Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03762g8.845ON1206120655780.0
Kwal_27.102328.845ON1209121039330.0
SAKL0D01342g8.845ON1270129729360.0
TDEL0B005308.845ON1301101423220.0
ABL121C8.845ON1285133823110.0
KLLA0D01452g8.845ON1445132922850.0
ZYRO0G14278g8.845ON1250110621310.0
Suva_13.4688.845ON1418115617250.0
YMR280C (CAT8)8.845ON1433109917030.0
NCAS0C003908.845ON116491916720.0
Skud_13.4528.845ON1432109816680.0
Smik_13.4938.845ON143394516640.0
KNAG0J002508.845ON123792316320.0
KAFR0B039508.845ON124677815390.0
Ecym_46168.845ON157749114521e-176
CAGL0M03025g8.845ON125483414041e-172
NDAI0K003908.845ON149570312871e-153
Kpol_1016.201.277ON1086482204e-17
AFR096W1.277ON852482097e-16
KAFR0A014801.277ON725492061e-15
TPHA0I028201.277ON1044502062e-15
KLLA0F14322g1.277ON717482042e-15
ZYRO0G15136g1.277ON1027482052e-15
KLTH0D03564g1.277ON862482033e-15
Ecym_63401.277ON952482033e-15
SAKL0D05654g1.277ON919482024e-15
Smik_10.1531.277ON829482024e-15
YJL089W (SIP4)1.277ON829482007e-15
Kwal_26.7397singletonOFF201481859e-15
Skud_10.1251.277ON833481991e-14
Suva_6.1611.277ON832481972e-14
TDEL0D014501.277ON945481935e-14
CAGL0L03377g1.277ON1209481928e-14
NDAI0G055301.277ON1186481901e-13
KNAG0B018401.277ON1072491873e-13
TBLA0D054201.277ON757481792e-12
NCAS0A094101.277ON932451579e-10
KLLA0C10923g5.235ON775491273e-06
KLLA0E13993gsingletonON678441273e-06
TBLA0G026102.231ON1000421255e-06
SAKL0C02024gsingletonON898481212e-05
SAKL0G11902g5.235ON906481212e-05
NDAI0F012206.279ON960451202e-05
YPL248C (GAL4)6.279ON881471193e-05
KLLA0F04609g2.231ON916331193e-05
Smik_6.4526.279ON878471193e-05
NCAS0D041906.279ON890451184e-05
KNAG0D006906.279ON875501184e-05
NDAI0A087907.17ON1059341184e-05
ZYRO0E08272g6.279ON794471175e-05
KAFR0J017102.231ON848331175e-05
NCAS0D025405.235ON890441175e-05
NCAS0B065502.231ON906331175e-05
KNAG0B051205.235ON888441175e-05
NDAI0B038502.231ON930411166e-05
Smik_9.392.231ON1012331166e-05
Skud_9.372.231ON954451166e-05
TDEL0C044802.231ON8522171167e-05
Suva_9.592.231ON926331167e-05
YIL130W (ASG1)2.231ON964331167e-05
Ecym_7440na 1ON898421158e-05
Kpol_1018.306.279ON881451158e-05
CAGL0G08844g2.231ON847411158e-05
SAKL0E08998g2.231ON823411159e-05
KLTH0G09108g2.231ON782331149e-05
Kwal_23.47542.231ON812331141e-04
NCAS0G011006.279ON935451141e-04
SAKL0A02860g6.279ON745451141e-04
SAKL0H24860gna 2ON971651141e-04
KNAG0E017602.231ON902331141e-04
NDAI0I023505.235ON889441131e-04
KAFR0J006905.235ON864441131e-04
KLTH0D07260g2.547ON979501131e-04
Kpol_1039.112.231ON992331131e-04
KAFR0F014901.128ON6582151122e-04
Kwal_23.29055.235ON881481122e-04
TPHA0F013802.231ON8901651122e-04
Suva_16.596.279ON895451122e-04
KLTH0G07898g5.235ON866481122e-04
Suva_10.945.235ON906441122e-04
TDEL0E039105.235ON862441112e-04
KLTH0E14454gna 1ON902451112e-04
TDEL0D00260singletonON6471141112e-04
TPHA0H019806.279ON993471112e-04
TDEL0E00160singletonON631471103e-04
ZYRO0A10956g5.235ON855441103e-04
TBLA0G018006.279ON1154451103e-04
KLTH0D02222gna 3ON847471103e-04
NDAI0I007406.279ON1033451094e-04
Kpol_495.213.109ON1085371094e-04
KNAG0E002107.17ON948331095e-04
Smik_2.438na 4ON469421085e-04
Smik_12.775.235ON903441085e-04
CAGL0M12298g7.17ON994461085e-04
TPHA0N002307.17ON1232331086e-04
Smik_1.137.17ON1046461086e-04
ZYRO0E06270g2.565ON912461086e-04
SAKL0C03938g1.128ON780331086e-04
KLTH0H16170gna 5ON619331076e-04
YBR297W (MAL33)na 4ON468421076e-04
KAFR0C049807.17ON951411077e-04
YLR014C (PPR1)5.235ON904441078e-04
SAKL0B06732gna 1ON878421078e-04
KAFR0F034104.113ON995371078e-04
KAFR0F010406.279ON834471068e-04
KLLA0A02585gna 6ON370371050.001
Smik_18.8singletonON775381060.001
KLTH0E08778gna 7ON8733441060.001
TBLA0A012101.380ON1422301060.001
KLTH0B00352gsingletonON934431050.001
AER370W2.231ON801331050.001
Skud_12.825.235ON899441050.001
SAKL0A09856g2.547ON1020501050.001
AER183Cna 1ON879421050.001
Ecym_53972.231ON826331040.001
Suva_1.147.17ON1045461040.002
NDAI0D00900singletonON865331040.002
Skud_1.107.17ON1040461040.002
ADR403C7.17ON970461040.002
ZYRO0C18150g1.128ON571381030.002
KAFR0I002307.17ON1045331040.002
Kwal_47.17681na 7ON8541961030.002
SAKL0D14520g7.17ON983331030.002
CAGL0A00451g4.113ON1107421030.002
Kpol_538.427.17ON1088421030.002
TBLA0C040504.113ON1207361030.002
SAKL0B04620gna 6ON362371020.002
Skud_15.546na 8ON542461020.002
YAL051W (OAF1)7.17ON1047461030.002
KLTH0H02684g6.279ON749451020.002
CAGL0J07150g7.17ON1022431030.002
SAKL0H00682gna 9ON922461020.003
SAKL0A00704gna 10ON718461020.003
Ecym_50177.17ON978461020.003
KLLA0D12672g6.279ON865451020.003
ZYRO0C00726g7.17ON1035471020.003
NDAI0F00110singletonON508331010.003
ACL058Wna 2ON8171361020.003
TPHA0A045403.109ON1178371020.003
CAGL0I07755g3.109ON1053361020.003
NCAS0I002707.17ON944341010.003
SAKL0D00264g8.879ON848411010.003
TDEL0D051503.109ON996471010.004
TDEL0C056801.128ON691301010.004
TBLA0E007007.17ON1274331010.004
YGL013C (PDR1)4.113ON1068381010.004
TPHA0A06090singletonON847331000.004
Skud_2.427na 4ON468391000.004
Smik_15.561na 8ON546471000.005
KLLA0F22990g1.380ON1253301000.005
SAKL0D01100g4.113ON940361000.005
Ecym_8404na 2ON885751000.005
TBLA0C062306.60ON795331000.005
Suva_15.773.109ON1029471000.005
TDEL0H043407.17ON989331000.006
Kwal_26.81092.547ON97050990.006
SAKL0D14542gna 11ON94633990.006
YOR380W (RDR1)na 8ON54646990.006
KLLA0C18953gna 12ON703161990.006
KNAG0E041507.17ON113646990.006
Suva_8.436na 8ON54538980.007
Smik_17.27singletonON68833990.007
KLLA0F09559gsingletonON65838980.007
TBLA0G011308.879ON113234990.007
NCAS0A035804.113ON111337990.007
NDAI0H019907.17ON116133990.007
Smik_7.2774.113ON106938980.008
Skud_7.2744.113ON108038980.008
SAKL0C09944g3.109ON106136980.008
CAGL0K05841g1.380ON137230980.008
KLLA0C14212gna 9ON104036980.008
NCAS0D04860singletonON70139970.009
Suva_16.25singletonON14342910.009
TBLA0A097606.75ON153043980.009
KLLA0A09119g4.113ON108236980.009
AFL160C6.279ON64847970.010
NCAS0A03070singletonON65633970.010
KLLA0A10329gna 13ON63939970.010
Ecym_2522na 10ON92634970.010
CAGL0B03421g1.380ON135530970.011
KAFR0I020301.380ON123330970.011
Smik_13.1832.565ON91146970.011
CAGL0F07909g3.109ON104936970.011
NCAS0C002208.879ON83929970.011
Kpol_467.11.380ON128930970.012
CAGL0F09229gna 14ON83533960.012
YOR363C (PIP2)7.17ON99647970.012
Skud_15.5327.17ON100047970.012
Skud_11.1902.547ON117150970.013
ZYRO0G22550gsingletonON72437960.013
KNAG0I014501.380ON147630970.013
TBLA0A058601.128aON81046960.013
TBLA0D006307.389ON107740960.013
Ecym_27321.380ON119830960.014
YGR288W (MAL13)na 15ON47330950.014
Skud_15.643.109ON103236960.014
NCAS0A076107.17ON102233960.014
KLLA0F19602g8.283ON60340950.015
Kwal_34.15751na 5ON62833950.015
KNAG0A02300singletonON72931960.015
NDAI0G052601.380ON158130960.015
TPHA0H012405.59ON87739960.015
NCAS0C027308.423ON77539960.016
NCAS0A088401.380ON147830960.016
Skud_10.101.128ON833206960.016
Klac_YGOB_39601.128aON81037960.016
Skud_3.181singletonON83150950.016
SAKL0D07898g1.380ON124430960.017
TBLA0G005106.60ON93537950.018
KLLA0F02750g3.109ON114836950.018
Kwal_YGOB_0.1391.380ON124030950.018
NDAI0D035504.113ON111842950.018
KAFR0B014502.547ON108850950.018
KNAG0A025508.423ON73038950.018
TDEL0B004808.879ON83541950.019
KLLA0A03421gna 11ON88034950.019
TBLA0G00490singletonON91838950.019
Skud_9.220singletonON79335950.020
Kpol_260.25.59ON75641950.020
AFR117C1.380ON115230950.020
KLTH0H11572g1.380ON123730950.021
KNAG0A071002.547ON128650950.021
Smik_11.2102.547ON116950950.022
