Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03784g8.844ON99799746090.0
Kwal_27.102398.844ON91491625130.0
SAKL0D01364g8.844ON108283115070.0
TDEL0B005408.844ON1115108014101e-177
TPHA0I002708.844ON103990713291e-166
YML117W (NAB6)8.844ON1134112912771e-157
KNAG0G034408.844ON1053106512531e-155
NCAS0B002808.844ON108184212351e-152
KAFR0A028508.844ON104276512151e-149
ABL122C8.844ON104372912071e-148
ZYRO0G14256g8.844ON125969811911e-144
CAGL0B02365g8.844ON1050103811701e-143
Smik_13.178.844ON113189511341e-137
Suva_13.268.844ON112288311281e-136
Skud_13.248.844ON112873810851e-130
KLLA0D01485g8.844ON115155510011e-117
NDAI0E002708.844ON11985079701e-113
Kpol_1068.58.844ON10322679071e-105
TBLA0B032808.844ON13622328633e-97
Ecym_46158.844ON10672538391e-95
SAKL0A05280g6.183ON5822024538e-47
NCAS0H010406.183ON6292024408e-45
TBLA0B052106.183ON7102044393e-44
KLLA0E19031g6.183ON6522024347e-44
Kwal_27.111586.183ON5672024281e-43
Kpol_1002.696.183ON5902024291e-43
NDAI0F022606.183ON6802024322e-43
AFL061C6.183ON5232014199e-43
Ecym_22336.183ON5762014211e-42
KNAG0M004306.183ON4432014131e-42
KLTH0H04906g6.183ON5692024201e-42
CAGL0C01419g6.183ON6392034204e-42
TDEL0G016206.183ON5842024166e-42
TPHA0J022106.183ON5932024167e-42
ZYRO0G08140g6.183ON6322014152e-41
YPL184C (MRN1)6.183ON6122024132e-41
Smik_6.3906.183ON6252024132e-41
Suva_16.1236.183ON5962024094e-41
Skud_16.946.183ON6142024088e-41
KAFR0B066906.183ON5332014048e-41
ZYRO0F07238g8.670ON389681000.003
KAFR0A038308.670ON37467980.005
KNAG0A024008.466ON301105900.038
Kpol_526.415.635ON252128870.080
ACR135C8.670ON37672860.12
Ecym_26457.80ON1089159791.3
TDEL0A050105.635ON26488761.5
KAFR0D016608.797ON21267752.1
NDAI0E032608.466ON31780752.3
TPHA0L012008.466ON32268752.5
Kwal_55.22252singletonON236131733.4
TPHA0F028206.104ON60883753.4
KAFR0D026003.379ON28853743.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03784g
         (997 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...  1779   0.0  
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   972   0.0  
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   585   0.0  
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   547   e-177
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   516   e-166
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   496   e-157
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   487   e-155
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     480   e-152
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   472   e-149
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   469   e-148
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   463   e-144
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   455   e-143
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   441   e-137
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   439   e-136
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   422   e-130
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   390   e-117
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     378   e-113
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   353   e-105
TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...   337   3e-97
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   327   1e-95
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   179   8e-47
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   174   8e-45
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   173   3e-44
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   171   7e-44
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   169   1e-43
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   169   1e-43
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    171   2e-43
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   166   9e-43
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   166   1e-42
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   163   1e-42
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   166   1e-42
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   166   4e-42
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   164   6e-42
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   164   7e-42
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   164   2e-41
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   163   2e-41
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   163   2e-41
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   162   4e-41
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   161   8e-41
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   160   8e-41
ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {...    43   0.003
KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {O...    42   0.005
KNAG0A02400 Chr1 complement(236366..237271) [906 bp, 301 aa] {ON...    39   0.038
Kpol_526.41 s526 (95789..96547) [759 bp, 252 aa] {ON} (95789..96...    38   0.080
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    38   0.12 
Ecym_2645 Chr2 complement(1247120..1250389) [3270 bp, 1089 aa] {...    35   1.3  
TDEL0A05010 Chr1 (884301..885095) [795 bp, 264 aa] {ON} Anc_5.63...    34   1.5  
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    33   2.1  
NDAI0E03260 Chr5 complement(701736..702689) [954 bp, 317 aa] {ON...    33   2.3  
TPHA0L01200 Chr12 (250506..251474) [969 bp, 322 aa] {ON} Anc_8.4...    33   2.5  
Kwal_55.22252 s55 (1172484..1173194) [711 bp, 236 aa] {ON} YFL06...    33   3.4  
TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.1...    33   3.4  
KAFR0D02600 Chr4 complement(514523..515369,515443..515462) [867 ...    33   3.5  

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 997

 Score = 1779 bits (4609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 879/997 (88%), Positives = 879/997 (88%)

Query: 1   MSSYTPSAHRSMGKHPKGLYAEQRSHVALPEGSREYSGYYHGNRVPPAPQTPFDTSYGVX 60
           MSSYTPSAHRSMGKHPKGLYAEQRSHVALPEGSREYSGYYHGNRVPPAPQTPFDTSYGV 
Sbjct: 1   MSSYTPSAHRSMGKHPKGLYAEQRSHVALPEGSREYSGYYHGNRVPPAPQTPFDTSYGVS 60

Query: 61  XXXXXXXXXXXXXATPGMGSASPHRAGGSRSSHAQSSYHTPNFGSTQLRMPPPTEKRNFK 120
                        ATPGMGSASPHRAGGSRSSHAQSSYHTPNFGSTQLRMPPPTEKRNFK
Sbjct: 61  LLPSHLLMSSPFLATPGMGSASPHRAGGSRSSHAQSSYHTPNFGSTQLRMPPPTEKRNFK 120

Query: 121 HGSSYRHNSSVQQRAYEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKF 180
           HGSSYRHNSSVQQRAYEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKF
Sbjct: 121 HGSSYRHNSSVQQRAYEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKF 180

Query: 181 DRVESVYLVDSQQQSVLVSFLTKETCLDFYNGVXXXXXXXXXXXXXXXXXXNFASLRDVK 240
           DRVESVYLVDSQQQSVLVSFLTKETCLDFYNGV                  NFASLRDVK
Sbjct: 181 DRVESVYLVDSQQQSVLVSFLTKETCLDFYNGVLQKLSEFKKELKSKELTLNFASLRDVK 240

Query: 241 TGPTLQEIKIEVLRAGATRSLILEFQDKVDLALLSKSLGFIVNEGPRYVVEAIEIVNAGR 300
           TGPTLQEIKIEVLRAGATRSLILEFQDKVDLALLSKSLGFIVNEGPRYVVEAIEIVNAGR
Sbjct: 241 TGPTLQEIKIEVLRAGATRSLILEFQDKVDLALLSKSLGFIVNEGPRYVVEAIEIVNAGR 300

Query: 301 SSKHFGPHYAIIHFISIAMALETVEYLKSQSNKLAGLIKFRYVNTTSASGKSEFQTLSSS 360
           SSKHFGPHYAIIHFISIAMALETVEYLKSQSNKLAGLIKFRYVNTTSASGKSEFQTLSSS
Sbjct: 301 SSKHFGPHYAIIHFISIAMALETVEYLKSQSNKLAGLIKFRYVNTTSASGKSEFQTLSSS 360

Query: 361 QLNERALSNTSDSDISGGESVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHV 420
           QLNERALSNTSDSDISGGESVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHV
Sbjct: 361 QLNERALSNTSDSDISGGESVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHV 420

Query: 421 TISKAXXXXXXXXXXXXXXXXPQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPPIPGY 480
           TISKA                PQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPPIPGY
Sbjct: 421 TISKALNSKSSLNDLTSNTTSPQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPPIPGY 480

Query: 481 PFYMNMSKPLGXXXXXXXXXXXXXXXXMGGGLGNRTVYIGNISPRSKTEDICNVVRGGIL 540
           PFYMNMSKPLG                MGGGLGNRTVYIGNISPRSKTEDICNVVRGGIL
Sbjct: 481 PFYMNMSKPLGQTLQQQYTTTAQVATAMGGGLGNRTVYIGNISPRSKTEDICNVVRGGIL 540

Query: 541 QSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAV 600
           QSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAV
Sbjct: 541 QSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAV 600

Query: 601 TIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLED 660
           TIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLED
Sbjct: 601 TIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLED 660

Query: 661 GHCCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVXXX 720
           GHCCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLV   
Sbjct: 661 GHCCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVANK 720

Query: 721 XXXXXXXXXXXXXNIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGISVGDTQNLVRX 780
                        NIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGISVGDTQNLVR 
Sbjct: 721 NSKYFKKVKKASYNIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGISVGDTQNLVRD 780

Query: 781 XXXXXXXXXXXXXXXXXXNNTGGGLGISLASSTGEETNTPXXXXXXXXXXXXXXXXXXXI 840
                             NNTGGGLGISLASSTGEETNTP                   I
Sbjct: 781 SDEEQKLEEDELLRLSDLNNTGGGLGISLASSTGEETNTPVSDESSKEESVSSESSDVDI 840

Query: 841 LVSAPGSADTSQLESKTAPRSPKQPRVLANVPEKPSAFSAIIPRVSSASLDAVPPLAPST 900
           LVSAPGSADTSQLESKTAPRSPKQPRVLANVPEKPSAFSAIIPRVSSASLDAVPPLAPST
Sbjct: 841 LVSAPGSADTSQLESKTAPRSPKQPRVLANVPEKPSAFSAIIPRVSSASLDAVPPLAPST 900

Query: 901 LSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLHPRRRKSKAIPGSDVMAQY 960
           LSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLHPRRRKSKAIPGSDVMAQY
Sbjct: 901 LSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLHPRRRKSKAIPGSDVMAQY 960

Query: 961 LAQLQHSTFMYAANILGVDDGETVFYDENGPTTDPLI 997
           LAQLQHSTFMYAANILGVDDGETVFYDENGPTTDPLI
Sbjct: 961 LAQLQHSTFMYAANILGVDDGETVFYDENGPTTDPLI 997

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
           Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  972 bits (2513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/916 (56%), Positives = 618/916 (67%), Gaps = 24/916 (2%)

Query: 74  ATPGMGSASPHRAGGSRSSHAQSSYHTPNFGSTQLRMPPPTEKRNFKHGSSYRH--NSSV 131
           ATPG+G +SPHR   ++SS A        + STQLRMPP    R  +  +  +H  +   
Sbjct: 7   ATPGVGHSSPHRHVTNKSSQA--------YKSTQLRMPPSDAIRGSRRHNKEKHLYDEGT 58

Query: 132 QQRAYEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLVDS 191
           +Q  Y++ F+ILPR+ +G GD++ TRSL FSNLNPD  LH+FL  F KFDR+ESVY+VD 
Sbjct: 59  RQIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVDR 118

Query: 192 QQQSVLVSFLTKETCLDFYNGVXXXXXXXXXXXXXXXXXXNFASLRDVKTGPTLQEIKIE 251
           +QQSVLVSFLTKETCLDFYNG+                  +FAS + V++GPTLQEIK E
Sbjct: 119 EQQSVLVSFLTKETCLDFYNGILQKLSEFKKELRSKELSLSFASPQKVESGPTLQEIKFE 178

Query: 252 VLRAGATRSLILEFQDKVDLALLSKSLGFIVNEGPRYVVEAIEIVNAGRSSKHFGPHYAI 311
           VLRAGATRSL LEF+D++D A L K   F  N GPRYV+E+IE VN  + SK+FG +YAI
Sbjct: 179 VLRAGATRSLGLEFKDEIDFASLLKKFDFFDNSGPRYVIESIETVNTDKPSKYFGSNYAI 238

Query: 312 IHFISIAMALETVEYLKSQSNKLAGLIKFRYVNTTSASGKSEFQTLSSSQLNERALSNTS 371
           +HFISIAMA+ET+EYLK Q+ +  GL K  YVN+T  SGKSEFQT S+S+L+++      
Sbjct: 239 VHFISIAMAVETMEYLKVQTPESFGLTKVSYVNSTFTSGKSEFQTFSNSELSDQNDVEVQ 298

Query: 372 DSDISGGESVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHVTISKAXXXXXX 431
           DS  S  +   S GS    +   E+   V P+QYG P+VEE ++H  H+TISKA      
Sbjct: 299 DSISSFEDITLSEGS---MSVENEKAFTVLPSQYGPPVVEEHNQHCSHITISKALSSKVS 355

Query: 432 XXXXXXXXXXPQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPPIPGYPFYMNMSKPLG 491
                     PQPQEVLV++ E  SSR S+VSL  A S GP YP +PGY +YM+MSKPLG
Sbjct: 356 RNGSSSSIASPQPQEVLVSNSEAPSSRNSIVSLLSARSQGPTYP-VPGYHYYMDMSKPLG 414

Query: 492 XXXXXXXXXXXXXXXXMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHI 551
                           MGGG GNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHI
Sbjct: 415 QTLQQQYTATAQVATAMGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHI 474

Query: 552 CFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVS 611
           CFVTFIEAASAVQFFANS+IEPIVLHG++LKVGWGHHSGNLPQSISLAVTIGASRNVYVS
Sbjct: 475 CFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVYVS 534

Query: 612 LPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNI 671
           LPE+AFKDKFIKDPEYQ F+EKF+LPSK+QLY+DFS FGDIEL+NFLEDGHCCWINFMNI
Sbjct: 535 LPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFMNI 594

Query: 672 SNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVXXXXXXXXXXXXXX 731
           SNAIKLVEDANN NN+SFHEKF NRY+GLFIGYGKDRCGNVNKNLV              
Sbjct: 595 SNAIKLVEDANNSNNESFHEKFENRYRGLFIGYGKDRCGNVNKNLVSNKNSKYFKKVKKA 654

Query: 732 XXNIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGISVGDTQNLVRXXXXXXXXXXXX 791
             NIRLR+QQK   +A  +     +  +K ++ DAFGISVG +Q   R            
Sbjct: 655 SYNIRLRRQQKSDIEAQAKSGKGDENSEKKLQVDAFGISVG-SQPDARYSDEEQKIEENE 713

Query: 792 XXXXXXXNNTGGGLGISLASSTGEETNTPXXXXXXXXXXXXXXXXXXXILVSAPGSADTS 851
                  N+  GGLGIS++       N                     ILVSAPGSA+TS
Sbjct: 714 LLLLSKPNSAEGGLGISVSQDVTVTENNTACGGKNKTGSVSSGSSEVDILVSAPGSANTS 773

Query: 852 QLES------KTAPRSPKQPRVLANVPEKPSAFSAIIPRVSSASLDAVPPLAPSTLSRQY 905
           QLE        TA  + K+ R  ++   K   FS I PRVS ASLDAVPPLAP+ L+  Y
Sbjct: 774 QLEGGGPTQRTTAASNGKKER--SSGVSKLHCFSEIAPRVSKASLDAVPPLAPAALNCHY 831

Query: 906 TATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSK-KPLHPRRRKSKAIPGSDVMAQYLAQL 964
            +  + ++R+      +   S   +DI S+ ++ K    R+R ++AIPGS+VMAQYLAQL
Sbjct: 832 NSAPRRSARKNGHDHDSNPVSGSKSDIGSKSTQGKSSKSRQRNAQAIPGSNVMAQYLAQL 891

Query: 965 QHSTFMYAANILGVDD 980
           QHSTFMYAA+ILGVDD
Sbjct: 892 QHSTFMYAADILGVDD 907

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/831 (42%), Positives = 454/831 (54%), Gaps = 99/831 (11%)

Query: 6   PSAHRSMGKHPKGLY---AEQRSHVALPEGSREYSGYYHGNRVPPAPQTPFDTSYGVXXX 62
           P   ++M  HP G      +    ++LP       GYY G+ +P APQTPFDTSYG    
Sbjct: 25  PHYPQTMAYHPMGPMNGGVQPTMQMSLPS----QQGYYAGSPMPSAPQTPFDTSYGATLL 80

Query: 63  XXXXXXXXXXXATPGMGSASPHRAGGSRSSHAQSSYHT------PNFGSTQLRMPPPTEK 116
                      +TP   +A  H      +S  Q  YH        N GS++       + 
Sbjct: 81  PSHLLMGSPFISTP-QNAAMMHAGSRGLNSSQQQFYHYTYSNNGKNKGSSKKNNRDKKKV 139

Query: 117 RN----------------------FKHGSSYRH--NSSVQQRAYEVVFHILPRSADGGGD 152
            N                       K  +  RH  NS      Y + F ILP+    G D
Sbjct: 140 ENGHVMMTRYSYPPPPQLNAPPMTHKRKTHLRHETNSQPSSEPYVINFKILPK----GDD 195

Query: 153 EYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLV----------------------- 189
           EYMTRSLL SN+N    LHDF+TKF KF  +ESVY+V                       
Sbjct: 196 EYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPEEEEEEEEEEEEEEEEEEEEEE 255

Query: 190 --DSQQQSVLVSFLTKETCLDFYNGVXXXXXXXXXXXXXXXXXXNFASLRDVKTGPTLQE 247
             + ++QS+L+SFLTK TCLDFYN V                  NF SL       T ++
Sbjct: 256 KGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNFVSL-------TSED 308

Query: 248 IKIEVLRAGATRSLILEFQDKVDLALLSKSLGFIVN-EGPRYVVEAIEIVNAGRSSKHFG 306
           I+ +VLR GATRS+ LEF++      L +S+  + N    R+VVE I+IVN    +K+F 
Sbjct: 309 IRDDVLRKGATRSIALEFKNSFTTKQL-ESIEILSNASNSRFVVEKIDIVNTESPNKNFN 367

Query: 307 PHYAIIHFISIAMALETVEYLKSQSNKLAGLIKFRYVNTTSASGKSEFQTLSSSQLNERA 366
            HYAIIHFISI+MA+E   YL +   KL G+ +  +V  +  +    F++  +SQ     
Sbjct: 368 THYAIIHFISISMAVEASSYLLNWDEKL-GISRLFFVTDSIINKSDYFRSAPASQ----- 421

Query: 367 LSNTSDSDISGGESVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHVTISK-- 424
             + S S +S  +++     KLQ   L E+TL + P  Y +  +EE   HL  ++ISK  
Sbjct: 422 --DASRSSVSIDQTLEFATKKLQGLVLKERTLSIKPKTYPQAEIEEHQHHLTSISISKPL 479

Query: 425 ----AXXXXXXXXXXXXXXXXPQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPPIPGY 480
                                P  QE+ ++D  +S+    M+    A+      PP P Y
Sbjct: 480 LSSNNNSSSVSLQGNQNLTSSPVTQEMYLHDTSNSTREDVMIQSSMASGTSNFVPPPPHY 539

Query: 481 PFYMNMSKPLGXXXXXXXXXXXXXXXXMGGGLGNRTVYIGNISPRSKTEDICNVVRGGIL 540
             YM+++KP+                 MGGGLGNRTVY+GNI+PRSK EDICNVVRGGIL
Sbjct: 540 --YMDVTKPIRQTLQQQLTTTAQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGIL 597

Query: 541 QSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAV 600
           Q +K+ E KH+CFVTFIEAA+AVQFFAN++IEPIVLHGNVLKVGWGHH G+L QSI+LAV
Sbjct: 598 QHIKFFEHKHVCFVTFIEAAAAVQFFANASIEPIVLHGNVLKVGWGHHPGDLAQSIALAV 657

