYTLLLLG---- 251

Query: 192 IGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDN 236
            G  L  L   L+  E  +  W F+  TI+A  N ++    +P+ 
Sbjct: 252 -GKNLVPLLGSLV-FEHLSTHWLFWILTIIAGSNFVLHLLFVPET 294

>Kwal_27.12173 s27 complement(1120952..1122655) [1704 bp, 567 aa]
           {ON} YBR180W (DTR1) - dityrosine transporter MFS-MDR
           [contig 22] FULL
          Length = 567

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 76/185 (41%), Gaps = 13/185 (7%)

Query: 74  LFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLI 133
           +F + S  + A  S    + A  PL+  SF        D  G K   +    + VI +++
Sbjct: 140 IFGVSSTTINATVSVFMAVFAVGPLIWASF-------ADFGGRKILYMISLLLTVIVNVL 192

Query: 134 CGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIG 193
             L++   N       R  Q    + V+    G V +I  P  + K + + M+G    +G
Sbjct: 193 --LAAVPVNTGALFFLRVMQAFASSSVMALGAGTVSDIRPPQVRGKAIAYFMLGPN--MG 248

Query: 194 ATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYV-IPDNIPTNVHKFKMDWLGSF 252
             L  + +GLI      W W F   +I++ + GLIA  V +P+ +   V      W+ + 
Sbjct: 249 PILAPIIAGLILMRGSYWRWLFGFTSILSGI-GLIAVIVFLPETLRCIVGNGDPKWIDTE 307

Query: 253 LGVCG 257
             V G
Sbjct: 308 DEVVG 312

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 36/70 (51%), Gaps = 3/70 (4%)

Query: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFF 146
           S  +W+  ++ L S +F  + GK+ DI+G +  ++      ++  LICGLS    N+   
Sbjct: 96  SHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGCLICGLS---KNLWTL 152

Query: 147 IVARSFQGLG 156
           +  R   G+G
Sbjct: 153 VAGRFIAGIG 162

>TBLA0C01100 Chr3 (227542..229491) [1950 bp, 649 aa] {ON} Anc_1.432
          Length = 649

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 55/144 (38%), Gaps = 28/144 (19%)

Query: 105 LVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAF----- 159
           L+S  V D  G K +L   +   ++W + CG+ S +  V   +V R   G+GI F     
Sbjct: 83  LLSPSVSDALGRKCSL---HVSCILWCIGCGIQSGSTGVAMLVVGRVIAGVGIGFGVAAA 139

Query: 160 -------VLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWA 212
                    P V G V  I++    A  +V   IG         GC F       S A  
Sbjct: 140 PMYCVELAPPRVRGTVVGIFQLAVTAGILVLFFIG--------YGCSF-----LHSTAVF 186

Query: 213 WTFYAYTIVAALNGLIAWYVIPDN 236
              +A  IV  +      + IP++
Sbjct: 187 RVTWALQIVPGIAAFFLIFFIPES 210

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 59/126 (46%), Gaps = 6/126 (4%)

Query: 91  WLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVAR 150
           WL+  + L S  F L+ G++  + GLK  L+    +  I SLI  +S   +++   I  R
Sbjct: 82  WLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAVS---NSMGMLIAGR 138

Query: 151 SFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEA 210
              G G + +  ++  IVG     + +++ MV  M+   A +G+  G    G    E  +
Sbjct: 139 VVAGAGGSGI-QSLVYIVGTSLV-SERSRGMVI-MVLTFAFVGSNAGGPILGGALNEHAS 195

Query: 211 WAWTFY 216
           W W F+
Sbjct: 196 WRWCFF 201

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 63/131 (48%), Gaps = 8/131 (6%)

Query: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFF 146
           S+  WL   + L +    L+ G++    G K+T+L    +  + SLI   S+ A++++  
Sbjct: 111 SEIGWLFTGYSLPNALLALIWGRIATPIGFKRTMLFAIVIFEVGSLI---SALANSMNVL 167

Query: 147 IVARSFQGLGIAFVLPNVTGIVG-NIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIG 205
           I  R   G+G    + +++ ++G N+ + + +    V   I +C+   A++   F G + 
Sbjct: 168 IGGRVIAGVG-GCGIQSLSFVIGSNLVEESNRG---VLIAILSCSFAIASVVGPFLGGVF 223

Query: 206 TESEAWAWTFY 216
           T    W W FY
Sbjct: 224 TSRVTWRWCFY 234

>TBLA0B04640 Chr2 complement(1082147..1083595) [1449 bp, 482 aa]
           {ON} Anc_6.155 YBR241C
          Length = 482

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 66/150 (44%), Gaps = 17/150 (11%)

Query: 87  SQQAWLMASFPL--VSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVD 144
           +Q  W+ + F L  + GSF   +G   D YG KK  +    VV I SL+     Y++   
Sbjct: 74  TQIGWITSIFSLGGLLGSFY--AGSWADHYGRKKVSIASSVVVTIGSLVL---FYSNTYL 128

Query: 145 FFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLI 204
             ++ R+  G+     L     ++  +Y  N  A       +GA   +   LG L + L+
Sbjct: 129 QLLIGRTIVGIACGVYL-----VITPLYI-NEIAPAQHRGALGAMNQVAINLGILLTQLL 182

Query: 205 G---TESEAWAWTFYAYTIVAALNGLIAWY 231
               T+S  W W F+A  ++  L  L+ W+
Sbjct: 183 ALRYTDSFRWRWLFFAGVVLGLLT-LVMWW 211

>KAFR0I00710 Chr9 (139612..141339) [1728 bp, 575 aa] {ON} Anc_8.570
           YBR180W
          Length = 575

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 47/113 (41%), Gaps = 2/113 (1%)