SAKL0H00616gna 16ON726179940.023
TPHA0B036301.380ON142932940.023
YLR256W (HAP1)1.380ON150230940.024
Suva_7.2684.113ON100038940.024
Skud_7.638singletonON47340930.024
KLLA0A06039g1.199ON65744940.025
YKL038W (RGT1)2.547ON117050940.025
KLLA0A03443g7.17ON97533940.025
ADR404Cna 11ON87533940.025
NDAI0C048408.423ON94843940.026
ZYRO0A13596gsingletonON64837940.026
NCAS0H00780singletonON90938940.026
CAGL0F07865g8.423ON84429940.027
NCAS0A047502.547ON114150940.027
KAFR0C03730singletonON79135930.028
TDEL0A02690singletonON72244930.028
ZYRO0G19338gna 17ON65329930.029
NCAS0A016304.113ON104336930.029
Kpol_538.528.879ON90730930.029
Skud_5.331singletonON17038890.030
Kwal_0.142singletonOFF62930930.030
KNAG0M00120singletonON88133930.031
TBLA0A007302.654ON1037128930.031
ZYRO0E05412g1.380ON124430930.031
Suva_11.1872.547ON117150930.031
KAFR0A021302.565ON70747930.031
Smik_12.3271.380ON150330930.031
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03762g
         (1206 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...  2153   0.0  
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...  1519   0.0  
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...  1135   0.0  
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...   899   0.0  
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...   894   0.0  
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...   884   0.0  
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...   825   0.0  
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...   669   0.0  
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...   660   0.0  
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845     648   0.0  
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...   647   0.0  
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...   645   0.0  
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...   633   0.0  
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...   597   0.0  
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...   563   e-176
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...   545   e-172
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845    500   e-153
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    89   4e-17
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    85   7e-16
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    84   1e-15
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    84   2e-15
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    83   2e-15
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    84   2e-15
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    83   3e-15
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    83   3e-15
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    82   4e-15
Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089...    82   4e-15
YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zi...    82   7e-15
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    76   9e-15
Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089...    81   1e-14
Suva_6.161 Chr6 complement(283370..284500,284547..284764,284948....    80   2e-14
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    79   5e-14
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    79   8e-14
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            78   1e-13
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    77   3e-13
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    74   2e-12
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    65   9e-10
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    54   3e-06
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    54   3e-06
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    53   5e-06
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    51   2e-05
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    51   2e-05
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    51   2e-05
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    50   3e-05
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    50   3e-05
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    50   3e-05
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     50   4e-05
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    50   4e-05
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    50   4e-05
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    50   5e-05
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    50   5e-05
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    50   5e-05
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    50   5e-05
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               50   5e-05
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    49   6e-05
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    49   6e-05
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    49   6e-05
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    49   7e-05
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    49   7e-05
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    49   7e-05
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    49   8e-05
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    49   8e-05
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    49   8e-05
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    49   9e-05
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    49   9e-05
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    49   1e-04
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    49   1e-04
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    49   1e-04
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    49   1e-04
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    49   1e-04
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     48   1e-04
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    48   1e-04
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    48   1e-04
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    48   1e-04
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    48   2e-04
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    48   2e-04
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    48   2e-04
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    48   2e-04
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    48   2e-04
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    48   2e-04
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    47   2e-04
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    47   2e-04
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       47   2e-04
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    47   2e-04
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 47   3e-04
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    47   3e-04
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    47   3e-04
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    47   3e-04
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    47   4e-04
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    47   4e-04
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    47   5e-04
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    46   5e-04