Query: 601 TIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLED 660
           TIGASRNVYVSLPE+AFKDKFIKDPE+QEF+EK++LPSKEQL +DFS FG+IE +N+L+D
Sbjct: 658 TIGASRNVYVSLPEYAFKDKFIKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDD 717

Query: 661 GHCCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVXXX 720
           GHCCW+NFMNI++AIKLVEDAN  +N  FH  + +RYKGL IGYGKDRCGNVNKNLV   
Sbjct: 718 GHCCWVNFMNITSAIKLVEDANGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVANK 777

Query: 721 XXXXXXXXXXXXXNIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGISV 771
                         IR+ KQ K             +E     + +AFGI +
Sbjct: 778 KSRFFKKVKKASYKIRMHKQNKAGG-------SNGQEPISSFQDNAFGICI 821

 Score =  115 bits (287), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 75/115 (65%), Gaps = 7/115 (6%)

Query: 885  VSSASLDAVPPLAPSTLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLHPR 944
            VSS SLDAVPPLAPST+SR Y+  S H++      G  + S  R+   +        H R
Sbjct: 972  VSSTSLDAVPPLAPSTVSRHYSVASSHSNNSYHNNGRHDASKKRHGGGKGNTH----HGR 1027

Query: 945  RRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDG---ETVFYDENGPTTDPL 996
             RKSKAIPGS VMAQYLAQLQHSTFMYAANILGV +G   ++  YDENG    P+
Sbjct: 1028 HRKSKAIPGSQVMAQYLAQLQHSTFMYAANILGVTNGDNEDSTLYDENGGFRGPM 1082

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
            YML117W
          Length = 1115

 Score =  547 bits (1410), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 388/1080 (35%), Positives = 547/1080 (50%), Gaps = 141/1080 (13%)

Query: 39   YYHGNRVPPAPQTPFDTSYGVXXXXXXXXXXXXXXATPGMGSASPHRAGGSRS----SHA 94
            YY    V  AP TPFDT+YGV              ++P +     H     +     SH 
Sbjct: 47   YYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNLFQQPHHHQHAHQRLQQYSHN 106

Query: 95   QS-SYHTPNFG--STQLRMPP----PTEKRNFKHGSSYR---HNSSVQ--------QRAY 136
            QS S    +FG  +T   +PP    P   RN  H    R   H  S+Q        +  +
Sbjct: 107  QSKSSSGRSFGKLATAYPVPPSLNSPPASRNALHNRGPRRGSHYKSIQSSDASKRFKDPF 166

Query: 137  EVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLVDSQ--QQ 194
             + + +LP+    G DE+ TRSLLF N++    LH F+T F  +  VESVYL  S+    
Sbjct: 167  ILTYRVLPK----GNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFKSEGDHV 222

Query: 195  SVLVSFLTKETCLDFYNGVXXXXXXXXXXXXXXXXXXNFASLRDVKTGPTLQE------- 247
            S+L+SF +K  CLDFYN V                  +F SL + K   T +E       
Sbjct: 223  SILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSL-EYKVSDTSEEDIDKEDD 281

Query: 248  -------------IKIEVLRAGATRSLILEFQDKVDL-ALLSKSLGFIVNEG-PRYVVEA 292
                         ++ +V+  GATRS+++ F+       L+ K L F+  E   RYV+E+
Sbjct: 282  SKPDAFNITAAGSLRYDVINRGATRSIMITFKTPCSKDELIDKKLEFLKKENNTRYVLES 341

Query: 293  IEIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLKSQSNKLAGLIKF-----------R 341
            I++V A   SKHF  +YA++ F++I MA+E ++Y++  S KL     F           +
Sbjct: 342  IDLVTADEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISKCFFISIQPQIPDGK 401

Query: 342  YVNTTSASGKSEFQTLSSSQLNERALSNT---SDSDISGGESVASLGSKLQQTSLGEQTL 398
             ++ +SAS     +++S +  ++ A   +   S S IS  + +  +  KLQ  +  +  L
Sbjct: 402  RLSVSSASNGRSMESISGNYRSKNASVTSLESSGSIISLDQEIDEMTYKLQSVNSKKNIL 461

Query: 399  VVDPTQYGRPLVEERSEHLPHVTISKAXXXXXXXXXXXXXXXXPQPQEVLVNDH----ED 454
             V    Y  P  E  ++HL +VT+S+A                P PQEV VN++    +D
Sbjct: 462  EVTTNNYKDPSFEGHTDHLTNVTVSEAASLDSQLTM-------PSPQEVTVNEYVLPNQD 514

Query: 455  SSSRGSMV---SLKQANSHGPAYPPI---PGYPF--YM---------NMSKPLGXXXXXX 497
                  M    S++  ++  P+  P+   P  P+  YM         NM+KP+       
Sbjct: 515  MPLPNDMNYAPSVQDVDAVPPSMVPMSTMPNTPYGCYMPPPNVRQNGNMTKPITQSLQRQ 574

Query: 498  XXXXXXXXXXMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFI 557
                      MGGG+GNRTVYIGNI PRS+TEDICNVVRGGILQ+VK++  K ICFVTF+
Sbjct: 575  YATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFV 634

Query: 558  EAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAF 617
            EA++AVQF+ N+ I+PIVLHGN+LKVGWGHHSG LP+SI+LAVT+GASRNVYVSLPE AF
Sbjct: 635  EASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAF 694

Query: 618  KDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKL 677
            KDK+I DP+Y+E+ +KF+LP +EQL +DFS +GDIE +N+L DGHCCW+NF NIS AIKL
Sbjct: 695  KDKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKL 754

Query: 678  VEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVXXXXXXXXXXXXXXXXNIR- 736
            VE+       +F++  G RY GL IGYGKDRCGNVNKN +                NIR 
Sbjct: 755  VEEVKYEGGGNFYKMLGGRYDGLVIGYGKDRCGNVNKNFIAGKNSRFYKKVKKPSFNIRL 814

Query: 737  -------------LRKQQKGASDAPTEVKDEAKELDKPIKADAFGISVGDTQNLVR---- 779
                         LR+QQ+  S+   +       +D   K D   +   D ++ V+    
Sbjct: 815  SKMEEERRQHEETLRRQQENNSEKFLQFGSLGITIDSNGKEDPEKVDDVDFEDEVKFDSN 874

Query: 780  ------XXXXXXXXXXXXXXXXXXXNNTGGGLGISLASSTGEETN-------TPXXXXXX 826
                                     N + G  G+++  S G+ T        T       
Sbjct: 875  SPKKTVEQASGKESDQEEQELLKLSNKSQGAQGLNIVESQGQSTREKEATKLTRNHSEND 934

Query: 827  XXXXXXXXXXXXXILVSAPGSADTSQLESKTAPRSPKQP-RVLANVPEKPSA---FSAII 882
                         +++++P   + S  +SK+     K   R LAN  E  S+   F +  
Sbjct: 935  ETSAKSDASSDVELIINSP-EEEESNFKSKSNRGFRKNDRRKLANCAEGASSKERFKSTT 993

Query: 883  PRV----SSASLDAVPPLAPSTLSRQYTATSK----HNSRR---GSRFGTTEKSSPRYND 931
              V    SS+SL+A PP+AP+T+SR Y+   K    H   R   G  F    +    ++ 
Sbjct: 994  NDVSSALSSSSLEANPPMAPATISRNYSLMFKQQYNHEKLRDFEGESFDDESQQESNFDF 1053

Query: 932  IRSQDSKKPLHPRRRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGV-DDGETVFYDENG 990
              +Q +++  +P RR  K+IPGSDVMAQYLAQLQHSTF+YAANILG  +DG+  + DEN 
Sbjct: 1054 ESTQQTRRRRYPNRRHGKSIPGSDVMAQYLAQLQHSTFIYAANILGASNDGDNNYLDENA 1113

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
            Anc_8.844 YML117W
          Length = 1039

 Score =  516 bits (1329), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 327/907 (36%), Positives = 462/907 (50%), Gaps = 135/907 (14%)

Query: 135  AYEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLVDSQQ- 193
            AY++ + ILP+    G D Y TRSLLF N+N    LH F+ KF  +  +ESVY+V S + 
Sbjct: 209  AYKISYQILPK----GDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYET 264

Query: 194  -----QSVLVSFLTKETCLDFYNGVXXXXXXXXXXXXXXXXXXNFASL----RDVKTG-- 242
                 +S+L+SF ++  CLDFYN V                  +F SL     ++  G  
Sbjct: 265  HQNSVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNINKGNG 324

Query: 243  -------------PTLQEIKIEVLRAGATRSLILEFQDKVDLA--LLSKSLGFIV-NEGP 286
                              I+ +V   GATRSL +EF  +VD     +   L F+  N   
Sbjct: 325  KISVESQKNETDFELTSLIQYQVANFGATRSLCIEFDKRVDKIDDFIETYLPFLSSNANK 384

Query: 287  RYVVEAIEIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLKSQ--SNKLAGLIKFRYVN 344
            RY++E++ IVN       F  HY I+ F++I+M +E + Y++S+  S  +   +   +  
Sbjct: 385  RYIIESLYIVNNNGKDNEFPAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLYVSFDR 444

Query: 345  TTSASGKSEFQTLS----SSQLN----ERALSNTSDSDISG-----GESVASLGSKLQQT 391
            T  A   S  Q+LS    S  LN    E  +++ ++ D++       E+   + +KL + 
Sbjct: 445  TKHAVSNSNRQSLSKKGTSDTLNTYTLESPINHNTEVDMNDIPSIYDENEIEIANKLSEL 504

Query: 392  SLGEQTLVVDPTQYGRPLVEERSEHLPHVTISKAXXXXX--------XXXXXXXXXXXPQ 443
             +   T  +D + Y  P +E R+EHLP+V+IS+                         P 
Sbjct: 505  EIQTHTFNLDISNYSNPHIEIRAEHLPNVSISRDPMIYANPIYQSPPSGYMENMWTTTPF 564

Query: 444  PQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPPIPGYPFYMNMSKPLGXXXXXXXXXXXX 503
                +V  HE+ ++     ++K  N+                 + PL             
Sbjct: 565  LSSHIV--HEEYANDRVDYNMKHYNNQL--------------YNVPLPQTLQSQFATSAE 608

Query: 504  XXXXMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAV 563
                MGGG+GNRT++IGNI+PRSKTEDICNV RGGI+Q VKYI  K+ICFV FI+  +A 
Sbjct: 609  MASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREKNICFVIFIDPQAAA 668

Query: 564  QFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIK 623
            QF+ANS I+PI+LH N LK+GWG H G LP++I LAVT GASRNVYVSLPE AFKDK+I 
Sbjct: 669  QFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVYVSLPEFAFKDKYIN 728

Query: 624  DPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANN 683
            DP Y+E+  K+ LPS++QL EDFS FG++E +NFL+D HCCWINF NI +AIKLVE   N
Sbjct: 729  DPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFTNIRSAIKLVELVKN 788

Query: 684  PNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVXXXXXXXXXXXXXXXXNIRLRKQQKG 743
             +N++FHE++ NRYKGL IGYGKDRCGNVNK+LV                NIRL++ ++ 
Sbjct: 789  EDNNNFHERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRKVKKPSYNIRLQQLEEE 848

Query: 744  ASDAPTEVKDEAKELD-KPIKADAFGISVGDTQNLVRXXXXXXXXXXXXXXXXXXXNNTG 802
                  +  DE K++D K I  D+ GI+    QN+                     + T 
Sbjct: 849  R-----KRNDEIKQIDNKRINLDSLGITTSPNQNI-------------------QEDETL 884

Query: 803  GGLGISLASSTGEETNTPXXXXXXXXXXXXXXXXXXXILVSAPGSADTSQLESKTAPRSP 862
                + L S TG +                       +++++PG+   S    K  P + 
Sbjct: 885  SLAKLKLTSDTGFKN---SENESDIDDSASNSSTDVELIINSPGNGFKSHRNRKPKPNN- 940

Query: 863  KQPRVLANVPEKPSAFSAIIPRVSSASLDAVPPLAPSTLSRQYTATSKHNSRRGSRFGTT 922
                   ++ E+        P+V +    A  P+AP+ LS  Y  T  HN+         
Sbjct: 941  ------LDLGER--------PKVDAIVFKADGPMAPNKLSHDYHRT--HNT--------- 975

Query: 923  EKSSPRYNDIRSQDSKKPLHPRRRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGE 982
                 R ++ RS+ ++K  H      K IPGSDVM+QYLAQ+QHSTFMYAAN+L     E
Sbjct: 976  -----RVDNPRSERTRKRTH-----KKIIPGSDVMSQYLAQVQHSTFMYAANVLNASIEE 1025

Query: 983  TVFYDEN 989
              FYDEN
Sbjct: 1026 PEFYDEN 1032

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
            RNA-binding protein that associates with mRNAs encoding
            cell wall proteins in high-throughput studies; deletion
            mutants display increased sensitivity to some cell wall
            disrupting agents; expression negatively regulated by
            cAMP
          Length = 1134

 Score =  496 bits (1277), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 382/1129 (33%), Positives = 523/1129 (46%), Gaps = 213/1129 (18%)

Query: 32   GSREYSGYYHGNRVPPAPQTPFDTSYGVXXXXXXXXXXXXXXATPGMGSASPHRAGGSRS 91
            G  ++  YY  + +P  P TPFDT+YG               ++P M S        +RS
Sbjct: 47   GPSQHPAYYTNSPLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSG----YNSARS 102

Query: 92   SH-AQSSYHTP-------------NFGSTQLRMPPPTE---------------KRNFKH- 121
            S+  + +Y  P             N  +T   M  P+                 RN  H 
Sbjct: 103  SNLKRKAYSRPVSNHNGYNGNSNSNQNNTNNGMVTPSNYYRMGRNSFSRNNNSTRNVTHN 162

Query: 122  ---GSSYRHNSS-----------------VQQRAYEVVFHILPRSADGGGDEYMTRSLLF 161
               G   R+NS                  + QR + + + +LP     G D Y TRSLL 
Sbjct: 163  NNKGCDTRNNSGRRTFARNNIFDDILPEMLLQRPFCINYKVLPT----GDDAYRTRSLLI 218

Query: 162  SNLNPDTHLHDFLTKFEKFDRVESVYL-----------VDSQQQSVLVSFLTKETCLDFY 210
             N++    LH  +  F K + +ES YL           V+++  S+L+SFLTK  CL+FY
Sbjct: 219  ENVDHSIDLHSIVKNFVKSNTLESAYLIEGGKSDDSKDVETKNLSILISFLTKGDCLNFY 278

Query: 211  NGVXXXXXXXXXXXXXXXXXXNFASLR----------------------DVKTGPTLQEI 248
            N +                   F  L                       D+  G T+   
Sbjct: 279  NNILQRLSEFKTFLKSEALNLKFVCLNYDPKCLPTFIESEALTENAEEADITNGSTMISA 338

Query: 249  KI--EVLRAGATRSLILEFQDKVDLA-LLSKSLGFI-VNEGPRYVVEAIEIVNAGRSSKH 304
             +   +    ATRS+I+EF+  V+ + L  K L F+  ++  RY++E+I++VN    S  
Sbjct: 339  SLHHNIANKDATRSIIIEFKSPVEKSDLFKKKLQFLDRSKNKRYILESIDLVNTDVPSNQ 398

Query: 305  FGPHYAIIHFISIAMALETVEYLKSQSNKLAGLIKFRYVN-----TTSA--------SGK 351
            F  +YA++ F++I+MA+E ++YLK  S  L G+ K  YV+      +SA         GK
Sbjct: 399  FPENYAVLTFLNISMAIEVLDYLKKYSKNL-GISKCFYVSLAPLVVSSARSSVANIYEGK 457

Query: 352  SEFQTLSSSQLNER--------------------ALSNTSDSDIS--------------- 376
            +    LS   +                        L+N S   +S               
Sbjct: 458  TSTHRLSVPSVTAGNNNDSNNNGNNNKSNMSGITTLNNNSSIGVSVYGHSNMSLTSLSSS 517

Query: 377  --GGESVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHVTISKAXXXXXXXXX 434
                E +  L +KLQ   L    L ++   Y  P +EE S HL +V ISK          
Sbjct: 518  VSLNEEIDMLATKLQGVELDGTYLEINYRDYQTPTIEEHSTHLSNVKISKTTENSRQFSQ 577

Query: 435  XXXXXXXPQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPPIPGYPFYMN---MSKPLG 491
                   P  + + +ND   + S G+++  +   +  P  P +      MN   +  P+ 
Sbjct: 578  DIPSPL-PLNEHMFMND--SNQSNGAIIPQQLIATPSPVSPNLQ-----MNQRVLPNPIT 629

Query: 492  XXXXXXXXXXXXXXXXMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHI 551
                            MG  +GNRT+YIGNI+PRSK EDICNVVRGGILQS+KYI  K I
Sbjct: 630  QSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIPEKKI 689

Query: 552  CFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVS 611
            CFVTFIEA SAVQF+ANS I+PIVLHGN+L+VGWGH+SG LP+ ISLAVTIGASRNVYVS
Sbjct: 690  CFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRNVYVS 749

Query: 612  LPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNI 671
            LPE AFK+KFI DP+Y++  E   LP  EQL EDFS +GDIE +N+L D HCCWINFMNI
Sbjct: 750  LPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNI 809

Query: 672  SNAIKLVEDANNPN---NDS--------FHEKFGNRYKGLFIGYGKDRCGNVNKNLVXXX 720
            S+AI LVE+ N  +   N+S          EKFG RYKGL I YGKDRCGN+NKNL+   
Sbjct: 810  SSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNLIAGK 869

Query: 721  XXXXXXXXXXXXXNIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGISV--------G 772
                         NIRL K ++       E+ ++ K  DKP+  ++ GIS+        G
Sbjct: 870  NSRFYKKVKRPSYNIRLSKLEEKRRQ--NEIDEKEKAFDKPLNLESLGISLDAHKDNGGG 927

Query: 773  DTQNLVRXXXXXXXXXXXXXXXXXXXNNTG--GGLGISLASS-----TGEETNTPXXXXX 825
            +T                        N TG  GGLG+++ASS     T +ET+       
Sbjct: 928  ETGT---ANNTGHENESELEAENENGNETGSFGGLGLAVASSDVKRATSDETD--YEDIF 982

Query: 826  XXXXXXXXXXXXXXILVSAPGSADTSQLESKTAPRSPKQPRVLANVP------EKPSAFS 879
                          +++ +P   + + L+S+T  RS  Q  + +  P      E+    S
Sbjct: 983  NKSSGSSDSSSDVEVIMHSPSDPEYA-LKSQTL-RSSSQTVINSKRPVKIEDEEEAVGMS 1040

Query: 880  AIIPRVSSASLDAVPPLAPSTLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKK 939
             +  R   +SL   PP APSTLS  Y  +  + +     F   E ++ R         K+
Sbjct: 1041 QLNYR---SSLRQAPPRAPSTLS--YNHSKNNETPMQDIFTNGETANNR-------KKKR 1088

Query: 940  PLHPRRRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDE 988
                R R    IPGSDVMAQYLAQ+QHSTFMYAANILG    +    DE
Sbjct: 1089 GSFARHR---TIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHPDE 1134

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
            Anc_8.844 YML117W
          Length = 1053

 Score =  487 bits (1253), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 358/1065 (33%), Positives = 498/1065 (46%), Gaps = 157/1065 (14%)