Query: 136 LSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGAT 195
           LS    N+    V R  Q    + V+    G + +I  P  + K + + MIG    +G  
Sbjct: 180 LSVLPTNIAALFVLRILQAFSSSSVITLGAGTITDITPPKHRGKAIGYFMIGPN--MGPI 237

Query: 196 LGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVHKFKMDW 248
           +  + +GLI  +   W W F   +I++ +  ++    +P+ +   V      W
Sbjct: 238 VAPIIAGLILMKGNYWRWLFGFTSIMSGVAFIVVLIFLPETLRCKVGNGDPGW 290

>ZYRO0A03564g Chr1 (283783..285837) [2055 bp, 684 aa] {ON} similar
           to YBR043C, uniprot|P38227 Saccharomyces cerevisiae
           YBR043C (QDR3)
          Length = 684

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 73/168 (43%), Gaps = 12/168 (7%)

Query: 73  PLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSL 132
           P  D + ED K  +      +  + +  G F L    + ++ G +   +  + +++ +++
Sbjct: 145 PAIDPIKEDYKTTSIMVNVSVGVYQISLGVFPLWWSSISEMNGRRTVYVLSFLLLLAFNV 204

Query: 133 ICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNM-VFSMIGACAP 191
             GLS    N++ FI+ R   G   A V     G V ++Y P  +  N+ ++ M    AP
Sbjct: 205 GTGLSP---NINDFIILRVLSGGAAASVQSVGAGTVADLYVPEERGTNIGIYYMGPLMAP 261

Query: 192 IGATL--GCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNI 237
           + + +    L SG        W  T +   I++ +N ++    +P+ +
Sbjct: 262 LVSPIIGAALVSGF------PWKSTQWFMVILSGVNVILLVLFLPETL 303

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 43/99 (43%), Gaps = 5/99 (5%)

Query: 78  LSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTL-LGGYAVVVIWSLICGL 136
           L E    + +  +W + S+ +     I   G++GDI G      + G+     +SL C L
Sbjct: 58  LGETYGLEYTTASWALTSYAITFAGLIAFMGRLGDIIGNSVLFTISGF----FFSLFCLL 113

Query: 137 SSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPN 175
            +   N   F V R+ QG+  A ++P    ++  +  P 
Sbjct: 114 CAVVTNFPAFAVLRALQGIAAAGLVPCGYALIPTLADPE 152

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 66/136 (48%), Gaps = 16/136 (11%)

Query: 106 VSGKVGDIYGLKKTLLGGYAVVVIWSLICGLS-SYAHNVDFFIVARSFQGLGIAFVLPNV 164
           +SG + D+YG +  +L G  + V  S+  GL+ S ++ V  F+  R  Q  GI+ ++   
Sbjct: 141 ISGGLADVYGRRPVILIGMLIYVCASI--GLACSNSYGVIVFL--RCLQSAGISPIIAIN 196

Query: 165 TGIVGNIYKPNTKAKNMVFSMIGACAPIGATL-GCLFSGLIG---TESEAWAWTFYAYTI 220
           +G+VG+      +      + +GA +  G TL G  F  LIG   T +  W   F+  TI
Sbjct: 197 SGVVGDFTVKQERG-----TFVGAVS--GFTLMGQAFGSLIGAALTAAFDWRAIFWFLTI 249

Query: 221 VAALNGLIAWYVIPDN 236
                 L+ + ++P+ 
Sbjct: 250 GCGTCMLVNFLLLPET 265

>KLLA0D11330g Chr4 (970243..971808) [1566 bp, 521 aa] {ON} similar
           to uniprot|P15365 Saccharomyces cerevisiae YJR152W DAL5
           Allantoin permease ureidosuccinate permease expression
           is constitutive but sensitive to nitrogen catabolite
           repression
          Length = 521

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 56/122 (45%), Gaps = 14/122 (11%)

Query: 127 VVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMI 186
           +VIW +I  L   A +   F + R+  G+  AFV P    ++   YK     K+  F  I
Sbjct: 147 IVIWGVIQCLHVTAKSYATFTLLRTLLGVLEAFVSPIFVIMMNQYYK-----KSEHFGYI 201

Query: 187 GA---CAPIGAT-LGCLFSGL---IGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIP 238
           G    C  +G   L C+  GL   +G+ + EA+   F     +   NGL+  +++P N P
Sbjct: 202 GVLYGCNGLGTVILACISYGLYHNLGSYTMEAYKVLFIIVGCLTIFNGLLILFIMP-NTP 260

Query: 239 TN 240
            +
Sbjct: 261 AD 262

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 60/152 (39%), Gaps = 6/152 (3%)

Query: 85  KASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVD 144
           + S  +W+  ++ + S SF  + G   D  G +  L    AV  I  L C  S+  + + 
Sbjct: 91  QMSISSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAVFTIGCLACSFSTNIYMLS 150

Query: 145 FFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLI 204
           F               L  ++ IV +   P++K + +  +        GA  G  F G I
Sbjct: 151 FM----RALAGIGGGGLITLSTIVNSDVIPSSK-RGIFQAFQNLLLGFGAICGASFGGTI 205

Query: 205 GTESEAWAWTFYAYTIVAALNGLIAWYVIPDN 236
            T +  W W F     ++ +  L+  Y +P+ 
Sbjct: 206 -TSTIGWRWCFLIQVPISMIASLLMNYYVPNQ 236

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/164 (21%), Positives = 72/164 (43%), Gaps = 11/164 (6%)

Query: 87  SQQAWLMASFPLVSGSFILVSGKVG-DIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDF 145
           ++  W++A + L +    L+ G++     G K  +L    +  I SLIC L   A+++D 
Sbjct: 93  AKTGWIIAGYSLPNALMSLLWGRIAFSFLGFKTAMLSAIVIFEIGSLICAL---ANSMDM 149