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    46   5e-04
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    46   5e-04
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    46   6e-04
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    46   6e-04
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    46   6e-04
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    46   6e-04
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    46   6e-04
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    46   6e-04
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    46   7e-04
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    46   8e-04
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    46   8e-04
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    46   8e-04
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    45   8e-04
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    45   0.001
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    45   0.001
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    45   0.001
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    45   0.001
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    45   0.001
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    45   0.001
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    45   0.001
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    45   0.001
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    45   0.001
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    45   0.001
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    45   0.002
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               45   0.002
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    45   0.002
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    45   0.002
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    44   0.002
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    45   0.002
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    44   0.002
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    44   0.002
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    44   0.002
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    44   0.002
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    44   0.002
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    44   0.002
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    44   0.002
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    44   0.002
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    44   0.002
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    44   0.002
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    44   0.003
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    44   0.003
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    44   0.003
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    44   0.003
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    44   0.003
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 44   0.003
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    44   0.003
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    44   0.003
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    44   0.003
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    44   0.003
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    44   0.003
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    44   0.004
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    44   0.004
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    44   0.004
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    44   0.004
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    43   0.004
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    43   0.004
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    43   0.005
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    43   0.005
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    43   0.005
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    43   0.005
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    43   0.005
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    43   0.005
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    43   0.006
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    43   0.006
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    43   0.006
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    43   0.006
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    43   0.006
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    43   0.006
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    42   0.007
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    43   0.007
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    42   0.007
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    43   0.007
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    43   0.007
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    43   0.007
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    42   0.008
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    42   0.008
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    42   0.008
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    42   0.008
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    42   0.008
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               42   0.009
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    40   0.009
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    42   0.009
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    42   0.009
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    42   0.010
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               42   0.010
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    42   0.010
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    42   0.010
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    42   0.011
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    42   0.011
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    42   0.011
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    42   0.011
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       42   0.011
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    42   0.012
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    42   0.012
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    42   0.012
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    42   0.012
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    42   0.013
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    42   0.013
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              42   0.013
TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON}             42   0.013
TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {...    42   0.013
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    42   0.014
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    41   0.014
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    42   0.014
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    42   0.014
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    41   0.015