Query: 15   HPKGLYAEQRSHVALPEGSREYSGYYHGNRVPPAPQT-----PFDTSYGVXXXXXXXXXX 69
            +P+G  ++Q     L + S  +   +  N  P +P T     PFDT+YG           
Sbjct: 54   YPQGTVSKQ---APLSQQSHPFPQNFAQNFPPNSPMTNGMPTPFDTAYGATLLPSHLLMG 110

Query: 70   XXXXATPGMGSASPHRAGGSRSSHAQSSYHTPNFGSTQLRMPPPTEKRNFKHGSSYRHNS 129
                +TP +                Q++Y     GS    M   T   N+     YR + 
Sbjct: 111  SPFVSTPNL---------------PQTNYTAQRKGS-HTGMANGTGSMNY-----YRTDP 149

Query: 130  SVQ----QRAYEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVES 185
             +     Q  +E+ + ILP+    G D Y TRSLL  N++    LH F++KF + + VES
Sbjct: 150  QIINGLFQIPFEISYKILPK----GDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVES 205

Query: 186  VYLVDSQQQ----SVLVSFLTKETCLDFYNGVXXXXXXXXXXXXXXXXXXNFASLRDVKT 241
            VY+    QQ      L+SFL+ + CL+FYN V                  +F S+R   T
Sbjct: 206  VYITKEGQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPT 265

Query: 242  --------------GPTLQEIKIEVL-RAGATRSLILEFQDKVDL----ALLSKSLGFIV 282
                          G  +  +  ++  + GATRS+ +EF DK  +     LL+K L F+ 
Sbjct: 266  KVEGKIYRRFAADDGDGMANLHFDMAAQTGATRSIAIEFVDKDVILTRDELLNKKLKFLS 325

Query: 283  NEGPRYVVEAIEIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLKSQSNKLAGLIKFRY 342
                RY++E I +      +K FG +YAII F+SI MA+E ++YLK    +L  L KF Y
Sbjct: 326  EGNNRYILEHIAVFKTQHGTKVFGKNYAIITFLSIPMAMEIMDYLKLNIKQLH-LTKFFY 384

Query: 343  VNTTSASGKSEFQTLSSSQLNERALSNTSDSDIS-------------------------- 376
            V  T    +S     ++SQ    A    S+ D S                          
Sbjct: 385  VQVTHPPQQSP----AASQKKPHANDTESNRDTSPPNSKKDQEFFPNNSMLSLVSSESST 440

Query: 377  -GGESVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHVTISKAXXXXXXXXXX 435
               + V  L +KL+   L E TL +    Y  PL E+ SEH   +  S            
Sbjct: 441  SLADDVDGLVNKLKSIELQESTLKLRVEDYPEPLFEQFSEHSNGIVQSLPVPQTRPIGGP 500

Query: 436  XXXXXXPQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPP--IPGYP----------FY 483
                  P+      ND     +    + L  +NS  P  PP  IP  P           +
Sbjct: 501  QSSISTPRAFGAFPNDIGSPPASFLPLDLNHSNS-VPNLPPGFIPATPSGPMSPQQQQLF 559

Query: 484  MN------------MSKPLGXXXXXXXXXXXXXXXXMGGGLGNRTVYIGNISPRSKTEDI 531
            +N             + P+                 MG    NRT+YIGNI+PRS+ EDI
Sbjct: 560  LNSQRQQRDHAGGKFAHPITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDI 619

Query: 532  CNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGN 591
            CNVVRGGILQ++K+IEAKHICF+TFIEA++AVQF+AN+ I+PIVLHGN LK+GWG ++G 
Sbjct: 620  CNVVRGGILQNIKFIEAKHICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGP 679

Query: 592  LPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGD 651
            LP+ I+LAVTIGASRNVY+SLPE AFKDK+IKDP+++ + E F+LP+KE L +DF  +G 
Sbjct: 680  LPKPIALAVTIGASRNVYISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGS 739

Query: 652  IELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGN 711
            IE +N L D HCCW+NFMNIS+AI+LVEDA+    D F++ F +RY+GL I YGKDRCGN
Sbjct: 740  IEQINMLNDSHCCWVNFMNISSAIRLVEDAST-KQDHFNQLFDHRYEGLVINYGKDRCGN 798

Query: 712  VNKNLVXXXXXXXXXXXXXXXXNIRLRKQQKGASDAPTEVKDEAK-ELDKPIKADAFGIS 770
            +N+NLV                ++RL + ++   +   E ++     + +    DAF I+
Sbjct: 799  INRNLVAGKTSKYHKKVKKHTRDVRLSQLEEKRRNQDAERREMVNGTIPEENPFDAFAIN 858

Query: 771  VGDTQNLVRXXXXXXXXXXXXXXXXXXXNNTGGGLGISLASSTGEETNTPXXXXXXXXXX 830
             G  +                             LGIS+         +P          
Sbjct: 859  TGSAEKKDELSL--------------------DSLGISIMEVESASPISPVMGDLEDHTN 898

Query: 831  XXXXXXXXXILVSAPGSADTSQLESKTAPRSPKQPRVLANVPE-KPSAFSAIIPRVSSAS 889
                      L     S  +S +E    P  P  P     V E  PS  S    +    +
Sbjct: 899  GSYTDAGIAPLNYTNNSGSSSDIELIINP--PNDPNRSVGVLEGDPSTLSPPSDKRKLVA 956

Query: 890  LDAV----PPLAPSTLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLHPRR 945
            L  V    PPLAP T+SRQY   S HN         T    P     ++++ +   H ++
Sbjct: 957  LHEVSSPPPPLAPDTISRQYAEASYHNEL------VTGNDHPDTGYGKAENGR---HRQQ 1007

Query: 946  --RKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDE 988
              R ++ IPGSDVMAQYLAQLQHSTFMYAAN+LG  +  T  YD+
Sbjct: 1008 LPRNARTIPGSDVMAQYLAQLQHSTFMYAANVLGASNEGTEQYDD 1052

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  480 bits (1235), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 299/842 (35%), Positives = 424/842 (50%), Gaps = 129/842 (15%)

Query: 39  YYHGNRVPPAPQTPFDTSYGVXXXXXXXXXXXXXXATPGMGSASPHRAGGSRSSHAQSSY 98
           YY  + +P  P TPFDT+YG               ATP          G S+S+  Q  Y
Sbjct: 69  YYQTSPLPNVPPTPFDTAYGATLLPSHLLMGSPFVATPT--------TGHSQSAIFQQPY 120

Query: 99  H-TPNFGSTQLRMP-------PPTEKRNFKHGSSYRHNSSVQQRA------------YEV 138
             TPN  S   ++P       PP+ +R        R  SS + +             + +
Sbjct: 121 MMTPNRASFS-QIPSMLNVGNPPSARRQGNQNDPNRRRSSYRSKVPETDPKTLFLQPFRM 179

Query: 139 VFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLV--------- 189
            + ILP     G D Y TRSLLF N+     LH F+T+F +F  +ESVYL+         
Sbjct: 180 SYKILP----SGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLINHHDSDKPD 235

Query: 190 -DSQQQSVLVSFLTKETCLDFYNGVXXXXXXXXXXXXXXXXXXNFASLR----------- 237
            D++ +S+L+SFLT+E CL FYN V                  +F S++           
Sbjct: 236 DDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQDENEEEETN 295

Query: 238 --DVKTGPTLQEIKIEVLRAGATRSLILEFQDKV-DLALLSKSLGFIVNEG-PRYVVEAI 293
             D  +  T + +  E+    ATRS++++F++   +  L  K L F+  E   RY++E+I
Sbjct: 296 IVDEPSFYTKESVYFELSNPQATRSILIQFKNPCSEQELFDKKLKFLNQENNSRYILESI 355

Query: 294 EIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLKSQSN--------------KLAGLIK 339
           ++VN  ++   F  HYAI+ FI+I MA+E  +YLK                  K    + 
Sbjct: 356 DLVNVTQTENEFPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCMFVQVIPKAVSCVS 415

Query: 340 FRYVNTTSASGKSEFQTLSSSQLNERALSNTS--------DSDISGGESVASLGSKLQQT 391
            +  +  S    +  +TLSS Q     L N+S        +  +S  E +  L  KL+ T
Sbjct: 416 SKRASIISKDNDNNDETLSSQQKKNDILKNSSIISLPSAENDQVSDEEKLDKLSEKLKST 475

Query: 392 SLGEQTLVVDPTQYGRPLVEERSEHLPHVTISKAXXXXXXXXXXXXXXXXPQPQEVLVND 451
           ++ E  L+VD   Y RP      EHLP+ T+S +                P  Q++  + 
Sbjct: 476 NIEELILIVDTATYPRPSFLSHDEHLPNATLSLSSSSN------------PFEQQLPYSY 523

Query: 452 HEDSSSRGSMVSLK-QANSHGPAYPPIPG----------------YP--FYMN------- 485
            ED   R ++ S    AN   P  P +P                 YP  +++N       
Sbjct: 524 EEDDDQRTNVRSGSLPANPQFPNMPNLPKGYISPNPNMNYNTPLMYPNGYFVNDPAFSMN 583

Query: 486 --------MSKPLGXXXXXXXXXXXXXXXXMGGGLGNRTVYIGNISPRSKTEDICNVVRG 537
                      P+                 +G   GNRT+YIGNI+ RSK EDICNVVRG
Sbjct: 584 NNYNNNTNYRNPISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRG 643

Query: 538 GILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSIS 597
           GILQ+VKYIE KHICF+TFIEA++A+ F+ANS I+PIVLH + LK+GWG++   LP++++
Sbjct: 644 GILQNVKYIEHKHICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVA 703

Query: 598 LAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNF 657
           LAVT+GASRNVYVSLPE AFKDKFI DPEYQE+ +K++LP  +QL  DFS +G IE +N+
Sbjct: 704 LAVTVGASRNVYVSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINY 763

Query: 658 LEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLV 717
           L+D HCCW+NF+NIS AI+LVEDA+NP    F EKF NRY GL I YGKDRCGNVNK+L+
Sbjct: 764 LKDSHCCWVNFLNISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLM 823

Query: 718 XXXXXXXXXXXXXXXXNIRLR---KQQKGASDAPTEVKDEAKELDKPIKADAFGISVGDT 774
                           N++L+   +++K  ++    ++  +    +  K DAFGI +   
Sbjct: 824 SNKNSRFYKKVKSISNNVKLKELEEKRKADTERLNSLRKTSSSDGQLSKLDAFGIGIDTV 883

Query: 775 QN 776
            N
Sbjct: 884 SN 885

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%)

Query: 935  QDSKKPLHPRRRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDE 988
            Q + K  +   ++++ IPGSDVMAQYLAQLQHSTFMYAANILG    +  +YDE
Sbjct: 1025 QKNNKKHNTNDKEARVIPGSDVMAQYLAQLQHSTFMYAANILGASAEDGSYYDE 1078

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
           Anc_8.844 YML117W
          Length = 1042

 Score =  472 bits (1215), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 300/765 (39%), Positives = 420/765 (54%), Gaps = 104/765 (13%)

Query: 39  YYHGNRVPPAPQTPFDTSYGVXXXXXXXXXXXXXXATPGM-------------------G 79
           YY G+ +P AP TPFDT+YG               ++P +                   G
Sbjct: 64  YYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNVPTPQQQYFLQQQFNTNNNNG 123

Query: 80  SASPHRAGGSRSSHAQSSYHTPNFGSTQLRMPPPTEKRNFKHGSSYRHNSSVQQRAY--- 136
           S++P ++    S+   SS  +  F  ++ R           + ++  +N  + ++ +   
Sbjct: 124 SSTPRKSFFKVSNRPISS-RSSRF--SEKRKSFIINNPTTNNSNNNNNNKEILEKLFTEP 180

Query: 137 -EVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLV----DS 191
             + + ILP+    G D Y TRSLLF N++   +LH F+T F K + +ES+YLV    DS
Sbjct: 181 INISYVILPK----GDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPNKNDS 236

Query: 192 QQQSVLVSFLTKETCLDFYNGVXXXXXXXXXXXXXXXXXXNFASLRDVKT-----GPTLQ 246
               +++SFL++  CLDFYN V                  NF SL+  KT     GP+L+
Sbjct: 237 NTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKTTRDNQGPSLE 296

Query: 247 EIKIEVLRAGATRSLILEF-QDKVDLALLSKSLGF--IVNE------GPRYVVEAIEIVN 297
                ++   ATRSL +E   ++ D  +L K   F  I+NE        RYV+E+I++V+
Sbjct: 297 ---FNIVTRDATRSLAIELCSNENDSLILEKEQLFEKILNEILRTDENKRYVLESIDLVS 353

Query: 298 AGRSSKHFGPHYAIIHFISIAMALETVEYLKSQSNKL----------AGLIKFRYVNTTS 347
             +S+K FG +YAI+ F++I MA+E ++Y++  S+KL            LI+   +N +S
Sbjct: 354 TDKSNKEFGKNYAILSFLNITMAIEIMDYIQVISSKLNIGKCSFVTIQPLIENNVMNNSS 413

Query: 348 A-SGKSEFQTLSSSQ--------------LNERALSNTSDSDISGGESVASLGSKLQQTS 392
           A S  +  Q+  SS+               N      +S+S +S  E V S+  KL+   
Sbjct: 414 ALSSATNIQSSVSSEGNNNQNNNGSTFFHKNSINSLLSSESSVSIDEEVISIADKLKGIK 473

Query: 393 LGEQTLVVDPTQYGRPLVEERSEHLPHVTISKAXXXXXXXXXXXXXXXXPQPQEVLVNDH 452
           L + +L + P  Y  P     ++HLP+VTIS                  P+ QE+ +ND 
Sbjct: 474 LKDISLDILPRDYPEPEFNFSTDHLPNVTIS-------VPTQLDQIPGTPRTQEIYINDM 526

Query: 453 EDSSSRGSMV----SLKQANSHGPAYPP--IPGYPFYMNMSK--------------PLGX 492
             S     M+    ++   N    +  P  IP   FYM+ +               P+  
Sbjct: 527 SPSFEGIDMMNSSSTMLSGNGTFISNTPMLIPSQSFYMDQNTQIQEAPFRSNSFIHPITD 586

Query: 493 XXXXXXXXXXXXXXXMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHIC 552
                          MG   GNRT+YIGNI+PRSK EDICNVVRGGILQS+K+IE+KHIC
Sbjct: 587 SLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESKHIC 646

Query: 553 FVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSL 612
           FVTFIEAA+AVQF+AN+ I+PIVLHGN LK+GWG++SG LP+SI+LAVTIGASRNVYVSL
Sbjct: 647 FVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVYVSL 706

Query: 613 PEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNIS 672
           PE AFKDK+I DPE++E+ EKF+LP  EQL  DFS +G  E +N+L D HCCW+NFMNIS
Sbjct: 707 PEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFMNIS 766

Query: 673 NAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLV 717
           +AIKLVE+A N + D F+EKF  RY GL I YGKDRCGN+NKNL+
Sbjct: 767 SAIKLVEEATN-DFDRFNEKFDERYNGLVINYGKDRCGNINKNLI 810

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 33/39 (84%), Gaps = 1/39 (2%)

Query: 950  AIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDE 988
             IPGSDVMAQYLAQLQHSTFMYAANILG   GE  +YDE
Sbjct: 996  TIPGSDVMAQYLAQLQHSTFMYAANILGA-SGEEEYYDE 1033

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  469 bits (1207), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 289/729 (39%), Positives = 393/729 (53%), Gaps = 79/729 (10%)

Query: 45  VPPAPQTPFDTSYGVXXXXXXXXXXXXXXATPGMGSASPHRAGGSRSSHAQSSYHTPNFG 104
           +PP PQTPFD +YG               +TP    A  H +    SSH  S +H  +  
Sbjct: 56  MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTPLRPQAHFHPSTPGHSSH--SLHHAQSAR 113

Query: 105 STQLRMP--------PPTEKRNFKHGSSYRHNSSVQQRAYEVVFHILPRSADGGGDEYMT 156
           S+ L  P        PP  K++     S           Y + F ILP+    G DEYMT
Sbjct: 114 SSFLYYPQPPMLKPIPPRRKKSVTLNHS---------EPYHINFKILPK----GKDEYMT 160

Query: 157 RSLLFSNLNP--DTHLHDFLTKFEKFDRVESVYLVDSQQQSVLVSFLTKETCLDFYNGVX 214
           RSLL +NL    D  +H+FL  F KF  VES+YL+D    S+L+SFLTK TCLDFYN + 
Sbjct: 161 RSLLLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMDDNH-SILLSFLTKATCLDFYNNLL 219

Query: 215 XXXXXXXXXXXXXXXXXNFASLRDVKTGPTLQEIKIEVLRAGATRSLILEFQDKV----- 269
                            +F    +       + +++ V+  GATRSL +EF+D V     
Sbjct: 220 QRFSEFKTKLHSPKLSVSFVCQDESSW---FKYLQMNVVTRGATRSLTVEFEDSVKELNE 276

Query: 270 DLALLSKSLGFIVNEGPRYVVEAIEIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLKS 329
           D   L     F      R+V+E I+++NA   ++HFG  Y I+HFISI+MALE  ++L+ 
Sbjct: 277 DFVRLKFPWLFCSQ---RFVLERIDLINATTVNQHFGTRYMILHFISISMALEVDDFLQQ 333

Query: 330 QSNKLA---GLIKFRYVNTTSASGKSEFQTLSSSQLNERALSNTSDSDISGGESVASLGS 386
            S K       I+F  VN   +    E    +++ L + + +++  S      + A L +
Sbjct: 334 PSQKRQLNISRIQFVNVNGHHSKLSDEEAAAAANGLQQDSRTSSVSSISLSISNTADLAA 393

Query: 387 KLQQTSLGEQTLV--VDPTQYGRPLVEERSEHLPHVTISKAXXX-----------XXXXX 433
                 L   TL   V P++Y  PL+E+ SEHL  +TIS+                    
Sbjct: 394 LFHSLDLSLDTLSLQVVPSEYPTPLIEQHSEHLTSITISRPSKTLGPSASLIEMDSNATN 453

Query: 434 XXXXXXXXPQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAY-----------PPIP---- 478
                        VL  +   SS    M+   + N + P             PP P    
Sbjct: 454 AGNHHGVSSSLSGVLFMNDPSSSGSTPMIVPSELNLNTPVMGGPMQGQLMPGPPQPMSLH 513

Query: 479 -------GYPFYMNMSKPLGXXXXXXXXXXXXXXXXMGGGLGNRTVYIGNISPRSKTEDI 531
                  G P Y  M   +G                   G+ NRTVYIGNI PRSK EDI
Sbjct: 514 NPSDGNGGSPSYF-MDPMVGAPIGQTLQRQYLAGASQANGINNRTVYIGNIHPRSKPEDI 572

Query: 532 CNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGN 591
           CNVVRGGILQ++K+I +K ICFVTFIE A+AVQF+AN+++EPIVLHGN+L+VGWG  SG 
Sbjct: 573 CNVVRGGILQTIKWISSKRICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGE 632

Query: 592 LPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGD 651
           LP++I+LAVTIGASRNVYVSLPE++FK+K+I +PE++ +  K++LP++EQL +DF+ +G 
Sbjct: 633 LPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQ 692