Query: 146 FIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIG 205
            I  R   G+G + +  +++ ++G+    + + +  + + + A   I + +G    G   
Sbjct: 150 LIGGRVIAGIGGSGI-QSLSFVIGSTL-VSPRGRGFIIAFMSASFGIASVIGPFIGGAF- 206

Query: 206 TESEAWAWTFYAYTIVAALNGLI-AWYVIP---DNIPTNVHKFK 245
           T    W W F+    V A+  +I  W   P     +   +H  K
Sbjct: 207 TSHVTWRWCFWINLPVGAVALVIFTWVYNPTGKKQVLLTIHDLK 250

>KLTH0C08074g Chr3 (688367..690295) [1929 bp, 642 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS- MDR)
          Length = 642

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 50/105 (47%), Gaps = 12/105 (11%)

Query: 127 VVIWSLICGL---SSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVF 183
           V+ +SL+C     S+ A N+  FIV R   G   A V     G V +++KP  + K + +
Sbjct: 162 VLSFSLLCAFCVGSALAPNIQAFIVFRMLCGACSASVQSVGAGTVADLFKPEDRGKMLGY 221

Query: 184 SMIGACAPIGATLGCLFSGLIGT-ESEAWAW--TFYAYTIVAALN 225
             +GA       +  L + +IG+     W+W  T +   I+A +N
Sbjct: 222 YYLGAL------MAPLLAPIIGSLLVSRWSWRSTQWFMVILAGVN 260

>NCAS0D04970 Chr4 (952902..954650) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 51/120 (42%), Gaps = 11/120 (9%)

Query: 130 WSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTG---IVGNIYKPNTKAKNMVFSMI 186
           WSL+   ++Y ++V      R F G    F  P+      + G  YK +   +   F  +
Sbjct: 210 WSLLTIGAAYVNSVPHLKAIRFFIG---GFEAPSYLAYQYLFGCFYKHDEMVRRSAFYYL 266

Query: 187 GACAPI---GATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNVH 242
           G    I   G     ++S L G      W W+F    I++   G++ +YV+P + P N +
Sbjct: 267 GQYVGILSSGGIQSAVYSNLDGRNGLSGWRWSFIIDAIISVFVGILGFYVLPGD-PDNCY 325

>Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {ON}
           YNR055C (HOL1) - Putative ion transporter similar to the
           major facilitator superfamily of transporters [contig
           55] FULL
          Length = 612

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 33/160 (20%), Positives = 72/160 (45%), Gaps = 8/160 (5%)

Query: 78  LSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLS 137
           L+E+     S  ++L+    L      +++     ++G +   L G  V    S+ C +S
Sbjct: 105 LAEEFNRSLSDISYLVGGMMLALAFGSIIASPSAVLFGKRILYLIGIIVFFFGSIGCSVS 164

Query: 138 SYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNM-VFSMIGACAPIGATL 196
              H+ +  + +R   GLG+A +    +  V  IY  + +A  + V++++      G  L
Sbjct: 165 ---HSYESLLASRIVSGLGVATIESLPSATVAEIYFAHERAYRLGVYTLLLLG---GKNL 218

Query: 197 GCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDN 236
             L + L+    + + W F+  TI+  +N ++  + +P+ 
Sbjct: 219 VPLLASLVFQSLDRY-WLFWIVTIIVGINFVLHLFFVPET 257

>SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 667

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 52/114 (45%), Gaps = 11/114 (9%)

Query: 134 CGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGA-CAPI 192
           C  ++ + N+  FI+ R   G   A V     G + ++Y P  + KN+ +  +GA  AP 
Sbjct: 179 CIGTAVSPNIQAFIILRVLCGASSASVQSVGAGTIADLYAPEERGKNLGYFYLGALTAP- 237

Query: 193 GATLGCLFSGLIGT-ESEAWAW--TFYAYTIVAALNGLIAWYVIPDNIPTNVHK 243
                 L S +IG+     W+W  T +   I+A  N ++    +P+ +    +K
Sbjct: 238 ------LLSPIIGSLLVNHWSWRSTQWFMVILAGANVILIVLFLPETLRLQENK 285

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 44/218 (20%), Positives = 84/218 (38%), Gaps = 37/218 (16%)

Query: 74  LFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLI 133
           + D+++E      S+  WL+  + L +    LV G+   I G + +L+    +    SL+
Sbjct: 58  IIDVVAEQF-GNYSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSLV 116

Query: 134 CGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIG 193
             L++  +     ++            L  +  ++G     N +++ +V S++     + 
Sbjct: 117 AALANSMN----MLIVGRVVAGVGGSGLQTLCFVIG-CTMVNERSRPLVISILSCAFAVA 171

Query: 194 ATLGCLFSGLIGTESEAWAWTFYAYTIV---AALNGLIAWYVIPDNI------------- 237
           A +G +  G   T    W W FY    +   A +  L+ +    +NI             
Sbjct: 172 AIVGPIIGGAFTTHV-TWRWCFYINLPIGGFAVIMFLLTYKTKSENILQQTRNILGRISK 230

Query: 238 --------PTNVHK------FKMDWLGSFLGVCGLIMF 261
                   P N+ K      FK D+LG  L   GL++F
Sbjct: 231 FELRRLTEPGNLRKALIGILFKFDFLGFALSSAGLVLF 268

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 58/127 (45%), Gaps = 8/127 (6%)

Query: 91  WLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVAR 150
           WL+  + L +  F+L+ G++ +I G K+ L+    V  I SLI  LS+    +    V  
Sbjct: 47  WLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVA 106

Query: 151 SFQGLGIAFVLPNVTGIVG-NIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESE 209
            F G GI     ++  +VG +I + N +   ++ + +     I   +G    G    E  
Sbjct: 107 GFGGSGI----ESLAFVVGTSIVRENHRG--IMITALAISYVIAEGVGPFIGGAF-NEHL 159