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    41   0.015
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    42   0.015
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    42   0.015
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    42   0.015
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     42   0.016
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    42   0.016
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    42   0.016
Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 81...    42   0.016
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    41   0.016
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    42   0.017
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    41   0.018
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    41   0.018
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    41   0.018
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    41   0.018
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    41   0.018
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    41   0.018
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    41   0.019
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    41   0.019
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                41   0.019
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    41   0.020
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    41   0.020
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    41   0.020
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    41   0.021
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    41   0.021
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    41   0.022
SAKL0H00616g Chr8 (73754..75934) [2181 bp, 726 aa] {ON} some sim...    41   0.023
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    41   0.023
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    41   0.024
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    41   0.024
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    40   0.024
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    41   0.025
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    41   0.025
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    41   0.025
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    41   0.025
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    41   0.026
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    41   0.026
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    41   0.026
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    41   0.027
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    41   0.027
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               40   0.028
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               40   0.028
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    40   0.029
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    40   0.029
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    40   0.029
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    39   0.030
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    40   0.030
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      40   0.031
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    40   0.031
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    40   0.031
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    40   0.031
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    40   0.031
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    40   0.031
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    40   0.031
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    40   0.032
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    40   0.032
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    40   0.032
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    40   0.033
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    40   0.033
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    40   0.033
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    40   0.034
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    40   0.034
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    40   0.035
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    40   0.037
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    40   0.037
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    40   0.038
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    40   0.039
KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.5...    40   0.039
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    40   0.040
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    40   0.041
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    40   0.042
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    39   0.043
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     40   0.043
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    40   0.043
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    40   0.044
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    40   0.045
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    40   0.045
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    40   0.046
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    40   0.047
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    40   0.048
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    40   0.049
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    40   0.049
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    40   0.050
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    40   0.051
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    40   0.052
SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakl...    40   0.053
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    40   0.056
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    40   0.057
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               40   0.058
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    40   0.059
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    40   0.060
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    40   0.061
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    39   0.062
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    40   0.064
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    39   0.065
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    39   0.065
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    39   0.065
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    39   0.068
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    39   0.068
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    39   0.068
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    39   0.069
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    39   0.070
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    39   0.071
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    39   0.072
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    39   0.072
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    39   0.074
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    39   0.074