Query: 652 IELVNFLEDGHCCWINFMNISNAIKLVEDANNP---NNDSFHEKFGNRYKGLFIGYGKDR 708
           +E +N+LEDGHCCW+NFMNI++AI+LVED+N+P   N + FH +F  RYK L IGYGKDR
Sbjct: 693 VEQINYLEDGHCCWVNFMNIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDR 752

Query: 709 CGNVNKNLV 717
           CGNVNKNL 
Sbjct: 753 CGNVNKNLA 761

 Score = 70.5 bits (171), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 47/110 (42%), Positives = 64/110 (58%), Gaps = 9/110 (8%)

Query: 886  SSASLDAVPPLAPSTLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLHPRR 945
            S+ SLDA PPLAPS++ +Q+ A  +     G    +T+ S+ +YN     ++      RR
Sbjct: 934  SAGSLDAPPPLAPSSM-QQHLADRRPRHTPGR---STDSSASQYNSQTPTNANYKSRRRR 989

Query: 946  RK--SKAIPGSDVMAQYLAQLQHSTFMYAANILG---VDDGETVFYDENG 990
            +   SK I G DVM+QYL QL HSTF+YA NILG   V +    +YD NG
Sbjct: 990  QAKFSKPIAGQDVMSQYLEQLHHSTFLYATNILGATTVQEPLGGYYDSNG 1039

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
           {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
           YML117W NAB6 Putative RNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 1259

 Score =  463 bits (1191), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 271/698 (38%), Positives = 379/698 (54%), Gaps = 107/698 (15%)

Query: 136 YEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLV----DS 191
           + V + +LP+    G DEY TRSLLF N+N    L+ F++K+ ++  VES+Y+     D 
Sbjct: 215 FVVTYRMLPK----GDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFKDRNDK 270

Query: 192 QQQSVLVSFLTKETCLDFYNGVXXXXXXXXXXXXXXXXXXNFASLR-------------- 237
            + SVL+SFL+++ CLD YN V                  +F SL+              
Sbjct: 271 TKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYRKHVDENEVDQND 330

Query: 238 ---------------------------DVKTGPTLQEIKIEVLRAGATRSLILEFQDKVD 270
                                      D      +  ++ +++  GATRS+ LE   + D
Sbjct: 331 NSSSTPMNETDDTDASKTPVATSNVQDDAYNVTVVASLQYDIVNRGATRSVALELDGEYD 390

Query: 271 -LALLSKSLGFIV-NEGPRYVVEAIEIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLK 328
              LL + L F+      RYV+E+I ++NA    KHF  +YAI+ F++I+MA+E ++Y++
Sbjct: 391 KTKLLDQELDFLSPANNQRYVLESIYLINAKEPFKHFPKNYAILTFLNISMAVEVLDYVR 450

Query: 329 SQSNKLAGLIKFRYVNTTS--------------------ASGKSEFQTLSSSQLNERALS 368
           +     +   K  +V+ +S                    ASG S     ++  L      
Sbjct: 451 NNETARSKFQKCFFVSVSSCPQTSSDGGIVTTSNSITPVASGGSA-GIATNGDLGGYTSK 509

Query: 369 NTSDSDISGGESVASLGSKLQ--QTSL-GEQTLVVDPTQYGRPLVEERSEHLPHVTISKA 425
           N S S ++   S  SL  ++    +SL G  T+ V   +Y +P   E S+HL + ++ +A
Sbjct: 510 NASLSSLNSVGSYISLDQEIDFLSSSLKGSHTITVAVDEYPKPFFAEFSDHLSNASVLEA 569

Query: 426 XXXXXXXXXXXXXXXXPQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPP------IPG 479
                           P PQEV+V   +DS   G    L   +   PA  P      +P 
Sbjct: 570 SALDTQISS-------PHPQEVIV-PSQDSPLVGGAPPLDAVH---PAATPALSSQVLPL 618

Query: 480 YP-------FYM--------NMSKPLGXXXXXXXXXXXXXXXXMGGGLGNRTVYIGNISP 524
            P        YM         M KP+                 MGGG+GNRTVYIGNI P
Sbjct: 619 QPHMAMNSGIYMEPFGRRNKTMIKPITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHP 678

Query: 525 RSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVG 584
           RSK EDICNVVRGGILQS+++++ KHICFVTFIEA++AVQF+ N+ I+PIVLHGN+LKVG
Sbjct: 679 RSKPEDICNVVRGGILQSIRFLQDKHICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVG 738

Query: 585 WGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYE 644
           WGHHSG LP+S+SLAVT+GASRNVYVSLP+ AFKDK+I DP+YQ + ++++LP++EQL  
Sbjct: 739 WGHHSGPLPKSVSLAVTVGASRNVYVSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRN 798

Query: 645 DFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGY 704
           DF+ FGDIE +NFL DGHCCW+NFMNIS+AIKLVE+    + ++FH+ F NRY+GL IGY
Sbjct: 799 DFNQFGDIEQINFLSDGHCCWVNFMNISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGY 858

Query: 705 GKDRCGNVNKNLVXXXXXXXXXXXXXXXXNIRLRKQQK 742
           GKDRCGNVNKNL+                NIRL + ++
Sbjct: 859 GKDRCGNVNKNLISGKNSRFYKKVKKPSYNIRLSRMEE 896

 Score = 75.9 bits (185), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 71/149 (47%), Gaps = 46/149 (30%)

Query: 885  VSSASLDAVPPLAPSTLSRQYTATSKHNS-----RR------------------------ 915
            VS+ S+   PP+APST+SR Y+   K  +     RR                        
Sbjct: 1110 VSNPSISMNPPIAPSTISRNYSLMMKTQNGHPHPRRDSSDRQNQQQQQQQQQQQQQQQQQ 1169

Query: 916  --------------GSRFGTTEKSSPRYNDIRSQDSKKPLHPRRRKSKAIPGSDVMAQYL 961
                           S   + ++ S    + R Q  K     +RR +KAIPGSDVMAQYL
Sbjct: 1170 QQQHQQQQQQQPNPSSSHNSGDRMSSHVGNSRGQQGKG--RNKRRNAKAIPGSDVMAQYL 1227

Query: 962  AQLQHSTFMYAANILGVD-DGETVFYDEN 989
            AQLQHSTFMYAANILG   +G+  +Y++N
Sbjct: 1228 AQLQHSTFMYAANILGATAEGDVDYYEDN 1256

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] {ON}
            some similarities with uniprot|Q03735 Saccharomyces
            cerevisiae YML117w
          Length = 1050

 Score =  455 bits (1170), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 333/1038 (32%), Positives = 488/1038 (47%), Gaps = 156/1038 (15%)

Query: 48   APQTPFDTSYGVXXXXXXXXXXXXXXAT---PGMGSASPHRAGGSRSSHA---------- 94
             P TPFDT+YG               +T   P   +A     G +R++ +          
Sbjct: 49   VPPTPFDTAYGASLLPSHLLMGSPMISTTNLPRDNNADLLAGGYNRNNRSFQFRRNSGFV 108

Query: 95   -QSSYHTPNFGS--TQLRMPPPTEKRNFKH------GSSYRHNSSVQQRA---------- 135
             QS+ +TP   S  + L   P ++KR  K+      GS  +     ++R           
Sbjct: 109  LQSNGNTPYMSSKRSSLSQAPMSQKRAEKNSTDSSVGSHGKKKLQHKKRTPIDVTKKLIS 168

Query: 136  -YEVVFHILPRSADGGGDEYMTRSLLFSNLNP-DTHLHDFLTKFEKFDRVESVYLV---- 189
               + + +LP     G D Y TRSLLF N+   D  L  F+     + +VESVY+     
Sbjct: 169  PISINYRVLP----SGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQVESVYVFQQTD 224

Query: 190  --------DSQQQSVLVSFLTKETCLDFYNGVXXXXXXXXXXXXXXXXXXNFASL----- 236
                    D     + +SFL+++  LDFYN                    +F S      
Sbjct: 225  TPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSVSFVSFSYVTD 284

Query: 237  -----------------RDVKTG------PTLQEIKIEVLRAGATRSLILEFQDKVDLAL 273
                             R++K        P L E   E+    ATRS+ +EF  +V+   
Sbjct: 285  EDKDKDKDKDKDINTEKRNIKRSQELLKEPALGE---EIFSHDATRSIAIEFYSQVEQDA 341

Query: 274  LSKSLGFIVN-EGPRYVVEAIEIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLKSQSN 332
            L + L F+ + +  RY++EA++I++A  ++  F  +Y I+ FI+I MA+E ++YLK+   
Sbjct: 342  LFEKLPFLDDKDNKRYILEAVDIISAEDAADDFPANYVILTFINIKMAIEVLDYLKANLM 401

Query: 333  ----------KLAGLIKFRYVNTTSASGKSEFQTLSSSQLNERALSNTSDSDISGGESVA 382
                       L G    R  +TT   G     T  S  ++E  L+N  ++ +   E + 
Sbjct: 402  TYSVNECFFVSLPGCKSQRESSTTPVLG--HISTEGSKSVSEVNLANGGNTVMIDRE-LE 458

Query: 383  SLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHVTISKAXXXXXXXXXXXXXXXXP 442
            SL  +L    L E+ L +  + Y +P +    +H+P  T                    P
Sbjct: 459  SLSDELASLKLEEKCLKIIRSDYPKPEIRSHDDHIPGST--------NFSMYIFDDGMNP 510

Query: 443  QPQEVLVNDHEDSSSRGSMVSLKQANSHGPA---------------------YP--PIPG 479
            +    +   H++ +   S++    +N   P+                     +P  PI G
Sbjct: 511  EGNSGMYL-HDNLTDHSSIIGSPFSNYIDPSISHVMLPNNGLPVGGFDAPGKFPIEPISG 569

Query: 480  YPFYMNMSKPLGXXXXXXXXXXXXXXXXMGGGLGNRTVYIGNISPRSKTEDICNVVRGGI 539
             PF  + +K +                 MGG   NRTVYIGNI+PRSK EDICNVVRGGI
Sbjct: 570  PPF-NHTNKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGI 628

Query: 540  LQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLA 599
            LQ+VK+IE K ICFVTFIEA++A QF ANS I+PIVLHGN L+VGWG+ SG LP+SI+LA
Sbjct: 629  LQNVKFIEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALA 688

Query: 600  VTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLE 659
            VT+GA+RNVYVSLPE+AFKDKFI DP+Y+E+ E+++LPS+EQL +DF+ +G+IE +N+L+
Sbjct: 689  VTVGANRNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLK 748

Query: 660  DGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVXX 719
            D HCCW+NF+NI++AI+LVED N+ N + FH+KF NRY+GL I YGKDRCGN+NKNL+  
Sbjct: 749  DSHCCWVNFINIASAIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKDRCGNINKNLIAG 808

Query: 720  XXXXXXXXXXXXXXNIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGISVGDTQNLVR 779
                          +IR++K ++        +  + K     I+ D+ GISV  T     
Sbjct: 809  KGSKFYKKVKKPSYDIRIKKMEEKRKMQEDNLLSQKK---NSIQLDSLGISVDRT----- 860

Query: 780  XXXXXXXXXXXXXXXXXXXNNTGGGLGISLASSTGEETNTPXXXXXXXXXXXXXXXXXXX 839
                                   GG+   L S+  +  +                     
Sbjct: 861  ------FSNESKLSGGHTTTEENGGVKQDLESNDYKSDHPQISSNGPIGIGLSSKKSPIF 914

Query: 840  ILVSAPGSADTSQLESKTAPRSPKQPRVLANVPEKPSAFSAIIPRVSSASLDAVPPLAPS 899
              +S    +  S  E+  +  +    R       +   F   +P+ +   L   PP APS
Sbjct: 915  DDISGSDESVISDFENSASKETSSSDRKYQTTNSRGDTF---VPKTN---LSHAPPRAPS 968

Query: 900  TLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLHPRRRKSKAIPGSDVMAQ 959
            T++  Y   S      G         +P+ +  +         P ++ ++ IPGSDVMAQ
Sbjct: 969  TINMTYKKISYVPPLNG--------QAPKMDYPKKYKRTHNNFPNQQPTRPIPGSDVMAQ 1020

Query: 960  YLAQLQHSTFMYAANILG 977
            YLAQLQHSTFMYAANILG
Sbjct: 1021 YLAQLQHSTFMYAANILG 1038

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
           (REAL)
          Length = 1131

 Score =  441 bits (1134), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 307/895 (34%), Positives = 427/895 (47%), Gaps = 168/895 (18%)

Query: 32  GSREYSGYYHGNRVPPAPQTPFDTSYGVXXXXXXXXXXXXXXATPGM-GSASPHRAGGSR 90
           G  ++  YY  + +P  P TPFDT+YG               ++P M G  SP R+    
Sbjct: 47  GPSQHPAYYSNSPLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARS---- 102

Query: 91  SSHAQSSYHTP-------------NFGSTQLRMPPPTEKRNFKHGSSYRHNSSVQ----- 132
           S+  + +Y  P             N  +    M  P+     +  S  R+N+S +     
Sbjct: 103 SNFKRKAYSRPVSNHNNYNGNNNSNQNNNNNGMVTPSNYYRIERNSFSRNNNSTRNSTHN 162

Query: 133 ------------------------------QRAYEVVFHILPRSADGGGDEYMTRSLLFS 162
                                         QR + + + ILP     G D Y TRSLL  
Sbjct: 163 NKGCDNRNSSGRRTSTRNNIFDDISSELLLQRPFRINYKILP----TGDDAYRTRSLLIE 218

Query: 163 NLNPDTHLHDFLTKFEKFDRVESVYLVDSQQQ-----------SVLVSFLTKETCLDFYN 211
           N++  T LH  +  F K + +ES Y++ +++            S+L+SFLT+  CL+FYN
Sbjct: 219 NVDRSTDLHSIVKNFVKSNTLESTYIIGNEKSDDLKDEQTSNLSILISFLTRSDCLNFYN 278

Query: 212 GVXXXXXXXXXXXXXXXXXXNFASLR-DVKTGPT----------LQEIKI---------- 250
            +                   F  L  D K   T          +++I I          
Sbjct: 279 NILQRLSEFKTFLKSESLNLKFVCLNYDFKCLSTFIEDDALTENVEQIDITNDSSMISAS 338

Query: 251 ---EVLRAGATRSLILEFQDKV-DLALLSKSLGFI-VNEGPRYVVEAIEIVNAGRSSKHF 305
              ++    ATRS+I+EF+  +    L +K L F+  +   RY++E+I+IVN    S  F
Sbjct: 339 LHHDLENKDATRSIIVEFKSPLKSTELFNKKLQFLDRSNNKRYILESIDIVNTDVPSNQF 398

Query: 306 GPHYAIIHFISIAMALETVEYLKSQSNKLAGLIKFRYVNTTS---ASGKSEFQTLSSSQL 362
             +YA++ F++I MA+E ++YLK  S KL G+ K  YV+      +S +S    +   + 
Sbjct: 399 PENYAVLTFLNIFMAIEVLDYLKKYSKKL-GISKCFYVSLAPLVISSTRSSVANIYEIKT 457

Query: 363 NERALS-------------------------NTSDSD---------------------IS 376
           +   LS                         NT +S+                     +S
Sbjct: 458 STHRLSVPSVPVENNNDNNNSNNHKSNISDANTHNSNNSTRASLYGNSNVSLASLPSSVS 517

Query: 377 GGESVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHVTISKAXXXXXXXXXXX 436
             E +  L +KLQ   L    L ++   Y  P V E S HL +V ISK            
Sbjct: 518 LNEEIDILTTKLQGIQLDGTDLEINYHDYQTPTVHEHSTHLSNVKISKT-VENSRQFPHD 576

Query: 437 XXXXXPQPQEVLVNDHEDSSSRGSMVSLKQANSHGPAYPPIPGYPFYMN---MSKPLGXX 493
                P  + + +ND   + S GS+V  +   +  P    I      MN   +  P+   
Sbjct: 577 IPSPLPLNERMFMND--SNHSNGSIVPQQLMATPSPVSSTIQ-----MNQRVLPNPITQS 629

Query: 494 XXXXXXXXXXXXXXMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICF 553
                         MG  +GNRT+YIGNI+PRS+ EDICNVVRGGILQS+KY+  K ICF
Sbjct: 630 LEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMPEKRICF 689

Query: 554 VTFIEAASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLP 613
           VTFIEA SAVQF+ANS I+PIVLHGN+L+VGWGH+SG LP+SISLAVTIGASRNVYVSLP
Sbjct: 690 VTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLP 749

Query: 614 EHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISN 673
           E AFK+KFI DP+Y++  E   LP  EQL EDFS +GDIE +N+L D HCCWINFMNIS+
Sbjct: 750 EFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISS 809

Query: 674 AIKLVEDAN------NPNNDSFH-----EKFGNRYKGLFIGYGKDRCGNVNKNLVXXXXX 722
           AI LVE+ N      N + +  H     +KFG RY+GL I YGKDRCGN+NKNLV     
Sbjct: 810 AISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNLVAGKNS 869

Query: 723 XXXXXXXXXXXNIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGISVGDTQNL 777
                      NIRL K ++       + K+ A   DK +  ++ GIS+   +++
Sbjct: 870 RFYKKVKRPSYNIRLSKLEERRRQNENDKKERA--FDKALNLESLGISLDSHKDI 922

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
           (REAL)
          Length = 1122

 Score =  439 bits (1128), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 307/883 (34%), Positives = 423/883 (47%), Gaps = 164/883 (18%)

Query: 32  GSREYSGYYHGNRVPPAPQTPFDTSYGVXXXXXXXXXXXXXXATPGMG-------SASPH 84
           G  ++  YY  + +P  P TPFDT+YG               ++P M        S+  +
Sbjct: 47  GPSQHPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYNLGRSSKFN 106

Query: 85  RAGGSRSSHAQSSYHTPNFGSTQLR------MPPPTEKRNFKHGSSYRHNSSVQ------ 132
           R   SR   +Q+SY+  +  +          M P +  RN +   S + N++V       
Sbjct: 107 RKAYSRPISSQNSYNANHNNNNNNSNSNNGMMTPSSYYRNGRTLFSRKDNNAVNVTHNIH 166

Query: 133 -----------------------------QRAYEVVFHILPRSADGGGDEYMTRSLLFSN 163
                                        Q+ + + + ILP     G D Y TRSLL  N
Sbjct: 167 KGYETRNSSGRRTSSRINIFDEIDPETLLQKPFRINYKILP----AGDDAYRTRSLLIEN 222

Query: 164 LNPDTHLHDFLTKFEKFDRVESVYLVDSQQQ-----------SVLVSFLTKETCLDFYNG 212
           ++    LH  +  F K + +ES Y+V S++            S+L+SFLT+  CL+FYN 
Sbjct: 223 VDDSADLHSLVKNFVKSNALESAYIVGSKETDNLEKEETKNLSILISFLTRGDCLNFYNN 282

Query: 213 VXXXXXXXXXXXXXXXXXXNFASLR-DVKTGPTLQE-----------------------I 248
           +                   F  L  D K+ PT  E                       +
Sbjct: 283 ILQRLSEFKTFLKSKSLNLKFVCLNYDSKSLPTPVEDEELSRSEEQAATDDASTMISASL 342