Query: 210 AWAWTFY 216
           +W W FY
Sbjct: 160 SWRWCFY 166

>Smik_19.10 Chr19 complement(12270..13901) [1632 bp, 543 aa] {ON}
           YJR152W (REAL)
          Length = 543

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 72/171 (42%), Gaps = 21/171 (12%)

Query: 78  LSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIY---GLKKTLLGGYAVVVIWSLIC 134
           L  DLK    Q +W+ ++F    G   +  G +  I+        +LGG+  +VIW L+ 
Sbjct: 111 LRTDLKMHGDQYSWVTSAFYF--GYLFMNLGPIQFIFQRTSYMSKMLGGF--IVIWGLLL 166

Query: 135 GLSSYAHNVDF--FIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMV--FSMIGACA 190
            L + A  V +  FI+ R   G   + V P  T I    +K   +   +   F M G   
Sbjct: 167 ALHA-APTVKYPTFILLRVLLGCAESVVTPCFTIITAQYWKSEEQFTRVSIWFGMNG--- 222

Query: 191 PIGATL--GCLFSGLIGTES---EAWAWTFYAYTIVAALNGLIAWYVIPDN 236
            +G+ L     +   I  +S   EAW   F    ++    G++ +  IPD+
Sbjct: 223 -LGSVLINAIAYGVYIHRDSYAIEAWKTLFVVTGVITIFVGILIYLWIPDD 272

>Kwal_56.24353 s56 (964777..966525) [1749 bp, 582 aa] {ON} YAL067C
           (SEO1) - putative permease [contig 163] FULL
          Length = 582

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 54/122 (44%), Gaps = 5/122 (4%)

Query: 125 AVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFS 184
           A+ + WS++   ++    V    V R F G+  A        + G+ YK +   +   F 
Sbjct: 206 ALDICWSILTIGAAKVDTVPHLKVIRFFIGVFEAPAYLAYQYLFGSFYKHDEMVRRSAFY 265

Query: 185 MIGACAPIGATLG---CLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTN 240
            +G  A I +  G    +++ L G      W W F    +++ + G+I +YV+P + P N
Sbjct: 266 YLGQYAGILSASGLQSAIYAVLDGKRGLSGWRWNFIIDGVISVVVGIIGFYVLPGD-PYN 324

Query: 241 VH 242
            +
Sbjct: 325 CY 326

>Kwal_47.18919 s47 complement(1026638..1028560) [1923 bp, 640 aa]
           {ON} YGR138C (TPO2) -  [contig 188] FULL
          Length = 640

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 48/106 (45%), Gaps = 7/106 (6%)

Query: 105 LVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNV 164
           L+   V D++G +        + VI+++ C L   A N+   +V R   G+  +  L  V
Sbjct: 251 LIWSPVSDLFGRRVAYFVSLGLYVIFNIPCAL---APNIGCLLVCRFLCGVWSSSGLCLV 307

Query: 165 TGIVGNIYKPNTKAKNMV-FSMIGACAPIGATLGCLFSGLIGTESE 209
            G + +++ P T+ + +  F+    C P+    G L +G I   + 
Sbjct: 308 GGSIADMFPPETRGRAIAFFAYAPYCGPV---FGPLVNGFISVSTH 350

>NDAI0K03000 Chr11 (686056..687834) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 51/122 (41%), Gaps = 11/122 (9%)

Query: 128 VIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTG---IVGNIYKPNTKAKNMVFS 184
           + WSL+   ++Y ++V      R F G   AF  P+      + G  YK +   +   F 
Sbjct: 217 LCWSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGCFYKHDEMVRRSAFY 273

Query: 185 MIGACAPI---GATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTN 240
             G    I   G     +F+ L G      W W F    I++ + G+I +Y +P + P N
Sbjct: 274 YFGQYIGILSSGGIQSAVFTSLDGVNGMSGWRWNFIIDAIISVVVGIIGFYSLPGD-PHN 332

Query: 241 VH 242
            +
Sbjct: 333 CY 334

>SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121W QDR2 Multidrug transporter required for
           resistance to quinidine barban cisplatin and bleomycin
           member of the major facilitator superfamily of
           transporters conferring multiple drug resistance
           (MFS-MDR)
          Length = 600

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 97/238 (40%), Gaps = 14/238 (5%)

Query: 9   SKQRTGSDISRKVVDN-HEDSDMLLASRSRLQNPDY--FDKQWKEYLFVISSMLSXXXXX 65
           S +   +D ++KV++   + S     +    Q P Y  F K  K  L V+ +  +     
Sbjct: 35  SNEIQCTDDNQKVIEQISKPSSANPNNEKTCQEPPYSRFGKSEKSILAVLCAS-AGLFST 93

Query: 66  XXXXXXXPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYA 125
                  P   ++ ED           +  + ++ G   ++ G + D  G +  +L   A
Sbjct: 94  ISAPIYYPALTIIEEDFNISQEMVNITVVVYFILQGLAPMLMGGLADKVGRRPIVLCSIA 153

Query: 126 VVVIWSLIC-GLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKA-KNMVF 183
              ++++ C GL+S A N    +  R  Q  GI+ V+    GI+G+I    TKA +    
Sbjct: 154 ---LYAVACIGLAS-AQNYGEVLFLRCLQSAGISPVVAVNNGIIGDI---TTKAERGGYL 206

Query: 184 SMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNV 241
            ++     IG+  G L    I T    W   F+   I +  +  +A +++P+   T V
Sbjct: 207 GLMAGTQVIGSAFGALIGAGI-TARWGWRAIFWFLAIGSGFSLAVASFLLPETKRTVV 263

>TDEL0D03800 Chr4 (695403..697325) [1923 bp, 640 aa] {ON} Anc_3.245
           YBR043C
          Length = 640

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 36/145 (24%), Positives = 67/145 (46%), Gaps = 19/145 (13%)

Query: 96  FPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGL 155
           FPL   SF  + G+   +Y +   +L G+         C  ++ + N+  FI+ R   G 
Sbjct: 141 FPLWWSSFSEMHGR-RSVYVVSFIMLFGF---------CIGAALSPNISSFIILRVLCGA 190

Query: 156 GIAFVLPNVTGIVGNIYKPNTKAKNM-VFSMIGACAPIGATLGCLFSGLIGTESEAWAW- 213
             A V     G V ++Y P  + +N+ ++ M    AP+ A +  + SGL+      W+W 
Sbjct: 191 ASASVQSVGAGTVSDLYIPEDRGRNLGIYYMGPLMAPLIAPI--IASGLV----TRWSWR 244

Query: 214 -TFYAYTIVAALNGLIAWYVIPDNI 237
            T +   I+A  + L+  + +P+ +
Sbjct: 245 STQWFMVILAGFDVLLLVFFLPETL 269

>KLTH0E16720g Chr5 (1482846..1484570) [1725 bp, 574 aa] {ON} similar
           to uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 574

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 33/151 (21%), Positives = 65/151 (43%), Gaps = 10/151 (6%)

Query: 90  AWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVA 149
           +W+  ++ +   SF  + G   D  G +  L     +  +    CG ++  +++   I+ 
Sbjct: 81  SWITTAYLITCTSFQPLYGSFSDTLGRRHCLFFANTIFALGCFGCGTTTTIYSL---ILM 137

Query: 150 RSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFS--MIGACAPIGATLGCLFSGLIGTE 207
           R+  G+G   ++   T I  +I     +     F   ++G  A +GA+ G    GLI T 
Sbjct: 138 RALTGIGGGGLITLSTIINSDIIPAKKRGIYQAFQNVLLGTGAVVGASCG----GLIAT- 192

Query: 208 SEAWAWTFYAYTIVAALNGLIAWYVIPDNIP 238
           +  W W F     ++    L+A++ + D  P
Sbjct: 193 TMGWRWCFLLQVPISVGGTLVAFFFVHDQRP 223

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 39/72 (54%), Gaps = 3/72 (4%)

Query: 85  KASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVD 144
           +AS   W+  ++ L + +   + GK+ DI G +K LL G    +++++  GL  ++ ++ 
Sbjct: 135 QASMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGE---IVFAVGVGLCIFSKSIP 191

Query: 145 FFIVARSFQGLG 156
              +AR   G+G
Sbjct: 192 QLAIARGICGIG 203

>Skud_9.48 Chr9 (109346..111145) [1800 bp, 599 aa] {ON} YIL120W
           (REAL)
          Length = 599

 Score = 32.3 bits (72), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 64/140 (45%), Gaps = 28/140 (20%)

Query: 115 GLKKTLLGGYA------------VVVIWSLICGLS---SYAHNVDFFIVARSFQGLGIAF 159
           GL  TL+GG+A            +++ +    GL+   +YA      IV R  Q  GI+ 
Sbjct: 133 GLAPTLMGGFADSLGRRPVVLIAIIIYFGACVGLACTQTYAQ----IIVLRCLQAAGISP 188

Query: 160 VLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTE-SEAWAWT--FY 216
           V+   +GI+G+I    T+A+   +  +G  A     LG  F  LIG   S  W W   F+
Sbjct: 189 VIAINSGIMGDI---TTRAERGGY--VGYAAGF-QVLGSAFGALIGAGLSSRWGWRAIFW 242

Query: 217 AYTIVAALNGLIAWYVIPDN 236
             TI + +  L +  ++P+ 
Sbjct: 243 FLTIGSGICFLASLLILPET 262

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 61/148 (41%), Gaps = 6/148 (4%)

Query: 89  QAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIV 148
            +W+  ++ + S SF  + G   D  G +  L        I  L CGLS    N+     
Sbjct: 92  SSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTSFTIGCLACGLSP---NIVVLSF 148

Query: 149 ARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTES 208
            R+  G+G   ++   T IV +   P++K + +  +       +GA  G  F G I + S
Sbjct: 149 MRALTGIGGGGLITLST-IVNSDMIPSSK-RGIFQAFQNLLLGLGAICGASFGGSIAS-S 205

Query: 209 EAWAWTFYAYTIVAALNGLIAWYVIPDN 236
             W W F+    +   N LI    +P+ 
Sbjct: 206 IGWRWCFFVQVPICITNSLIMSSYVPNQ 233

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 33/148 (22%), Positives = 62/148 (41%), Gaps = 10/148 (6%)

Query: 91  WLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVAR 150
           W+  ++ + S SF  + G   D  G +  L    A   I  L CG SS  + + F    R
Sbjct: 6   WITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFSSNIYMLSFM---R 62

Query: 151 SFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFS--MIGACAPIGATLGCLFSGLIGTES 208
           +  G+G   ++   T +  ++   + +     F   ++G  A  GA+ G   +  IG   
Sbjct: 63  ALTGIGGGGLITLSTIVNSDVIPTSKRGIFQAFQNLLLGFGAICGASFGGTIASTIG--- 119

Query: 209 EAWAWTFYAYTIVAALNGLIAWYVIPDN 236
             W W F     ++ ++ ++  Y +P+ 
Sbjct: 120 --WRWCFLIQVPISMISSILMNYYVPNQ 145

>KNAG0M00710 Chr13 complement(118300..119919) [1620 bp, 539 aa] {ON}
           
          Length = 539

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 63/165 (38%), Gaps = 9/165 (5%)

Query: 78  LSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVV-IWSLI-CG 135
           L +DL     Q +W+ ++F    G   +  G V  I+   K +    A+ +  W LI C 
Sbjct: 108 LRQDLHMHGDQYSWVGSAFYF--GYLFMNLGPVQLIFQKTKHMSKLLALFIGSWGLILCC 165