Query: 249 KIEVLRAGATRSLILEFQDKVDLA-LLSKSLGFI-VNEGPRYVVEAIEIVNAGRSSKHFG 306
             +V    ATRS+I+EF+  ++ A L  + L F+  ++  RY++E+I+IV+    S  F 
Sbjct: 343 HHDVENKDATRSIIIEFKSPLEKAELFKEKLQFLDRSKNKRYILESIDIVDTDVPSNQFP 402

Query: 307 PHYAIIHFISIAMALETVEYLKSQSNKLAGLIKFRYVNTTSA-------------SGKSE 353
            +Y ++ F++I MA+E ++YLK  S KL G+ K  YV+ T                 KS 
Sbjct: 403 ENYVVLTFLNIFMAIEVLDYLKKYSKKL-GISKCFYVSLTPLMVSSARSSVASIYESKSS 461

Query: 354 FQTLSSSQL--------------------------NERALSNTSDSDISGGESVASLGSK 387
              LS+  +                          N      +  S +S  E +  L +K
Sbjct: 462 SHRLSTPSVPAGNNNDINNINNNNNNGSIGSSIYGNSNISLTSLSSSVSLNEEIEVLTTK 521

Query: 388 LQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHVTISKAXXXXXXXXXXXXXXXXPQPQEV 447
           LQ   L    L V    Y  P++ E S HL ++ ISK                   P  +
Sbjct: 522 LQGIDLDGTILEVTCHDYPTPVINEHSAHLSNIKISKTVDNSRQFTQDI-------PSPL 574

Query: 448 LVNDH----EDSSSRGSMVSLKQANSHGPAYP-PIPGYPFYMN---MSKPLGXXXXXXXX 499
            +N+H    + + S G++VS +   +  P  P P       MN   +  P+         
Sbjct: 575 PLNEHMFMTDSNQSNGTIVSQQLITAPSPQSPNP------QMNQRVLPNPITQSLEQNFN 628

Query: 500 XXXXXXXXMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEA 559
                   MG  +GNRT+YIGNI+PRS+ EDICNVVRGGILQ++KYI  K ICFVTFIEA
Sbjct: 629 VSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIAEKRICFVTFIEA 688

Query: 560 ASAVQFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKD 619
           ASAVQF+ANS I+PIVLHGN+L+VGWGH+SG LP+SISLAVTIGASRNVYVSLPE AFK+
Sbjct: 689 ASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKE 748

Query: 620 KFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVE 679
           KFI DP+Y++  E   LP  EQL EDFS +GDIE +N+L D HCCWINFMNIS+AI LVE
Sbjct: 749 KFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWINFMNISSAISLVE 808

Query: 680 DANNP---NNDS--------FHEKFGNRYKGLFIGYGKDRCGNVNKNLVXXXXXXXXXXX 728
           + N     ++DS          EKF  RYKGL I YGKDRCGN+NKNLV           
Sbjct: 809 EMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKV 868

Query: 729 XXXXXNIRLRKQQKGASDAPTEVKDEAKELDKPIKADAFGISV 771
                NIRL K ++          D+ +  DK +  ++ GIS+
Sbjct: 869 KRPSYNIRLSKLEERRRQNEN---DKKESFDKVLNLESLGISL 908

 Score = 72.0 bits (175), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 56/101 (55%), Gaps = 12/101 (11%)

Query: 888  ASLDAVPPLAPSTLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLHPRRRK 947
            +SL   PP APSTLS  +   SK N       G   + +       ++  K+   PR R 
Sbjct: 1034 SSLKQAPPRAPSTLSHNH---SKKNQMPIQDAGINAEVT------DNKTKKRGSFPRHR- 1083

Query: 948  SKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDE 988
               IPGSDVMAQYLAQ+QHSTFMYAANILG    +  + DE
Sbjct: 1084 --TIPGSDVMAQYLAQVQHSTFMYAANILGASAEDNAYSDE 1122

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
           (REAL)
          Length = 1128

 Score =  422 bits (1085), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 273/738 (36%), Positives = 370/738 (50%), Gaps = 115/738 (15%)

Query: 133 QRAYEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLVDSQ 192
           QR + + + ILP     G D Y TRSLL  N++  T LH  +  F KF+ +ES Y VD+ 
Sbjct: 193 QRPFRINYKILP----TGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDND 248

Query: 193 QQ-----------SVLVSFLTKETCLDFYNGVXXXXXXXXXXXXXXXXXXNFASLR---- 237
           +            SVL+SFLT+  CL+FYN +                   F  L     
Sbjct: 249 KNDDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESE 308

Query: 238 ---DVKTGPTLQEIKIEVLRAG-----------------ATRSLILEFQDKVD-LALLSK 276
                  G   +E+  +V  A                  ATRS+I+EF+  ++   L  K
Sbjct: 309 CLSTFVEGEKPKEVDEQVHAANDSMMISASLHHDVENKDATRSIIIEFKSALEKTELFRK 368

Query: 277 SLGFI-VNEGPRYVVEAIEIVNAGRSSKHFGPHYAIIHFISIAMALETVEYLKSQSNKLA 335
            L F+  ++  RY++E+I++VN    S  F  +YA++ F++I MA+E ++YLK  S  L 
Sbjct: 369 RLQFLDESKNKRYILESIDLVNTDVPSNQFPENYAVLTFLNIFMAVEVLDYLKKFSKSLE 428

Query: 336 GLIKFRYVNTT---SASGKSEFQTLSSSQLNERALS------------------------ 368
            + K  YV+ T    +S +S    +  S+   R LS                        
Sbjct: 429 -ISKCFYVSLTPLMVSSTRSSVANIYESKTTTRRLSVPSVPAGIKNDNNNNSNKGNISSI 487

Query: 369 NTSDSDISGG---------------------ESVASLGSKLQQTSLGEQTLVVDPTQYGR 407
           N  +++ S G                     E +  L +KLQ   L   +L +    Y  
Sbjct: 488 NAQNNNSSIGSSIYGNSNISLTSLSSSVSLNEEIDLLTTKLQGIELDGTSLEITSHDYST 547

Query: 408 PLVEERSEHLPHVTISKAXXXXXXXXXXXXXXXXPQPQEVLVNDHEDSSSRGSMVSLKQA 467
           P + E S HL ++ ISK                 P  +++ +ND   + S G+++  +  
Sbjct: 548 PTINEHSTHLSNIKISKTVENSRHFPQDIPSPL-PLNEQMFMND--SNQSNGAVIPQQLI 604

Query: 468 NSHGPAYPPIPGYPFYMN---MSKPLGXXXXXXXXXXXXXXXXMGGGLGNRTVYIGNISP 524
                A P        +N   +   +                 MG  +GNRT+YIGNI+P
Sbjct: 605 -----AAPSPLSSNLQINQRVLPNAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINP 659

Query: 525 RSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVG 584
           RS+ EDICNVVRGGILQS+KYI  K I FVTFIEA SAVQF+ANS I+PIVLHGN+L+VG
Sbjct: 660 RSRAEDICNVVRGGILQSIKYIPEKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVG 719

Query: 585 WGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQLYE 644
           WGH+SG LP+SISLAVTIGASRNVYVSLPE AFK+KFI DP+Y++  E   LP  EQL E
Sbjct: 720 WGHYSGPLPKSISLAVTIGASRNVYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLRE 779

Query: 645 DFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPN-----------NDSFHEKF 693
           DFS +GDIE +N+L D HCCWINFMNIS+AI LVE+ N  +             +  EKF
Sbjct: 780 DFSTYGDIEQINYLSDSHCCWINFMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKF 839

Query: 694 GNRYKGLFIGYGKDRCGNVNKNLVXXXXXXXXXXXXXXXXNIRLRKQQKGASDAPTEVKD 753
             RYKGL I YGKDRCGN+NKNLV                NIRL K ++          D
Sbjct: 840 DGRYKGLLINYGKDRCGNINKNLVAGKNSRFYKKVKRPSYNIRLSKLEERRRQNEN---D 896

Query: 754 EAKELDKPIKADAFGISV 771
           + +  DK +  ++ GIS+
Sbjct: 897 KKESFDKVLNLESLGISL 914

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 32  GSREYSGYYHGNRVPPAPQTPFDTSYGVXXXXXXXXXXXXXXATPGM-GSASPHRA 86
           GS ++  YY  + +P  P TPFDT+YG               ++P M G  SP R+
Sbjct: 47  GSSQHPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQGGYSPARS 102

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar
           to uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
           Putative RNA-binding protein based on computational
           analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  390 bits (1001), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 224/555 (40%), Positives = 320/555 (57%), Gaps = 60/555 (10%)

Query: 193 QQSVLVSFLTKETCLDFYNGVXXXXXXXXXXXXXXXXXXNFASLRDVKTGPTLQEIKIEV 252
           QQS L+SF TKE+CLDFYN +                  NF  ++D +    +  +K+ V
Sbjct: 324 QQSYLLSFFTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQDDEEW--MANLKMNV 381

Query: 253 LRAGATRSLILEF-QDKVDLALLSKSLGFIVNEGPRYVVEAIEIVNAGRSSKHFGPHYAI 311
           +  GATRSL +EF  D V    +  +L F+ N G +YVV  +++V      K+FG HY +
Sbjct: 382 ISLGATRSLYVEFADDSVTSDTIWDTLPFLKNSG-KYVVIDVDVVTTDERRKNFGLHYCL 440

Query: 312 IHFISIAMALETVEYLKSQSNKLAGL------------IKFRYVNTTSASGKSEFQTLSS 359
           +HF+S+ MALE  E L++    ++ +            ++ R  +  S   ++  Q  S+
Sbjct: 441 LHFLSVTMALEVKELLETGDEAVSRVSFVTPANSADKEMRRRRSSAISLKQEASPQMFST 500

Query: 360 SQLNERALSNTSDSDISGGESVASLGSKLQ-------QTSLGEQTLVVDPTQYGRPLVEE 412
              +    SN S   +   E V++  + +          +L   TL+VD ++Y  P+V E
Sbjct: 501 DSRSRSRSSNVS---LPLSEQVSTASTDISTPIYEEFDGNLTWSTLIVDVSEYKEPIVNE 557

Query: 413 RSEHLPHVTISKAXXXXXXXXXXXXXXXXPQPQEVLVNDHEDSSSRGSMVSLKQANSHGP 472
              HL   +ISK                   P  + +  HE  ++  S  +L  ++   P
Sbjct: 558 FDHHLNSWSISK-------------------PTTLYM--HESGTTNFSSSNL--SDDIDP 594

Query: 473 ----AYPPIPG------YPFYMNMSKPLGXXXXXXXXXXXXXXXXMGGGLGNRTVYIGNI 522
               ++ P+P       YP+ M    P                  +  G+ +RTVYIGNI
Sbjct: 595 LSISSHDPVPQQMLLNEYPYIMEPLMP-PQITQTIQNQYSKSIQAVNAGMEHRTVYIGNI 653

Query: 523 SPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLK 582
           +PRSK EDICNVVRGGILQ +K++  K ICFVTFIE A+AVQF+AN+T+EPI+LHGNVLK
Sbjct: 654 NPRSKAEDICNVVRGGILQHIKWVSHKRICFVTFIETAAAVQFYANTTLEPIILHGNVLK 713

Query: 583 VGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKFQLPSKEQL 642
           VGWG + G LP++I+LAVT+GASRNVYVSLP+ AFKDKFI DP+++E++ ++++P+  QL
Sbjct: 714 VGWGQNPGPLPKNIALAVTVGASRNVYVSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQL 773

Query: 643 YEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFI 702
             DF  +G +E VNF  DGHCCWINFMNIS+AIKLVE+ ++  ++ FH+K   RY GL I
Sbjct: 774 KSDFGAYGTMEQVNFHSDGHCCWINFMNISSAIKLVEEYSDTKDNLFHKKTEGRYVGLII 833

Query: 703 GYGKDRCGNVNKNLV 717
           GYGKDRCGN+N+NLV
Sbjct: 834 GYGKDRCGNINRNLV 848

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (72%), Gaps = 1/48 (2%)

Query: 942  HPRRRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDEN 989
            +PR+   K I GSDVM +YL QL H+TF+YAANILG    + VFYDE+
Sbjct: 1103 NPRKSSMKPIAGSDVMTRYLEQLHHNTFVYAANILGATQ-DPVFYDED 1149

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 33/53 (62%), Gaps = 4/53 (7%)

Query: 140 FHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLVDSQ 192
           + ILP+    G D Y +RSLLF+N+N +  + +FL K  K   +ES+YL+  +
Sbjct: 219 YSILPK----GNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDE 267

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  378 bits (970), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 213/507 (42%), Positives = 283/507 (55%), Gaps = 51/507 (10%)

Query: 508  MGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFA 567
            MG  +GNRT+YIGN++PRSK ED+CNVVRGGILQS+K I +K ICFVTFIEA++AVQF+A
Sbjct: 721  MGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASKRICFVTFIEASAAVQFYA 780

Query: 568  NSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEY 627
            NS I+P++LHGN LK+GWG++   L +SI+LAVTIGASRNVYVSLPE AFKDKF+ DPEY
Sbjct: 781  NSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVYVSLPEFAFKDKFLNDPEY 840

Query: 628  QEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDA-NNPNN 686
            +EF EK++LPS++QL  DF+ +G IE +N+L D HCCW+NFMNI++AIKLVED  NNP +
Sbjct: 841  KEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFMNITSAIKLVEDVNNNPKD 900

Query: 687  DSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVXXXXXXXXXXXXXXXXNIRLRKQQKGASD 746
            ++F +KF +RY GL I YGKDRCGNVN+NL+                N +LR+ Q+    
Sbjct: 901  NTFSKKFNHRYDGLIINYGKDRCGNVNRNLISNKNSRHYRKVKKFSDNYKLRQLQEKRRV 960

Query: 747  APTEVKDEAKEL------DKPIKADAFGISVGDTQ--NLVRXXXXXXXXXXXXXXXXXXX 798
                 +++ KEL      +K    DA GI +  T      +                   
Sbjct: 961  E----QEKGKELNGGVNDNKLPSLDALGIGLQRTAPPEEQKVPESNEDDANYDSAVTESD 1016

Query: 799  NNTGGGLGISLASST-----------GEETNTPXXXXXXXXXXXXXXXXXXXILVSAPGS 847
             NT   LG  + S+T           GEE                       I+      
Sbjct: 1017 TNTFNALGFRIQSNTDSHDDEQNDEKGEEQEEVDVIAHADDISSVNSSDVEIIIDCPHNE 1076

Query: 848  ADTSQLESKTAPRSPKQPRV--LANVPEKPSAFSAIIPRVSSASLDAVPPLAPSTLSRQY 905
            +DTS ++ K       Q ++  LA       A +A+ P       + +P +        +
Sbjct: 1077 SDTSMIQEKKKTIRKNQQKIDRLA------KARNAMFPE----HRETIPDINNKLF---H 1123

Query: 906  TATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLHPRRRKSKAIPGSDVMAQYLAQLQ 965
               +K  +RR    G  +   P             L    ++ + IPG+DVMAQYL QLQ
Sbjct: 1124 DRKNKDKNRRKQVQGGIQDQDPH------------LSSTGKQQRVIPGADVMAQYLTQLQ 1171

Query: 966  HSTFMYAANILGVDDGETVFYDENGPT 992
            HSTFMYAANILGV   +  +YDE   T
Sbjct: 1172 HSTFMYAANILGVSAEDNTYYDEEDTT 1198

 Score =  125 bits (313), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 128/535 (23%), Positives = 210/535 (39%), Gaps = 146/535 (27%)

Query: 30  PEGSREYS----GYYHGNRVPPAPQTPFDTSYGVXXXXXXXXXXXXXXATPGMGSASPHR 85
           P GS+ ++     YY  + +P AP TPFDT+YG               +TP  G     +
Sbjct: 60  PNGSQYFATTQQAYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPN-GIVPSSQ 118

Query: 86  AGGSRSSHAQSSYHTPN---FGSTQLRMPPPTEKRNF---KHGSSYRHNSSVQ------- 132
                  ++QS   TPN   F      +  P+ + NF    + + Y++N   +       
Sbjct: 119 QQSQMFLYSQSPAGTPNRKSFSQLNSMLNQPSSRSNFFTDSYNNRYQNNPQTRIPEVDPN 178

Query: 133 ---QRAYEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLV 189
              Q+ + + + +LP     G D Y TRSLLFSN+     LH F+  F ++  +ES+YL+
Sbjct: 179 ELFQKPFVISYKLLP----TGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLI 234

Query: 190 -------------DSQQQSVLVSFLTKETCLDFYNGVXXXXXXXXXXXXXXXXXXNFASL 236
                        D  ++S+L+SFL++E CL FYN V                  NF  L
Sbjct: 235 SNTDDEKDQDNENDKNKRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVIL 294

Query: 237 --------------------------RDVKTGP--------TLQEIKIEVLRAGATRSLI 262
                                      DV T          T+  +K +++   ATR ++
Sbjct: 295 NYLEKTDDGSTANISNNQLNQIQENENDVNTNEFDYRNSMNTVNALKFDLINPDATRFIM 354

Query: 263 LEFQDKVDL-ALLSKSLGFIVN--EGPRYVVEAIEIVNA--------------------- 298
           +E + K D   LL+K L F+++  +  RY++E+I++ N                      
Sbjct: 355 IELKTKCDKETLLNKHLSFLIDNKKNIRYILESIDLFNIIENENSSENKSIIEAKNENEN 414

Query: 299 ----------------GRSSKHFGPHYAIIHFISIAMALETVEYLKSQSNKL----AGLI 338
                            RS + F  HYA++ FI+I MA+E  +YLK    K     A  +
Sbjct: 415 SPQGKEKDTMVQKRKRNRSKRTFPNHYAVLSFINIYMAMELRDYLKLNGLKHGITNASYV 474

Query: 339 KFRYVNTTSA--------------SGKSEFQTLSSSQLNER-------------ALSNTS 371
           + ++V  +                  KSE  T  S +  ++             +++ +S
Sbjct: 475 QIKHVKKSLNSSSKRSSVTSTTDNKDKSEVDTNESVEGKDKKSEEAKSFNNKLSSITMSS 534

Query: 372 DSDISGGE---SVASLGSKLQQTSLGEQTLVVDPTQYGRPLVEERSEHLPHVTIS 423
                 GE    +  + SKLQ+  L E   V+D   Y  PL +    H+ ++T+S
Sbjct: 535 PDTTYEGEDDIDIDIIISKLQKLKLKETIQVLDIATYNTPLFQSHDSHMANITLS 589

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,
           1032 aa] {ON} (7832..9475,9855..9863,10320..11765) [3099
           nt, 1033 aa]
          Length = 1032

 Score =  353 bits (907), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 168/267 (62%), Positives = 202/267 (75%), Gaps = 10/267 (3%)

Query: 508 MGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFA 567
           MGGG GNRTVYIGNI+PRSK EDICNVVRGG LQ +K+ + K ICFVTFIEAASA QF+A
Sbjct: 574 MGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEKGICFVTFIEAASAAQFYA 633

Query: 568 NSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEY 627
           NS I+PI+LH N L+VGWG HSG LP+SISLAVT+GASRNVYVSLPE+AFKDKFI DPEY
Sbjct: 634 NSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVYVSLPEYAFKDKFINDPEY 693

Query: 628 QEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPN-N 686
           +E+  K+ LP++E+L +DFS FG++E VNFL DGHCCWINFMNI +AIKLVE  N+ N  
Sbjct: 694 KEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFMNIRSAIKLVESVNSSNGG 753

Query: 687 DSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVXXXXXXXXXXXXXXXXNIRLRKQQKGASD 746
            +FHE++ NRYKGL IGYGKDRCGNVNK+L+                NIRL++ ++    
Sbjct: 754 KTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKVKKPSYNIRLQQLEE---- 809

Query: 747 APTEVKDEAKEL--DKPIKADAFGISV 771
              E K E K    +K I  ++FGI V
Sbjct: 810 ---ERKQEEKNKISNKSINLNSFGIQV 833

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 95/396 (23%), Positives = 164/396 (41%), Gaps = 101/396 (25%)

Query: 39  YYHGNRVPPAPQTPFDTSYGVXXXXXXXXXXXXXXATPGMGSA--------SPHRAGGSR 90
           YY    +P AP TPFD++YG               +TP MG +        SP + GG+ 
Sbjct: 112 YYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTMGQSYSQQFARPSPSK-GGNS 170

Query: 91  SSHAQSSYHTPNFGSTQLRMPPPTE------------------------KRNFKHGSSYR 126
                S+Y  P      + +PP +                          R   H S   
Sbjct: 171 MGRLSSAYPAP----PTINLPPSSRAHASSNNNNNNNNSSSSNNNNNNNNRRGNHNSHRN 226

Query: 127 HNSS------------VQQRA---YEVVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLH 171
            N++             Q+ +   + + + +LP+    G DEY TRSLLF N++    LH
Sbjct: 227 TNNNGGRFTQKNIIKRFQENSLNRFTISYKVLPK----GNDEYQTRSLLFENVDKSVDLH 282

Query: 172 DFLTKFEKFDRVESVYLVDSQ------------------------------QQSVLVSFL 201
            F+ KF  F  +ESVYL++S                                QS+L+SFL
Sbjct: 283 CFIKKFVNFGPIESVYLINSNGIYDNNKNNDDYDDDNDNNNDNDDNANNHDTQSILLSFL 342

Query: 202 TKETCLDFYNGVXXXXXXXXXXXXXXXXXXNFASLR----------DVKTGPTL-QEIKI 250
           ++  CLDFYN V                  +F  L+          +    P L   ++ 
Sbjct: 343 SRPICLDFYNSVLQRLSEFKTQLNSNDLTLSFVLLKYKNQDRPDDEESDFSPALPLSLEY 402

Query: 251 EVLRAGATRSLILEFQDKV--DLALLSKSLGFIVN-EGPRYVVEAIEIVNAGRSSKHFGP 307
           ++++ GATRS+ +EF   +      ++  L F+++ E  RY++E+++I+NA     +   
Sbjct: 403 DIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKRYIIESVDIINAAERDANLPK 462

Query: 308 HYAIIHFISIAMALETVEYLKSQSNKLAGLIKFRYV 343
           +  I+ F++I+M ++ ++ ++ +  K +G+ K  +V
Sbjct: 463 NTVILTFLNISMTVDVMDRIRLER-KDSGISKCVFV 497

 Score = 99.8 bits (247), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 69/109 (63%), Gaps = 3/109 (2%)

Query: 883  PRVSSASLDAVPPLAPSTLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKPLH 942
            P VS   L++ PPLAP+TLSR +  +SK  S   +   T +++    ND  +  SK   H
Sbjct: 918  PPVSKTLLESSPPLAPATLSRDFQKSSKQLSSDLTNLSTMDQNDMSEND-SNTSSKNASH 976

Query: 943  PR--RRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETVFYDEN 989
             R  ++  K +PGSDVM+QYLAQLQHSTFMYAANILG    E  FYDEN
Sbjct: 977  KRSSKKNKKLLPGSDVMSQYLAQLQHSTFMYAANILGASSDEPEFYDEN 1025

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score =  337 bits (863), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 151/232 (65%), Positives = 184/232 (79%)

Query: 508  MGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFA 567
            +GGG GNRTVYIGNI+PRSK ED+CNVVRGGILQ + ++  KHICFVTFIEA +A QFFA
Sbjct: 819  LGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFA 878

Query: 568  NSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEY 627
            N+ I+PIVLHGN+LKVGWG+HSG LP+SISLAVTIGA+RNVYVSLPE AFKDKFI +P+Y
Sbjct: 879  NAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDY 938

Query: 628  QEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNND 687
            +++ E ++LP++ QL +DFS +G+IE +N+L DGHCCWINFMNI++AI LVE+ N  +  
Sbjct: 939  EKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGI 998

Query: 688  SFHEKFGNRYKGLFIGYGKDRCGNVNKNLVXXXXXXXXXXXXXXXXNIRLRK 739
             FH KF  RY GL IGYGKDRCGNVNKNLV                 I+L+K
Sbjct: 999  RFHNKFDGRYNGLIIGYGKDRCGNVNKNLVATKNSKFFKKVKKPAYQIKLKK 1050

 Score = 79.7 bits (195), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 63/116 (54%), Gaps = 18/116 (15%)

Query: 890  LDAVPPLAPSTLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQ------DSKKPLH- 942
            L+  PP+A STL+R Y  T         +F T++      ++I SQ      D K P   
Sbjct: 1249 LNQYPPMASSTLTRTYRKTKLKPKNDNPKFITSDTE----DEILSQLPDEVLDEKNPFRG 1304

Query: 943  PR-----RRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGV--DDGETVFYDENGP 991
            PR     R   K IPGSDVM+QYL QLQHSTFMYAANILGV  +D    + D+  P
Sbjct: 1305 PRNKNKNRNTRKTIPGSDVMSQYLTQLQHSTFMYAANILGVSAEDNNITYGDDGEP 1360

 Score = 65.1 bits (157), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 47/80 (58%), Gaps = 8/80 (10%)

Query: 138 VVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLVD----SQQ 193
           V + ILP+    G DE+ TRSLL  N+N        +  F  F  +ESVYL+     S+ 
Sbjct: 263 VSYKILPK----GTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKLNPGSKY 318

Query: 194 QSVLVSFLTKETCLDFYNGV 213
            S+L+SF+++E CLDFYN V
Sbjct: 319 NSILLSFVSREICLDFYNNV 338

 Score = 39.3 bits (90), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 64/133 (48%), Gaps = 38/133 (28%)

Query: 251 EVLRAGATRSLILEFQDKVDLALLSKSLGFIVNEGP----------RYVVEAIEIVNAGR 300
           ++++ GATRSL+L+F       ++SK    ++NE            RY++E+I +VN   
Sbjct: 435 DLVKRGATRSLLLKFN-----GVVSKDQ--LINEKLNLFINNNLNNRYILESISLVNIEN 487

Query: 301 SSK--------------------HFGPHYAIIHFISIAMALETVEYLKSQSNKLAGLIKF 340
           ++K                     FG +Y ++ F +I MA+E  +Y K++ N+L     F
Sbjct: 488 NTKNNKNTIGDDNEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCF 547

Query: 341 RYVNTTSASGKSE 353
            +V+ T+    SE
Sbjct: 548 -FVSKTNYHKNSE 559

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
           similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  327 bits (839), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 194/253 (76%), Gaps = 3/253 (1%)

Query: 510 GGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANS 569
           GG  NRTVYIGNI PRSK EDICNVVRGGILQ++K+I +K ICFVTFIEAA+A+QF+AN+
Sbjct: 564 GGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSKRICFVTFIEAAAAIQFYANA 623

Query: 570 TIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQE 629
           ++EPIVLHGN+L+VGWG  SG LP++I+LAVTIGASRNVYVSLPE++FK+K+I +PE++E
Sbjct: 624 SLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVYVSLPEYSFKEKYINNPEFKE 683

Query: 630 FKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANN---PNN 686
           +  K++LPS+EQL +DF+ +G +E +N+L+DGHCCW+NFMNI++AI+LVED N+    N 
Sbjct: 684 YHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFMNIAHAIRLVEDCNSLSQRNL 743

Query: 687 DSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVXXXXXXXXXXXXXXXXNIRLRKQQKGASD 746
           + FH +F  RYK L IGYGKDRCGNVNKNL                   +  K+Q+    
Sbjct: 744 EKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTANKNSRFFKKIKKLNCTTKPNKRQQSKRG 803

Query: 747 APTEVKDEAKELD 759
             +   D+A++ D
Sbjct: 804 TSSASSDDARKDD 816

 Score =  175 bits (444), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 135/392 (34%), Positives = 202/392 (51%), Gaps = 33/392 (8%)

Query: 45  VPPAPQTPFDTSYGVXXXXXXXXXXXXXXATPGMGSASPHRAGGSRSSHAQSSYHTPNFG 104
           +PP PQTPFD +YG               +TP       H +  S S+H++S  + P   
Sbjct: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTPMRPQGHFHPSASSHSNHSRSFLYYPQ-- 136

Query: 105 STQLRMPPPTEKRNFKHGSSYRHNSSVQQRAYEVVFHILPRSADGGGDEYMTRSLLFSNL 164
              L+  PP  +++F    S  H+       Y+V F ILP+    G DEYMTRSLLFSNL
Sbjct: 137 PPILKPIPPRRRKSF----SLNHS-----EPYQVNFKILPK----GKDEYMTRSLLFSNL 183

Query: 165 --NPDTHLHDFLTKFEKFDRVESVYLVDSQQQSVLVSFLTKETCLDFYNGVXXXXXXXXX 222
               +  +H+FLT F KF  +ES+YL+D    S+L+SFLTK TCLDFYN +         
Sbjct: 184 ERQENFDIHNFLTNFIKFGPIESIYLLDD-SHSILLSFLTKATCLDFYNNLLQRFSEFKS 242

Query: 223 XXXXXXXXXNFASLRDVKTGPTLQEIKIEVLRAGATRSLILEFQDK-VDLA--LLSKSLG 279
                    +F    +      LQ   + V+  G TRSL +EF+D+ ++L   L+ + + 
Sbjct: 243 KLHSTKLSVSFVCQDETNWFRLLQ---MNVVTRGVTRSLCIEFEDQSMELTSDLIHEKIP 299

Query: 280 FIVNEGPRYVVEAIEIVNAGR-SSKHFGPHYAIIHFISIAMALETVEYLKSQSN-KLAGL 337
           ++     R+V+E I++VNA    +++F   Y +IHFI I+MALE  EYL+  S  K  G+
Sbjct: 300 WLFFSH-RFVIERIDLVNAAAPKNQNFNNRYLLIHFICISMALEVEEYLQQASQKKQLGI 358

Query: 338 IKFRYVNTTS-ASGKSEFQTLSSSQLNERALSNTSDSD----ISGGESVASLGSKLQQTS 392
            K ++VN    +S  S+   ++++   +R    +S S     IS    +  L   L   +
Sbjct: 359 SKIQFVNVNGHSSDLSDEDAVAAANGLQRESRTSSVSSISLPISNSSDLVELFHSL-DLA 417

Query: 393 LGEQTLVVDPTQYGRPLVEERSEHLPHVTISK 424
           LG  +L V P++Y  PL+E   +HL  VTIS+
Sbjct: 418 LGIISLQVIPSEYPVPLIESHDDHLHSVTISR 449

 Score = 55.1 bits (131), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 59/116 (50%), Gaps = 16/116 (13%)

Query: 886  SSASLDAVPPLAPSTLSRQY-----TATSKHNSRRGSRFGTTEKSSPRYNDIRSQDSKKP 940
            S+  LD++PPL PS +++ +        S H +   +  G     S  YN   S +  + 
Sbjct: 954  SNTYLDSIPPLVPSPINQHFHDKSLCRGSAHVNDNNNALGGFNNYS--YNCGGSNNGNRT 1011

Query: 941  LHPRRRK-SKAIPGSDVMAQYLAQLQHSTFMYAANILGVDDGETV-----FYDENG 990
               R+ K SK I G DVM+QYL QL HSTF+Y+ NILG     TV     FYD N 
Sbjct: 1012 RRRRQAKFSKPIAGQDVMSQYLEQLHHSTFLYSTNILG---ATTVHDPLGFYDVNA 1064

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 582

 Score =  179 bits (453), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 125/202 (61%), Gaps = 23/202 (11%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRTVY+GN+    K E+ICN VRGG+LQSVK +  +H+CFVTFI+  +A QF+A S++
Sbjct: 398 LGNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSL 457

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
             + +H    K+GWG HSG+LP +++LAV+ GASRN+YV             + ++    
Sbjct: 458 HGLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVG------------NIDFNAID 505

Query: 632 EKFQLPSKEQ-LYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFH 690
           E  +    EQ L E F  FG++E +NFL + +CC+INF NISNAI  ++           
Sbjct: 506 ETGETIFTEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKI--------- 556

Query: 691 EKFGNRYKGLFIGYGKDRCGNV 712
            K    +K L + +GKDRCGNV
Sbjct: 557 -KCNPYFKNLKVNFGKDRCGNV 577

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 112/204 (54%), Gaps = 22/204 (10%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GNI P    + + + VR G+++ +K +  +   F++F++ +SA+ F +++ ++ +
Sbjct: 161 RTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAILKRL 220

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYV----SLPEHAFKDKFIKDPEYQEF 630
            + G  +KVGWG  +   P   +   + GA+RNVY+    + P+ A   +F  DP     
Sbjct: 221 NIEGRDIKVGWGKPTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDPNE--- 275

Query: 631 KEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFH 690
               ++ S+E+L +D + FG+IE +  + D    +++F +I +AIK+V +  + N    +
Sbjct: 276 ----EIVSEEKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNLASVNPYYTN 331

Query: 691 EKFGNRYKGLFIGYGKDRCGNVNK 714
           +K         I YGKDRC  + K
Sbjct: 332 KK---------IFYGKDRCAFITK 346

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
           Anc_6.183
          Length = 629

 Score =  174 bits (440), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 131/202 (64%), Gaps = 23/202 (11%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRTVY+GN+    K E+ICNVVRGG+LQSVK +  +++CFVTFI+  +A QF+A S++
Sbjct: 445 LGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFYAMSSL 504

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
             + +     KVGWG HSG LP +++LAV+ GASRNVY+      F+   ++DP      
Sbjct: 505 HGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDP------ 556

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAI-KLVEDANNPNNDSFH 690
              ++ +++ L + F  +G++E +NFL + +CC+INF NISNAI  L +  +NP+     
Sbjct: 557 ---RIFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKIKSNPH----- 608

Query: 691 EKFGNRYKGLFIGYGKDRCGNV 712
                 ++ L I +GKDRCGNV
Sbjct: 609 ------FEDLKINFGKDRCGNV 624

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 102/200 (51%), Gaps = 20/200 (10%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GNI      +++ + VR G+++ VK I  K   F++F++ +SA+ F +++ ++ +
Sbjct: 214 RTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAILKRL 273

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKF 634
            + G  +K+GWG  +   P   +  +   A+RNV++        D   K+P         
Sbjct: 274 NIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFIGHLNKTDNDSCTKEPI-------- 325

Query: 635 QLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFG 694
              ++ +L ED   FG+IE V  + +    +++F +I++AIK V +  + N         
Sbjct: 326 ---TEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHNLRSMN--------- 373

Query: 695 NRYKGLFIGYGKDRCGNVNK 714
             Y+   I YGKDRC  + K
Sbjct: 374 PYYENKKIAYGKDRCAFITK 393

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa]
           {ON} Anc_6.183 YPL184C
          Length = 710

 Score =  173 bits (439), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 89/204 (43%), Positives = 121/204 (59%), Gaps = 22/204 (10%)

Query: 510 GGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANS 569
             LGNRTVY+GN+    K ++ICN VRGG+LQ +K +  +H+CFVTFI+  +A QF+A S
Sbjct: 523 NNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRHVCFVTFIDPTAAAQFYAMS 582

Query: 570 TIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQE 629
           ++  + +     KVGWG HSG LP  I+LAV+ GASRNVY+   +     K    P + E
Sbjct: 583 SLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYLGNIDFENDIKLHNPPIFTE 642

Query: 630 FKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVED-ANNPNNDS 688
                       L   F  +GD+E +NFL + +CC+INF NISNAI  +E   NNP+   
Sbjct: 643 LS----------LRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILAIEKIKNNPD--- 689

Query: 689 FHEKFGNRYKGLFIGYGKDRCGNV 712
                   +K L I +GKDRCGN+
Sbjct: 690 --------FKDLKINFGKDRCGNI 705

 Score = 87.8 bits (216), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 113/223 (50%), Gaps = 30/223 (13%)

Query: 510 GGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANS 569
           G   +RTVY+GNI      +D+ + VR G+++++K +  K   F++F++ +SA+ F +++
Sbjct: 263 GNTPSRTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAFISFVDESSALLFHSDA 322

Query: 570 TIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYV----------------SLP 613
            ++ + + G  +K+GWG  +   P   +  VT GA+RNVY+                S  
Sbjct: 323 ILKRLNIGGRDIKIGWGKPTPIDPIVATSIVTDGATRNVYIGQLSNSSNNNTSSSSSSTS 382

Query: 614 EHAFKDKFIKDPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISN 673
             +  +    D E ++  +   L ++E+L ED   +G+I+ V  ++D    +++  +I +
Sbjct: 383 PSSPSNNTSDDLEKKKNIDDSPL-TEEKLREDLKDYGEIDCVKIVQDKGFAFVHMSSILS 441

Query: 674 AIKLVED--ANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNK 714
           AIK+V +    NP            Y+   I YGKDRC  + K
Sbjct: 442 AIKVVNNLAQTNP-----------YYQNKRIFYGKDRCAFITK 473

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 652

 Score =  171 bits (434), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 86/202 (42%), Positives = 125/202 (61%), Gaps = 23/202 (11%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRTVY+GN+    K E+ICN +RGG+LQ++K +  +H+CFVTFI+  +A QF+A S++
Sbjct: 469 LGNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSL 528

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
             + +H    K+GWG HSG LP  I+LAV+ GASRN+Y+          F +D + +E  
Sbjct: 529 HGLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLG------NINFEEDAKQEE-- 580

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVED-ANNPNNDSFH 690
               + +++ L   F  FG +E +NFL + +CC+INF NISNAI  ++   +NP      
Sbjct: 581 ---SVFAEDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKIKSNP------ 631

Query: 691 EKFGNRYKGLFIGYGKDRCGNV 712
                 +  L I +GKDRCGNV
Sbjct: 632 -----HFNNLKINFGKDRCGNV 648

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 110/208 (52%), Gaps = 30/208 (14%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GNI      + + + VR G+++ VK +  K   FV+F++   A+ F +++ ++ +
Sbjct: 233 RTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAILKRL 292

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTI-----GASRNVYVSLPEHAFKD---KFIKDPE 626
            + G  +K+GWG      PQ I   V       GA+RNVY+    +  KD   K+  DP 
Sbjct: 293 NIDGRDIKIGWGK-----PQPIDPIVRAGIANDGATRNVYIG-KLNTNKDSCEKWGADP- 345

Query: 627 YQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNN 686
                 K  L +KE+LY+D S FG+IE +  +ED    +++F +I  AIK V  AN  + 
Sbjct: 346 ------KEILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAV--ANIGSI 397

Query: 687 DSFHEKFGNRYKGLFIGYGKDRCGNVNK 714
           D ++       K +F  YGKDRC  + K
Sbjct: 398 DPYYSN-----KKVF--YGKDRCAFITK 418

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
           Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  169 bits (428), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/202 (41%), Positives = 125/202 (61%), Gaps = 23/202 (11%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRT+Y+GN+    K E+ICNVVRGG+LQS+K +  +H+CFVTFI+  +A Q +A +++
Sbjct: 383 LGNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMASL 442