Query: 136 LSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGAT 195
            ++   N   FI  R   G     V P  T I    +K N +   + F   G        
Sbjct: 166 HAAPRINYAAFIALRVLLGCAEGVVTPCFTIITAQYWKSNEQFTRICF-WFGMNGLGVIM 224

Query: 196 LGCLFSGLIGTESE----AWAWTFYAYTIVAALNGLIAWYVIPDN 236
           L  +  GL+  +      AW   F    ++    G + WY IPD+
Sbjct: 225 LNSMAYGLVLHKDSYSIPAWKLLFVIIGVITIALGALVWYWIPDD 269

>Kpol_1048.45 s1048 (117855..119801) [1947 bp, 648 aa] {ON}
           (117855..119801) [1947 nt, 649 aa]
          Length = 648

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 31/145 (21%), Positives = 62/145 (42%), Gaps = 5/145 (3%)

Query: 105 LVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNV 164
           L+ G   DI G K   L    ++ I +++  L+S    +      R FQ    + V+   
Sbjct: 225 LIWGHFADICGRKWLYLCSLLLMTIVNIL--LASLPAKIGLLYFLRIFQAFSSSSVMSMG 282

Query: 165 TGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAAL 224
            G V +I  P  + K + + M+G    +G  +  + +G+I   ++ W W F   +I++ +
Sbjct: 283 AGTVTDITAPKHRGKAIAYFMMGPN--MGPIVAPIIAGVI-LINDNWRWLFGFTSIMSGV 339

Query: 225 NGLIAWYVIPDNIPTNVHKFKMDWL 249
              +    +P+ +   V      W+
Sbjct: 340 AFFLVLVFLPETLRCMVGNGDKRWI 364

>SAKL0A02926g Chr1 complement(267564..269282) [1719 bp, 572 aa] {ON}
           similar to uniprot|P39709 Saccharomyces cerevisiae
           YAL067C SEO1 Putative permease member of the allantoate
           transporter subfamily of the major facilitator
           superfamily mutation confers resistance to ethionine
           sulfoxide
          Length = 572

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 53/125 (42%), Gaps = 11/125 (8%)

Query: 125 AVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTG---IVGNIYKPNTKAKNM 181
           A+ + WS++   +S   +V      R F G   AF  P       + G  YK +   +  
Sbjct: 196 ALDICWSILTIGASQVDSVPHLKAIRFFIG---AFEAPAYLAYQYLFGCFYKHDEMVRRS 252

Query: 182 VFSMIGACAPI---GATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNI 237
            F  +G  A I   G     +F+ L G      W W F    IV+ + G++ +Y++P + 
Sbjct: 253 AFYYLGQYAGILSAGGIQSAVFASLDGVNGLSGWRWNFIIDAIVSIVIGILGFYMLPGD- 311

Query: 238 PTNVH 242
           P N +
Sbjct: 312 PYNCY 316

>Kwal_23.4814 s23 (881364..882953) [1590 bp, 529 aa] {ON} YIL121W -
           Hypothetical ORF [contig 5] FULL
          Length = 529

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 71/170 (41%), Gaps = 35/170 (20%)

Query: 115 GLKKTLLGGYA------VVVIWSL---------ICGLSSYAHNVDFFIVARSFQGLGIAF 159
           GL  TL+GG A       VV+WS+         I    +YA      +V R  Q  GI+ 
Sbjct: 70  GLSPTLMGGLADSFGRRPVVLWSVALYMAACIGIACSKTYAQ----ILVLRCLQSAGISP 125

Query: 160 VLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTESEAWAWTFYAYT 219
           V+   +GI+G++     +   +   +      IG+  G L  G I   + +W   F+   
Sbjct: 126 VIAVNSGIMGDVTTREQRGGYV--GLTAGFQVIGSAFGALIGGGI-VSTWSWRAVFWFLA 182

Query: 220 IVAALNGLIAWYVIPDNIPTNVHKFKMDWLGSFLGVCGLIMFNFVWNQAP 269
           I +  + ++ + ++P+         K   +G+     G I  N +W+ AP
Sbjct: 183 IASGFSLVVTFIMLPET--------KRSIVGN-----GSIQPNTIWHIAP 219

>NDAI0K01460 Chr11 (332950..333921) [972 bp, 323 aa] {ON} Anc_2.451
          Length = 323

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 353 GSYFMFAIFGTIAAFLVGHTIHKTGPAIILLASVIA-FDVGCIM 395
           GS     I+ T   FLV + I K GPA+ L AS I+   VG +M
Sbjct: 203 GSSVQLPIYNTAKNFLVKNDIMKDGPALHLTASTISGLGVGVVM 246

>Smik_3.206 Chr3 complement(303825..304154) [330 bp, 109 aa] {ON}
           YBR008C (REAL)
          Length = 109

 Score = 30.0 bits (66), Expect = 5.0,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 3/53 (5%)

Query: 192 IGATLGCLFSGLIGTE---SEAWAWTFYAYTIVAALNGLIAWYVIPDNIPTNV 241
           IGA L  + + L+G     ++ W + F+  T VA  N ++ ++ +P+ +  NV
Sbjct: 6   IGAVLAPVMAPLLGASMMVAKGWRYIFWLLTWVATANFVLLFFFLPETLSDNV 58

>KLLA0E03829g Chr5 (349784..351613) [1830 bp, 609 aa] {ON} highly
           similar to uniprot|Q06451 Saccharomyces cerevisiae
           YPR156C TPO3 Polyamine transport protein
          Length = 609

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 61/135 (45%), Gaps = 9/135 (6%)