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
             + +H    K+GWG HSG L  +++LAV+ GASRN+Y+          F  D E +   
Sbjct: 443 HGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLG------NIDFKADSETEH-- 494

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVED-ANNPNNDSFH 690
               + +++ L   F  FG++E +NFL + +CC++NF NISNAI  ++   NNP      
Sbjct: 495 ---PIFTEQNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKIKNNP------ 545

Query: 691 EKFGNRYKGLFIGYGKDRCGNV 712
                ++  L I +GKDRCGNV
Sbjct: 546 -----QFSDLKINFGKDRCGNV 562

 Score = 96.7 bits (239), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 108/204 (52%), Gaps = 22/204 (10%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GNI P  +   + + VR G+++ ++ +  K   F++F++ +SA+ F +++ ++ +
Sbjct: 146 RTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAILKRL 205

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSL--PEHAFKDKFIKDPEYQEFKE 632
            + G  +K+GWG  +   P   S     GA+RNVY+     + +F  +   DP       
Sbjct: 206 NIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADP------- 258

Query: 633 KFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVED--ANNPNNDSFH 690
           + ++ ++++L +D S +G+IE V  + +    +++F +I +AIK+V    A NP      
Sbjct: 259 RDEVVTEQKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSLAAVNP------ 312

Query: 691 EKFGNRYKGLFIGYGKDRCGNVNK 714
                 Y    I YGKDRC  + K
Sbjct: 313 -----YYANKKIFYGKDRCAFITK 331

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa]
           {ON} complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  169 bits (429), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 88/202 (43%), Positives = 126/202 (62%), Gaps = 23/202 (11%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRTVY+GN+    K E+ICN VR G+LQSVK +  +H+CFVTFI+  +A QF+A S++
Sbjct: 406 LGNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSL 465

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
             ++L     KVGWG HSG LP  I+LAV+ GASRNVY+          F +D +  E  
Sbjct: 466 HGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIG------NIDFEEDSKRNE-- 517

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVED-ANNPNNDSFH 690
              ++ +++ L + F  +G++E +NFL   +CC+IN+ NISNAI  ++   +NP      
Sbjct: 518 ---RVFTEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKIKSNP------ 568

Query: 691 EKFGNRYKGLFIGYGKDRCGNV 712
                 +K L I +GKDRCGN+
Sbjct: 569 -----YFKDLKINFGKDRCGNI 585

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 111/203 (54%), Gaps = 20/203 (9%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GNI      +++ + VR G+++ VK +  K   F++F++ +SA+ F +++ ++ +
Sbjct: 169 RTVYLGNIPTTLTVKELLDHVRSGVVEDVKILPEKMCAFISFVDDSSALLFHSDAILKRL 228

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQE---FK 631
            + G  +K+GWG  +   P   +   T GA+RNVY+         +   D E  E     
Sbjct: 229 NIEGRDIKIGWGKPTKIDPIVANGITTDGATRNVYIG--------QLYTDAEVAESLNIP 280

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHE 691
           ++ ++ ++E+L  D  ++GDI+ V  +++    +I+F +I +AIK+V      NN +   
Sbjct: 281 KESEIVTEERLIADLEIYGDIDSVKIVKEKGIAFIHFASILSAIKVV------NNLAASN 334

Query: 692 KFGNRYKGLFIGYGKDRCGNVNK 714
           ++   Y+   I YGKDRC  + K
Sbjct: 335 RY---YQNRKIFYGKDRCAFITK 354

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  171 bits (432), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 88/202 (43%), Positives = 129/202 (63%), Gaps = 23/202 (11%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRT+Y+GN+    + E+ICNVVRGG+LQSVK +  +++CFVTFI+  +A QFFA S++
Sbjct: 496 LGNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFFAMSSL 555

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
             + +     KVGWG HSG L  +++LAV+ GASRN+Y+   + A  DK   +P + E  
Sbjct: 556 HGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFA-TDKKRDNPIFTE-- 612

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVED-ANNPNNDSFH 690
                   + L + FS++G++E +NFL + +CC+INF NISNAI  ++   +NP      
Sbjct: 613 --------DSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKIKSNP------ 658

Query: 691 EKFGNRYKGLFIGYGKDRCGNV 712
                 +K L I +GKDRCGN+
Sbjct: 659 -----VFKDLKINFGKDRCGNI 675

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 114/232 (49%), Gaps = 41/232 (17%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GNI      +++ + VR G+++ VK I  K   F++F++  SA+ F +++ ++ +
Sbjct: 222 RTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAILKRL 281

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYV-SLPEHAF---KDKFIKDPEYQ-- 628
            ++G  +K+GWG  +   P   +  +  GA+RNV++  L   +F   K K  K P  +  
Sbjct: 282 NINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPSRNH 341

Query: 629 --------EFKEK-----------------FQLP-SKEQLYEDFSVFGDIELVNFLEDGH 662
                   E  EK                  + P S  +L +D + FGDI+ +  +ED  
Sbjct: 342 DINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVEDKG 401

Query: 663 CCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGLFIGYGKDRCGNVNK 714
             +I+F +I++AIK V + N+ N         + Y    I YGKDRC  + K
Sbjct: 402 IAFIHFASITSAIKCVHNLNSMN---------DYYSTKKIFYGKDRCAFITK 444

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  166 bits (419), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 122/201 (60%), Gaps = 21/201 (10%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRT+Y+GN+    K E+ICN VRGG+LQ +K +  +H+CFVTFI+  +A QF+A S++
Sbjct: 339 LGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSL 398

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
             + +H    K+GWG HSG LP  ++LAV+ GASRN+Y+   + A  DK  + P + E  
Sbjct: 399 HGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFA-ADKKSQHPIFTE-- 455

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHE 691
                     L   F  FG++E +NFL + +CC+INF NIS+AI  ++            
Sbjct: 456 --------AALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI---------- 497

Query: 692 KFGNRYKGLFIGYGKDRCGNV 712
           K    +K L I +GKDRCGNV
Sbjct: 498 KSIPTFKDLKINFGKDRCGNV 518

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 105/203 (51%), Gaps = 20/203 (9%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GN+ P   T+++ + VR G+++ VK +  K   F++F+E  SA+ F +++ ++ +
Sbjct: 103 RTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAILKRL 162

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKD---KFIKDPEYQEFK 631
            +    +K+GWG  +   P   +     GA+RNVY+    +  KD   ++  DP  +   
Sbjct: 163 NIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIG-KLNTNKDICAQWGVDPNEEVIT 221

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHE 691
           E       E+L  D S FG++E V  + +    +++F +I  AIK+V +  N N     +
Sbjct: 222 E-------EKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANLANINPYYAQK 274

Query: 692 KFGNRYKGLFIGYGKDRCGNVNK 714
           K         I YGKDRC  + K
Sbjct: 275 K---------IFYGKDRCAFITK 288

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  166 bits (421), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 122/201 (60%), Gaps = 21/201 (10%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRT+Y+GN+    K E+ICN VRGG+LQ +K +  +H+CFVTFI+  +A QF+A S++
Sbjct: 392 LGNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSSL 451

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
             + +H    K+GWG HSG LP  ++LAV+ GASRN+Y+   +    D+ ++ P + E  
Sbjct: 452 HGLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIFTE-- 508

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHE 691
                     L   F  FG++E +NFL + +CC+INF NIS+AI  ++            
Sbjct: 509 --------TSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI---------- 550

Query: 692 KFGNRYKGLFIGYGKDRCGNV 712
           K    +K L I +GKDRCGNV
Sbjct: 551 KSIPTFKDLKINFGKDRCGNV 571

 Score = 87.4 bits (215), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 105/204 (51%), Gaps = 22/204 (10%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GN+ P   T ++ + VR G+++ VK +  K   F++F++  SA+ F +++ ++ +
Sbjct: 156 RTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAILKRL 215

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYV----SLPEHAFKDKFIKDPEYQEF 630
            +    +K+GWG  +   P   +     GA+RNVY+    + P+     ++  DP  +  
Sbjct: 216 NIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLGKLNTNPKMC--AQWGADPNEETI 273

Query: 631 KEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFH 690
            E       E+L  D + FG++E V  + +    +++F +I +AIK+V +  N N     
Sbjct: 274 TE-------EKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANLANVNPYYAQ 326

Query: 691 EKFGNRYKGLFIGYGKDRCGNVNK 714
           +K         I YGKDRC  + K
Sbjct: 327 KK---------IFYGKDRCAFITK 341

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
           Anc_6.183 YPL184C
          Length = 443

 Score =  163 bits (413), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 122/201 (60%), Gaps = 23/201 (11%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRT+Y+GN+S R + E++CNVVRGG+LQSVK++  +H+CFVTF +  +A QF+A +++
Sbjct: 262 LGNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFYAMASL 321

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
             + +     K+GWG HSG LP  ++ A++ GASRNVY       F +   +DP   EF 
Sbjct: 322 HGLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPAVAEFF 374

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHE 691
           E      +  L +  S FG++E VN + +  C ++NF N+ +AI  VE            
Sbjct: 375 E------ERHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQV---------- 418

Query: 692 KFGNRYKGLFIGYGKDRCGNV 712
           K   +++ L + YGKDRCGNV
Sbjct: 419 KKWPQFQQLKVNYGKDRCGNV 439

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 95/202 (47%), Gaps = 31/202 (15%)

Query: 514 NRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEP 573
           +RTVY+GNI+P     ++ + V+ G+++  +   AK   FV+F++  SA+ F +++ +  
Sbjct: 38  SRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVDENSALLFHSDAILNR 97

Query: 574 IVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYV-SLPEHAFKDKFIKDPEYQEFKE 632
           + +    +K+GW   +   P   +   + GA+RNVY+ +LP+                  
Sbjct: 98  LRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLGNLPDGV---------------- 141

Query: 633 KFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEK 692
                S+ +L +D SV+G+I+ V  L      +++  +I  AI  V +    N       
Sbjct: 142 -----SRYELTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAVANLQRDNKI----- 191

Query: 693 FGNRYKGLFIGYGKDRCGNVNK 714
               Y    + +GKDRC  V K
Sbjct: 192 ----YSDRRVSFGKDRCAYVTK 209

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184C Hypothetical ORF
          Length = 569

 Score =  166 bits (420), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/202 (41%), Positives = 123/202 (60%), Gaps = 23/202 (11%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRT+Y+GN+    K E+ICN VRGG+LQS+K +  +H+CFVTFI+  +A Q +A +++
Sbjct: 385 LGNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSL 444

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKD-PEYQEF 630
             + +H    K+GWG HSG L  +++LAV+ GASRN+Y  L    FK    +D P + E 
Sbjct: 445 HGLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIY--LGNIDFKADSERDVPVFTE- 501

Query: 631 KEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFH 690
                    + L + F  +G++E +NFL +  CC++NF NISNAI  ++           
Sbjct: 502 ---------QNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKI--------- 543

Query: 691 EKFGNRYKGLFIGYGKDRCGNV 712
            K   ++K L I +GKDRCGNV
Sbjct: 544 -KSNEQFKDLKINFGKDRCGNV 564

 Score = 93.2 bits (230), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 58/202 (28%), Positives = 103/202 (50%), Gaps = 18/202 (8%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GNI P  +  ++ + VR G+++ V+ +  K   F++F++ +SA+ F +++ ++ +
Sbjct: 148 RTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKRL 207

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSL--PEHAFKDKFIKDPEYQEFKE 632
            + G  +KVGWG  +   P   +     GA+RNVY+     +     +F  DP       
Sbjct: 208 NIGGRDIKVGWGKPTPIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADP------- 260

Query: 633 KFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEK 692
           +  + ++E+L  D   +G+IE V  + +    +++F +I +AIK+V      N       
Sbjct: 261 RDLIATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSLATVN------- 313

Query: 693 FGNRYKGLFIGYGKDRCGNVNK 714
               Y    I YGKDRC  V K
Sbjct: 314 --PYYSNKKIFYGKDRCAFVTK 333

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
           similar to uniprot|Q08925 Saccharomyces cerevisiae
           YPL184c
          Length = 639

 Score =  166 bits (420), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 126/203 (62%), Gaps = 25/203 (12%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRTVY+GN+    K E+ICN VRGG+LQS+K ++ +H+CFVTFI+  +A QF+A S++
Sbjct: 455 LGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFYAMSSL 514

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
               +     KVGWG HSG LP +++LAV+ GASRNVY+             + +++   
Sbjct: 515 YGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLG------------NIDFEADS 562

Query: 632 EKFQ-LPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVED-ANNPNNDSF 689
           +K Q + ++  L   F  +G++E +NFL +  CC+INF NI+NAI  ++   +NP     
Sbjct: 563 KKEQPIFNETALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKIKSNP----- 617

Query: 690 HEKFGNRYKGLFIGYGKDRCGNV 712
                  +K L I +GKDRCGNV
Sbjct: 618 ------HFKSLKINFGKDRCGNV 634

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 107/200 (53%), Gaps = 20/200 (10%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GNI P    +++ + VR G+++  K +  K   F++F+E +SA+ F +++ ++ +
Sbjct: 224 RTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAILKRL 283

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKF 634
            +    +KVGWG  +   P   S  +  GA+RNVY+    +        D   +E KE  
Sbjct: 284 NIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQGNN--------DRSSKENKEPL 335

Query: 635 QLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFG 694
              ++E+L ED   +G+I+ +  + +    +++F +I+ AIK+V      N   F+++  
Sbjct: 336 ---TEEKLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTLAQKN--PFYQE-- 388

Query: 695 NRYKGLFIGYGKDRCGNVNK 714
              K +F  YGKDRC  + K
Sbjct: 389 ---KKIF--YGKDRCAFITK 403

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
           Anc_6.183 YPL184C
          Length = 584

 Score =  164 bits (416), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 85/202 (42%), Positives = 125/202 (61%), Gaps = 23/202 (11%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRTVY+GN+    K E+ICNVVRGGILQ++K +  +H+CFVTFI+  +A QF+A S++
Sbjct: 400 LGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFYAMSSL 459

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
             I +     +VGWG H G LP +I+LAV+ GASRNVY+          F +D + QE  
Sbjct: 460 HGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIG------NIDFYEDSKRQE-- 511

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVED-ANNPNNDSFH 690
               + + + L + F  +G++E +NFL + +C ++N+ NISNAI  ++   +NP      
Sbjct: 512 ---PIFTADYLRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKIKSNP------ 562

Query: 691 EKFGNRYKGLFIGYGKDRCGNV 712
                 +K L I +GKDRCG +
Sbjct: 563 -----LFKNLKINFGKDRCGTI 579

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 109/202 (53%), Gaps = 18/202 (8%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           +TVY+GNI P     ++ + VR G+++ VK +  K   F+TF++ ++A+ F +++ ++ +
Sbjct: 163 KTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAILKRL 222

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSL--PEHAFKDKFIKDPEYQEFKE 632
            + G  +K+GWG  +   P   +   + GA+RNVY+ L   +     +   DP  ++  E
Sbjct: 223 HIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLLNTDSDIALQVGADPNDEKITE 282

Query: 633 KFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEK 692
                  E+L  D   FG+I+ V  +E+    +I+F +I +A+K+V  AN    + ++E 
Sbjct: 283 -------EKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVV--ANLAGINPYYEN 333

Query: 693 FGNRYKGLFIGYGKDRCGNVNK 714
                K ++  YGKDRC  + K
Sbjct: 334 -----KKIY--YGKDRCAFITK 348

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
           YPL184C
          Length = 593

 Score =  164 bits (416), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 86/202 (42%), Positives = 121/202 (59%), Gaps = 23/202 (11%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRTVY+GN+    + EDICN +R G+LQ++K +  +H+CFVTFI+  SA QF+A S+I
Sbjct: 412 LGNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMSSI 471

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
              VL     KVGWG HSG L   ++LAV+ GASRNVY+   +      F  D   +E  
Sbjct: 472 YGFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNID------FTADGTKRE-- 523

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVED-ANNPNNDSFH 690
              +  +   L   FS +G++E +NFL   +CC++N+ NI+NAI  ++   NNP      
Sbjct: 524 ---RYFTDSNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKIKNNPT----- 575

Query: 691 EKFGNRYKGLFIGYGKDRCGNV 712
                 +K L I +GKDRCGN+
Sbjct: 576 ------FKNLKINFGKDRCGNI 591

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 106/202 (52%), Gaps = 11/202 (5%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GNI P     D+ + VR G+++ VK +  K   F++F++  S++ F +++ ++ +
Sbjct: 168 RTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAILKRL 227

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYV-SLPEHAFKDKFIKDPEYQEFKEK 633
            + G  +K+GWG  S   P   +   T GA+RN+++  L       +   D       + 
Sbjct: 228 NIDGKDIKIGWGKPSPLSPIIATSVATDGATRNIFIGQLNTTDHNKQKDNDATIYHGSDD 287

Query: 634 FQ-LPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEK 692
           F+ + ++E+L +D   +GDI+ +   ++    +++F +I +AIK+V + +N N       
Sbjct: 288 FEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNSN------- 340

Query: 693 FGNRYKGLFIGYGKDRCGNVNK 714
               Y    I YGKDRC  + K
Sbjct: 341 --PYYSKKKIYYGKDRCAFITK 360

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
           Hypothetical ORF
          Length = 632

 Score =  164 bits (415), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/201 (42%), Positives = 122/201 (60%), Gaps = 21/201 (10%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRTVY+GN+    K E+ICNVVRGG+LQ+VK +  +H+CFVTFI+  +A QF+A S++
Sbjct: 448 LGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFYAMSSL 507

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
             I +     +VGWG H G+L  +++LAV+ GASRNVYV       +D   +DP + E  
Sbjct: 508 HGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINFD-EDSKREDPIFTE-- 564

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHE 691
                     L   F  +G++E +N+L + +CC++N+ NISNAI  ++          H 
Sbjct: 565 --------SSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAIDKIKG------HP 610

Query: 692 KFGNRYKGLFIGYGKDRCGNV 712
            F    K L I +GKDRCGNV
Sbjct: 611 VF----KDLKINFGKDRCGNV 627

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 105/200 (52%), Gaps = 13/200 (6%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           +TVY+GN       +++ + VR G+++ V+ +  K   FV+F++ ++A+ F +++ ++ +
Sbjct: 210 KTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAILKRL 269

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKF 634
            + G  +K+GWG  +   P   +      A+RNVY+       K      P   +  E  
Sbjct: 270 HIDGRDIKIGWGKPTPIDPVVATAVANDNATRNVYIGQLNTGPKLSSQVSPV--DVTEP- 326

Query: 635 QLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFG 694
            + ++++L  D   FG+I+ +  +E+    +++F +I NAIK V  AN  N + ++    
Sbjct: 327 -VITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAV--ANLANINPYY---- 379

Query: 695 NRYKGLFIGYGKDRCGNVNK 714
            R K +F  YGKDRC  + K
Sbjct: 380 -RNKKIF--YGKDRCAFITK 396

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
           MRN1RNA-binding protein proposed to be involved in
           translational regulation; binds specific categories of
           mRNAs, including those that contain upstream open
           reading frames (uORFs) and internal ribosome entry sites
           (IRES)
          Length = 612

 Score =  163 bits (413), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 124/202 (61%), Gaps = 23/202 (11%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRTVY+G++    K E+ICN VRGG+LQS+K +  +++CFVTFI+  +A QF+A S++
Sbjct: 428 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 487

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
               +     KVGWG HSG LP +++LAV+ GASRNVYV          F+ D    E  
Sbjct: 488 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVGDSLRDE-- 539

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAI-KLVEDANNPNNDSFH 690
              ++ ++  L   F  +G++E +NFL + +CC+IN+ NISNAI  L +  +NP      
Sbjct: 540 ---RVFTESNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSNP------ 590

Query: 691 EKFGNRYKGLFIGYGKDRCGNV 712
                 +K L I +GKDRCGNV
Sbjct: 591 -----YFKDLKINFGKDRCGNV 607

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/200 (29%), Positives = 106/200 (53%), Gaps = 24/200 (12%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GN+ P    +++ + VR G+++ VK I  K   FV+FI+ ++A+ F +++ ++ +
Sbjct: 201 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAILKRL 260

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKF 634
            +    +K+GWG  +   P   +   T GA+RNVY+         +   + E        
Sbjct: 261 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIG--------RMTIEGEESHL---- 308

Query: 635 QLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFG 694
              S+EQL  D   +G+I+ +  +++    +I+F +I NAIK+V   N P  + +++   
Sbjct: 309 ---SEEQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVV--TNLPIRNPYYQN-- 361

Query: 695 NRYKGLFIGYGKDRCGNVNK 714
              K +F  YGKDRC  + K
Sbjct: 362 ---KRIF--YGKDRCAFITK 376

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
           (REAL)
          Length = 625

 Score =  163 bits (413), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 86/202 (42%), Positives = 124/202 (61%), Gaps = 23/202 (11%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRTVY+G++    K E+ICN VRGG+LQS+K +  +++CFVTFI+  +A QF+A S++
Sbjct: 441 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 500

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
               +     KVGWG HSG LP +++LAV+ GASRNVYV          F+ D    E  
Sbjct: 501 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFVSDSLRDE-- 552

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAI-KLVEDANNPNNDSFH 690
              ++ ++  L   F  +G++E +NFL + +CC++N+ NISNAI  L +  +NP      
Sbjct: 553 ---RIFTESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKIKSNP------ 603

Query: 691 EKFGNRYKGLFIGYGKDRCGNV 712
                 +K L I +GKDRCGNV
Sbjct: 604 -----YFKDLKINFGKDRCGNV 620

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 105/200 (52%), Gaps = 24/200 (12%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GN+ P    +++ + VR G+++ VK I  K   F++F++ ++A+ F +++ ++ +
Sbjct: 214 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAILKRL 273

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKF 634
            +    +K+GWG  +   P   +   T GA+RNVY+         +   D E     E  
Sbjct: 274 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIG--------RMTIDGEESHLSE-- 323

Query: 635 QLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFG 694
                EQL  D   +G+I+ +  +++    +I+F +I NAIK+V   N P  + +++   
Sbjct: 324 -----EQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVV--TNLPIRNPYYQN-- 374

Query: 695 NRYKGLFIGYGKDRCGNVNK 714
              K +F  YGKDRC  + K
Sbjct: 375 ---KRIF--YGKDRCAFITK 389

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
           YPL184C (REAL)
          Length = 596

 Score =  162 bits (409), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 86/202 (42%), Positives = 123/202 (60%), Gaps = 23/202 (11%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRTVY+G++    K E+ICN VRGG+LQS+K +  +++CFVTFI+  +A QF+A S++
Sbjct: 412 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 471

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
               +     KVGWG HSG LP +++LAV+ GASRNVYV          F  D    E  
Sbjct: 472 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDFASDSLNDE-- 523

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVED-ANNPNNDSFH 690
              ++ ++  L   F  +G++E +NFL + +CC+IN+ NISNAI  ++   +NP      
Sbjct: 524 ---RIFTENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSNP------ 574

Query: 691 EKFGNRYKGLFIGYGKDRCGNV 712
                 +K L I +GKDRCGNV
Sbjct: 575 -----YFKDLKINFGKDRCGNV 591

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 105/200 (52%), Gaps = 24/200 (12%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GN+ P    +++ + VR G+++ VK I  K   F++F++ ++A+ F +++ ++ +
Sbjct: 185 RTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 244

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKF 634
            +    +K+GWG  +   P   +   T GA+RNVY+         +   + E     E  
Sbjct: 245 NIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIG--------RMTVEGEESHLSE-- 294

Query: 635 QLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFG 694
                EQL  D   +G+I+ +  +++    +I+F +I NAIK+V   N P  + +++   
Sbjct: 295 -----EQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVV--TNLPIRNPYYQN-- 345

Query: 695 NRYKGLFIGYGKDRCGNVNK 714
              K +F  YGKDRC  + K
Sbjct: 346 ---KRIF--YGKDRCAFITK 360

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
           YPL184C (REAL)
          Length = 614

 Score =  161 bits (408), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 86/202 (42%), Positives = 125/202 (61%), Gaps = 23/202 (11%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRTVY+G++    K E+ICN VRGG+LQS+K +  +++CFVTFI+  +A QF+A S++
Sbjct: 430 LGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFYAMSSL 489

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
               +     KVGWG HSG LP +++LAV+ GASRNVYV          ++ D    E  
Sbjct: 490 YGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVG------NIDYVSDSVRDE-- 541

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAI-KLVEDANNPNNDSFH 690
              ++ ++ +L   F  +G++E +NFL + +CC+IN+ NISNAI  L +  +NP      
Sbjct: 542 ---RIFTEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKIKSNP------ 592

Query: 691 EKFGNRYKGLFIGYGKDRCGNV 712
                 +K L I +GKDRCGNV
Sbjct: 593 -----YFKDLKINFGKDRCGNV 609

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 105/200 (52%), Gaps = 24/200 (12%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GN+ P    +++ + VR G+++ VK I  K   F++F++ ++A+ F +++ ++ +
Sbjct: 203 RTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 262

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFKEKF 634
            +    +K+GWG  +   P   +   T GA+RNVY+         +   + E        
Sbjct: 263 NIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIG--------RMTIEGEESHL---- 310

Query: 635 QLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFG 694
              S EQL  D   +G+I+ +  +++    +I+F +I NAIK+V   N P  + +++   
Sbjct: 311 ---SGEQLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVV--TNLPIRNLYYQN-- 363

Query: 695 NRYKGLFIGYGKDRCGNVNK 714
              K +F  YGKDRC  + K
Sbjct: 364 ---KRIF--YGKDRCAFITK 378

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON}
           Anc_6.183 YPL184C
          Length = 533

 Score =  160 bits (404), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 80/201 (39%), Positives = 124/201 (61%), Gaps = 25/201 (12%)

Query: 512 LGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTI 571
           LGNRT+Y+GN+    K E+ICNVVRGG+LQ++K +  +  CF+TFI+  +A QF+A S++
Sbjct: 353 LGNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFYAMSSL 412

Query: 572 EPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIKDPEYQEFK 631
             + +  N  KVGWG HSG L  +++LA++ GASRN+Y+                  +F+
Sbjct: 413 HGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIYIG---------------NVDFE 457

Query: 632 EKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHE 691
           +K +  ++E L E F  FG++E +NFL +  CC++NF NI++AI  ++        S  E
Sbjct: 458 KKNEYFNEEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKI-----KSLPE 512

Query: 692 KFGNRYKGLFIGYGKDRCGNV 712
                ++ L I +GKDRCGN+
Sbjct: 513 -----FEDLKINFGKDRCGNI 528

 Score = 92.8 bits (229), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 107/201 (53%), Gaps = 28/201 (13%)

Query: 515 RTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPI 574
           RTVY+GNI      +++ + VR G+++SVK +  K   F++FI+   A+ F +++ ++ +
Sbjct: 128 RTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAILKRL 187

Query: 575 VLHGNVLKVGWGHHSGNLPQSISLAVT-IGASRNVYVSLPEHAFKDKFIKDPEYQEFKEK 633
            + G  +K+GWG  S ++   ++  +T  GA+RNVY+         +   DP        
Sbjct: 188 NIRGKDIKIGWG-KSNHIDSIVAARITNDGATRNVYIG--------QLNDDP-------- 230

Query: 634 FQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKF 693
             + ++++L +D   FG+I+ + FL +    +++F +IS AI +V++           K 
Sbjct: 231 -TITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNL---------SKL 280

Query: 694 GNRYKGLFIGYGKDRCGNVNK 714
             +YK   I YGKDRC  + K
Sbjct: 281 NEKYKNKRIFYGKDRCAFITK 301

>ZYRO0F07238g Chr6 complement(586327..587496) [1170 bp, 389 aa] {ON}
           similar to uniprot|Q96US5 Saccharomyces cerevisiae
           YOR242C SSP2 Sporulation SPecific involved in
           sporulation
          Length = 389

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 5/68 (7%)

Query: 641 QLYEDFSVFGDI-ELVNFLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKG 699
           ++ +DF  FG+I E+   +    C  INF N+ +A+K +++  NPN+D  H+ + N +  
Sbjct: 317 EIKQDFGTFGEILEITPVVSRKLCISINFFNMESAMKAMKEYENPNSD-LHKAYFNNWA- 374

Query: 700 LFIGYGKD 707
             I YGKD
Sbjct: 375 --IWYGKD 380

>KAFR0A03830 Chr1 complement(779143..780267) [1125 bp, 374 aa] {ON}
           Anc_8.670 YOR242C
          Length = 374

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 642 LYEDFSVFGDIELVN-FLEDGHCCWINFMNISNAIKLVEDANNPNNDSFHEKFGNRYKGL 700
           + EDF  FG I+ V   +    C  +N+ NI +A+K +E   +PN++  H K+   YK  
Sbjct: 303 IVEDFGQFGRIQEVTPIISRKLCVAVNYYNILSALKAIESYEDPNSE-LHRKY---YKSW 358

Query: 701 FIGYGKD 707
            I +GKD
Sbjct: 359 AIWFGKD 365

>KNAG0A02400 Chr1 complement(236366..237271) [906 bp, 301 aa] {ON}
           Anc_8.466 YDL209C
          Length = 301

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 47/105 (44%), Gaps = 29/105 (27%)

Query: 510 GGLG-----NRTVYIGNISP------------RSKTEDICNVVRGGILQSVKYIEAKHIC 552
           GG+G     NRT+YIG I+              S+   + N +  G L  ++Y+EAK+  
Sbjct: 126 GGVGSFNNANRTLYIGGIAGALNDKPLKPLQIESRLRYLFNKL--GALDRIRYVEAKNCA 183

Query: 553 FVTFIEAAS---AVQFFANSTI-------EPIVLHGNVLKVGWGH 587
           FVTF   A+   A +   N T+        P  L G+ L V W H
Sbjct: 184 FVTFKSTANAEFAKEAMTNQTLLVPTDKEYPQRLEGSGLLVKWSH 228

>Kpol_526.41 s526 (95789..96547) [759 bp, 252 aa] {ON}
           (95789..96547) [759 nt, 253 aa]
          Length = 252

 Score = 38.1 bits (87), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 55/128 (42%), Gaps = 18/128 (14%)

Query: 269 VDLALLSKSLGFIVNEGPRYVVEAIEIVNAGRSSKHFGPHYAIIHFI-------SIA-MA 320
           +DL L+ K   +  +  P Y+ +   ++N  ++   F     +I +I       +IA M+
Sbjct: 33  IDLFLVKKGHEYFCDIDPDYITDRFNLMNLQKTVSKFS---MVIQYIVDELDENAIANMS 89

Query: 321 LETVEYLKSQSNKLAGLIKFRYVNTTSASGK-------SEFQTLSSSQLNERALSNTSDS 373
              +E L+  S K  G+I  RY+ TT    K       S+F        N + L     S
Sbjct: 90  QSKLEQLEIDSKKTYGMIHARYIITTKGLQKMAGKYKNSDFGRCPRVYCNGQPLLPIGLS 149

Query: 374 DISGGESV 381
           DI G ESV
Sbjct: 150 DIPGVESV 157

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR242C
           (SSP2)
          Length = 376

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 11/72 (15%)

Query: 640 EQLYEDFSVFGDI-ELVNFLEDGHCCWINFMNISNAIKLVE---DANNPNNDSFHEKFGN 695
           ++L +DFS FG+I ++   +    C  INF +I +A+  ++   +AN+P N  + E +  
Sbjct: 303 QELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAMDALQSYKNANSPLNRKYAESWT- 361

Query: 696 RYKGLFIGYGKD 707
                 IGYGKD
Sbjct: 362 ------IGYGKD 367

>Ecym_2645 Chr2 complement(1247120..1250389) [3270 bp, 1089 aa] {ON}
           similar to Ashbya gossypii ACR286C
          Length = 1089

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 64/159 (40%), Gaps = 37/159 (23%)

Query: 525 RSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEPIVLHGNVLKVG 584
           R+KT     ++R    Q +K++ AK I  + + +  +  +F  N  I  ++ H  +LK G
Sbjct: 751 RAKTMMKPFILRRRKDQVLKHLPAK-INRINYCDMNAVQKFIYNKEIRLVMEHKRMLKEG 809

Query: 585 WGHHSGNLPQSIS--LAVTIGASRNVYVSLPE---------HAFKDKFIKD--------P 625
                  LP        VT   S+N+ ++L +         H + DK I D        P
Sbjct: 810 L------LPADAKERAVVTHSTSKNLIMALRKASLHPLLFRHIYNDKMIHDMSDRILDEP 863

Query: 626 EYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCC 664
           EY E        ++E + ED S   D EL        CC
Sbjct: 864 EYAE------TGNREYIREDMSYMSDFELHKL-----CC 891

>TDEL0A05010 Chr1 (884301..885095) [795 bp, 264 aa] {ON} Anc_5.635
           YOR039W
          Length = 264

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 37/88 (42%), Gaps = 5/88 (5%)

Query: 269 VDLALLSKSLGFIVNEGPRYVVEAIEIVNAGRSSKHFGPHYAII-----HFISIAMALET 323
           +DL L  K   +  +  P Y+ +   ++N  ++   F      I      F+   M+   
Sbjct: 45  IDLFLGRKGHEYFCDVDPEYITDRFNLINLQKTVSKFTQVVQYIVDELDEFVLEGMSHAR 104

Query: 324 VEYLKSQSNKLAGLIKFRYVNTTSASGK 351
           +E L+S + K  GLI  RY+ T     K
Sbjct: 105 LEQLESDARKFYGLIHARYIITVKGLSK 132

>KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.797
           YOR319W
          Length = 212

 Score = 33.5 bits (75), Expect = 2.1,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 5/67 (7%)

Query: 515 RTVYIGNISPRSKTEDICNV-VRGGILQSVKYIEAKHICFVTFIEAASAVQFFANSTIEP 573
           RTVY+GNI PR   ED+  + V+ G ++ + Y   K    +   +  + ++F  +ST++ 
Sbjct: 7   RTVYVGNIDPRVNKEDLYELFVQFGRIKKINYPRDK---VLDTHQGYAFIEFLNDSTVDY 63

Query: 574 IV-LHGN 579
           ++ L GN
Sbjct: 64  VLKLFGN 70

>NDAI0E03260 Chr5 complement(701736..702689) [954 bp, 317 aa] {ON}
           Anc_8.466 YDL209C
          Length = 317

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 40/80 (50%), Gaps = 18/80 (22%)

Query: 510 GGLG-----NRTVYIGNISPR--------SKTEDICNVVRG--GILQSVKYIEAKHICFV 554
           GG+G     NRT+YIG +S          S+ E     V G  G ++S++YIEAK+  FV
Sbjct: 125 GGVGSFRKRNRTLYIGGLSGAFNNKELKPSQIESRIRFVFGRLGDIESIRYIEAKNCGFV 184

Query: 555 TF---IEAASAVQFFANSTI 571
            +     A  A +  +N T+
Sbjct: 185 KYKYQCNAEFAKEVMSNQTL 204

>TPHA0L01200 Chr12 (250506..251474) [969 bp, 322 aa] {ON} Anc_8.466
           YDL209C
          Length = 322

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 15/68 (22%)

Query: 510 GGLG-----NRTVYIGNISPRSKTEDI----------CNVVRGGILQSVKYIEAKHICFV 554
           GG+G     NRT+YIG ++     E+               R G +++++YIEAK+  FV
Sbjct: 123 GGVGSFRKRNRTLYIGGLTGALNNENFKPSQIEGRLRFAFSRLGEIETIRYIEAKNCAFV 182

Query: 555 TFIEAASA 562
           T+   A+A
Sbjct: 183 TYRFQANA 190

>Kwal_55.22252 s55 (1172484..1173194) [711 bp, 236 aa] {ON} YFL066C
           - Hypothetical ORF [contig 697] FULL
          Length = 236

 Score = 32.7 bits (73), Expect = 3.4,   Method: Composition-based stats.
 Identities = 35/131 (26%), Positives = 54/131 (41%), Gaps = 19/131 (14%)

Query: 140 FHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYL-VDSQQQSVLV 198
           F   P   D GG   + + L F NLNP+TH+ D L + E    V+  +  VD    +V+ 
Sbjct: 31  FFCSPPQRDTGG---LKKPLRFLNLNPETHIWD-LVQTEPLLHVDKEFREVDEADMTVVA 86

Query: 199 SFLTKETCLDFYNGVXXXXXXXXXXXXXXXXXXNFASLRDVKT------GPTLQEI-KIE 251
             L  ET  D                        FA   D+ +       PT++++ +I+
Sbjct: 87  HGLIHETLAD-------QDAKVIVVCREKAGVREFAEGLDIPSIWIHGDVPTIEKVTRIQ 139

Query: 252 VLRAGATRSLI 262
             + G+TR LI
Sbjct: 140 SFKGGSTRVLI 150

>TPHA0F02820 Chr6 (627799..629625) [1827 bp, 608 aa] {ON} Anc_6.104
           YBR212W
          Length = 608

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 44/83 (53%), Gaps = 11/83 (13%)

Query: 514 NRTVYIGNISPRSKTEDICNVVR--GGILQSVKYIEAKHICFVTF---IEAASAVQFFAN 568
           N TV+IG +S  +   ++  +    G IL SVK    K+  FV F   IEA +A++    
Sbjct: 341 NTTVFIGGLSTSTNEYELQVLFEPFGNIL-SVKIPIGKNCGFVKFKRKIEANAAIK---- 395

Query: 569 STIEPIVLHGNVLKVGWGHHSGN 591
             ++  +++GN +++ WG  + N
Sbjct: 396 -GMQGFIINGNPIRLSWGKSNNN 417

>KAFR0D02600 Chr4 complement(514523..515369,515443..515462) [867 bp,
           288 aa] {ON} Anc_3.379 YBR119W
          Length = 288

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 514 NRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTF--IEAASAVQ 564
           N+ + + N+    K ED+ N+ +   L  V+ +  +H+ FV +  +E +SA++
Sbjct: 216 NKVLLVQNLPANVKQEDVINLFQNAGLVEVRLVSPRHLAFVEYKTVEDSSAIK 268

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 94,422,930
Number of extensions: 3815476
Number of successful extensions: 10512
Number of sequences better than 10.0: 82
Number of HSP's gapped: 10592
Number of HSP's successfully gapped: 147
Length of query: 997
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 877
Effective length of database: 39,721,479
Effective search space: 34835737083
Effective search space used: 34835737083
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 71 (32.0 bits)