Query: 77  LLSEDLKAKASQQAWLMASFPLVSGSFI--LVSGKVGDIYGLKKTLLGGYAVVVIWSLIC 134
           L + + K   SQ+  +++   +V G  +  L+   V D+YG +        + VI+++ C
Sbjct: 191 LFTVEEKFHVSQEVAILSCSLMVIGFSLGPLIWSPVSDLYGRRVAYFISLGLYVIFNIPC 250

Query: 135 GLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAP-IG 193
            L   A N+   +V R   G+  +  L  V G + +++   T+ + + F    A AP  G
Sbjct: 251 AL---AKNIGTLLVCRFLCGVWSSSGLCLVGGSIADMFPAETRGRAIAFF---AYAPYCG 304

Query: 194 ATLGCLFSGLIGTES 208
              G L +G I   +
Sbjct: 305 PVFGPLVNGFIAIST 319

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 61/130 (46%), Gaps = 6/130 (4%)

Query: 87  SQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFF 146
           ++  W++  + L +  F L+ G++    G + +++   A +V++     +S+ A +++  
Sbjct: 78  TKSGWIVTGYSLPNALFSLLWGRISANLGPRISIV---ACIVLFEAGSLISALARSMNML 134

Query: 147 IVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGT 206
           I  R   G+G    L  ++ ++G     + K++ +V S++     I + +G    G   T
Sbjct: 135 IAGRVVSGVG-GSGLQTLSLVIG-CQLVDEKSRPLVLSLLNCTFAIASIIGPFIGGAFTT 192

Query: 207 ESEAWAWTFY 216
               W W FY
Sbjct: 193 HV-TWRWCFY 201

>TBLA0D03000 Chr4 complement(727249..728799) [1551 bp, 516 aa] {ON}
           Anc_1.155 YCR028C
          Length = 516

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 57/136 (41%), Gaps = 23/136 (16%)

Query: 125 AVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNT-KAKNMVF 183
           +  + W L+    S+AH+     V R FQ L  +        I+G  Y P     ++ +F
Sbjct: 114 SCTLAWGLLTLGMSHAHSARDLCVLRFFQALFESCTFSGTHLILGAWYCPRELPLRSAIF 173

Query: 184 SMIGACAPIGATLGCLFSGLIGT----ESE------AWAWTF---YAYTIVAALNGLIAW 230
           +  G        +G +FSG + T    E E       W W F   +  T+  AL GL+ +
Sbjct: 174 TSSG-------LVGAIFSGFMQTAIAHELEGAGGMAGWRWLFIIDFCITVPVALYGLLCF 226

Query: 231 YVIPDNIPTNVHKFKM 246
             +PD   T+  KF +
Sbjct: 227 PGMPD--ATSTGKFTL 240

>TDEL0D05710 Chr4 complement(1025468..1027318) [1851 bp, 616 aa]
           {ON} Anc_3.503 YPR156C
          Length = 616

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 46/101 (45%), Gaps = 7/101 (6%)

Query: 110 VGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVG 169
           V D+YG +        + VI+++ C +S    N+   +V R   G+  +  L  V G + 
Sbjct: 232 VSDLYGRRVAYFVSMGLYVIFNIPCAISP---NISGLMVCRFLCGVWASSGLCLVGGSIA 288

Query: 170 NIYKPNTKAKNMVFSMIGACAP-IGATLGCLFSGLIGTESE 209
           +++   T+ K + F    A AP +G   G L +G I   + 
Sbjct: 289 DMFPSETRGKAIAFF---AFAPYVGPVFGPLVNGFISVSTR 326

>NCAS0D02880 Chr4 complement(547303..548907) [1605 bp, 534 aa] {ON}
           Anc_5.227
          Length = 534

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 47/112 (41%), Gaps = 6/112 (5%)

Query: 128 VIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMI- 186
           ++ +  C   SYA      ++ R+  GL  A        I G  Y  + ++  + F  I 
Sbjct: 168 IVLTCHCACKSYAS----LMIVRTLLGLFEASSAVGCIAISGMYYTKSEQSARIGFWAIQ 223

Query: 187 -GACAPIGATLGCLFSGLIGTESEAWAWTFYAYTIVAALNGLIAWYVIPDNI 237
            G    +G  +   F    GTE  +W   F    +V  + G+I ++ +PDN+
Sbjct: 224 AGTGYIVGGLISFGFLHYHGTEFTSWQIMFLVVGLVTIVFGIITFFYLPDNV 275

>Kwal_47.17169 s47 complement(282962..284692) [1731 bp, 576 aa] {ON}
           YJR152W (DAL5) - allantoate permease [contig 212] FULL
          Length = 576

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 71/170 (41%), Gaps = 19/170 (11%)

Query: 78  LSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAV-VVIWSLICGL 136
           L EDLK    Q +W+ ++F      F L  G+   I+   + L    AV V+IW +   L
Sbjct: 143 LREDLKMHGDQYSWVGSAFYFGYLFFNLGPGQF--IFQKTRWLAKTLAVFVMIWGMFLAL 200

Query: 137 SSYAHNVDF--FIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMV----FSMIGACA 190
            + A +V++  FI  R   G   + V P  T I    +K   +   +     F+ +G   
Sbjct: 201 HA-APSVNYASFIFLRVLLGCAESMVTPTFTIITSQYWKKEEQFMRVCMWFGFNGLG--- 256

Query: 191 PIGATLGCLFSGLIGTES----EAWAWTFYAYTIVAALNGLIAWYVIPDN 236
             G     L  GL   +S    EAW   F    ++    G + ++ IPD+
Sbjct: 257 --GIWANALAYGLYTRQSSYSIEAWRVLFIITGLITVAVGAMIYFHIPDD 304

>CAGL0K12716g Chr11 complement(1260998..1262452) [1455 bp, 484 aa]
           {ON} similar to uniprot|P43562 Saccharomyces cerevisiae
           YFL040w
          Length = 484

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 45/105 (42%), Gaps = 13/105 (12%)

Query: 88  QQAWLMASFPLVSGSFILVSGKVGDIY--GLKKTLLGGYAV---VVIWSLICGLSSYAHN 142
           +Q  LM + PL         G +G I+   L K     Y+     +IW + C +  +   
Sbjct: 48  EQGLLMGANPL--------GGLIGSIFYVSLAKNCARLYSFRLSTIIWLIGCFIGIFVLE 99

Query: 143 VDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIG 187
           +    VAR  +G+ I  +  ++T  +  ++  N + + + F  +G
Sbjct: 100 IWMIAVARFLKGITIGMLSIHITNYINEVFPSNIRGRTLAFVQVG 144

>SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} similar
           to uniprot|P25351 Saccharomyces cerevisiae YCR023C
           Hypothetical ORF
          Length = 657

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 50/128 (39%), Gaps = 9/128 (7%)

Query: 78  LSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLS 137
           ++ D    +    +L ++F L      L  GK  D YG K  L  G       SLI G S
Sbjct: 93  IAPDEAQVSKYSGYLSSTFALCQVLSSLQWGKFSDKYGRKPALFIGLCGTCASSLILGFS 152

Query: 138 SYAHNVDFFIVARSFQGL--GIAFVLPNVTGIVGNIYKPNTKAKNMVFSMIGACAPIGAT 195
              +   F   ARS  GL  G   VL  V G V +      + + + FS +      G+ 
Sbjct: 153 QNFYQALF---ARSLMGLLNGNVAVLRTVIGEVAS----ERRHQALAFSTMPLLFQFGSV 205

Query: 196 LGCLFSGL 203
           +G +  G 
Sbjct: 206 IGPMIGGF 213

>TBLA0D02900 Chr4 (714553..716628) [2076 bp, 691 aa] {ON} Anc_3.503
           YPR156C
          Length = 691

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 49/106 (46%), Gaps = 7/106 (6%)

Query: 105 LVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNV 164
           L+   + DIYG + T      + VI+++ C +    +N+   ++ R F G+  +  L  V
Sbjct: 296 LIWSPMSDIYGRRLTYFVSMGLYVIFNIPCAI---PNNIATLMICRFFCGVWSSSGLCLV 352

Query: 165 TGIVGNIYKPNTKAKNMV-FSMIGACAPIGATLGCLFSGLIGTESE 209
            G + +++   T+ + +  F+    C P+    G L +G I   + 
Sbjct: 353 GGSLADMFPSETRGRAIAFFAYAPYCGPV---FGPLVNGFISISTR 395

>KLTH0C11044g Chr3 complement(908604..909551) [948 bp, 315 aa] {ON}
           similar to uniprot|Q12442 Saccharomyces cerevisiae
           YOL002C IZH2 Membrane protein involved in zinc
           metabolism member of the four-protein IZH family direct
           target of the Zap1p transcription factor expression
           induced by zinc deficiency and fatty acids deletion
           increases sensitivity to elevated zinc
          Length = 315

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 455 MSLCLGVSGTAERQVNKDGTDLLKGYRAALYVGIGLASVGIFVSGA--YAIEDWWTR 509
           +++  G++       NK  +   + YRA+L+V  GL+++   ++GA  Y +++ WTR
Sbjct: 188 LTMAFGLACATVSLSNKFRSREWRPYRASLFVAFGLSALLPVIAGALHYGLKETWTR 244

>KLLA0D12716g Chr4 complement(1084062..1085849) [1788 bp, 595 aa]
           {ON} similar to uniprot|P39709 Saccharomyces cerevisiae
           YAL067C SEO1 Putative permease member of the allantoate
           transporter subfamily of the major facilitator
           superfamily mutation confers resistance to ethionine
           sulfoxide
          Length = 595

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 52/122 (42%), Gaps = 11/122 (9%)

Query: 128 VIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTG---IVGNIYKPNTKAKNMVFS 184
           + WSL+   ++Y   V      R F G   AF  P+      + G  YK +   +   F 
Sbjct: 211 ICWSLLTLGAAYVDTVPHLKAIRFFIG---AFEAPSYLAYQYLFGCFYKHDEMVRRSAFY 267

Query: 185 MIGACAPI---GATLGCLFSGLIGTESEA-WAWTFYAYTIVAALNGLIAWYVIPDNIPTN 240
             G  A +   G  +  + + + G   ++ W W F    +++   GL+ +Y++P + P N
Sbjct: 268 YFGQYAGVLSSGGIISAVHATMNGLHGKSGWRWNFIIDAVISVAVGLLGFYMLPGD-PYN 326

Query: 241 VH 242
            +
Sbjct: 327 CY 328

>NDAI0I02770 Chr9 (652149..654029) [1881 bp, 626 aa] {ON} Anc_3.503
          Length = 626

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 45/104 (43%), Gaps = 5/104 (4%)

Query: 105 LVSGKVGDIYGLKKTLLGGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNV 164
           L+   V D+YG +        + VI+++ C L   A N+   +  R   G+  +  L  V
Sbjct: 236 LIWSPVSDLYGRQVAYFFSMGLYVIFNIPCAL---APNLGCLLACRFLCGVWSSSGLCLV 292

Query: 165 TGIVGNIYKPNTKAKNMVFSMIGACAPIGATLGCLFSGLIGTES 208
            G + +++   T+ K + F     C   G  LG + +G I   +
Sbjct: 293 GGSIADMFPSETRGKAIAF--FAFCPYTGPVLGPVVNGFISVST 334

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.433 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,274,040
Number of extensions: 1914337
Number of successful extensions: 6514
Number of sequences better than 10.0: 283
Number of HSP's gapped: 6559
Number of HSP's successfully gapped: 294
Length of query: 525
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 411
Effective length of database: 40,409,475
Effective search space: 16608294225
Effective search space used: 16608294225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)