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    39   0.075
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    39   0.077
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    39   0.077
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    39   0.080
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    39   0.083
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    39   0.084
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    39   0.085
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    39   0.087
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    39   0.088
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    39   0.088
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    39   0.089
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    39   0.089
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    39   0.091
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    39   0.093
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    39   0.094
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    39   0.094
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    39   0.095
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    39   0.095
Kwal_47.18089 s47 complement(680481..682718) [2238 bp, 745 aa] {...    39   0.10 
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    39   0.10 
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    39   0.11 
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    39   0.11 
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    39   0.11 
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    39   0.11 
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    39   0.11 
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    39   0.11 
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    39   0.11 
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    39   0.11 
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    39   0.11 
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    39   0.11 
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    39   0.11 
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    39   0.11 
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    39   0.12 
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    38   0.12 
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    39   0.12 
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    39   0.12 
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    39   0.12 
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    39   0.12 
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    39   0.13 
SAKL0H01958g Chr8 complement(193079..195055) [1977 bp, 658 aa] {...    39   0.13 
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    39   0.13 
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    38   0.13 
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    39   0.13 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    38   0.13 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    38   0.13 
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    39   0.13 
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    39   0.13 
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    39   0.13 
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    39   0.13 
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    39   0.14 
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    38   0.14 
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    38   0.14 
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    38   0.14 
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    38   0.14 
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    38   0.15 
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    38   0.15 
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    38   0.15 
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    38   0.16 
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    38   0.16 
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    38   0.16 
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               38   0.16 
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    38   0.16 
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    38   0.16 
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    38   0.17 
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    38   0.17 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    38   0.17 
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    38   0.20 
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    38   0.20 
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    38   0.20 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    38   0.21 
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    38   0.21 
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    38   0.21 
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    38   0.21 
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    38   0.21 
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    38   0.21 
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    38   0.21 
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    38   0.22 
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    38   0.22 
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    38   0.22 
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    38   0.22 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    38   0.22 
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    38   0.22 
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    38   0.22 
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    38   0.23 
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    38   0.23 
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    38   0.23 
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    38   0.23 
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    38   0.23 
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    38   0.23 
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    38   0.24 
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    38   0.24 
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    37   0.24 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    37   0.25 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    37   0.25 
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    37   0.25 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       37   0.25 
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    37   0.26 
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    37   0.26 
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    37   0.26 
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    37   0.27 
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    37   0.27 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    37   0.27 
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    37   0.27 
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    37   0.28 
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    37   0.29 
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    37   0.30 
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    37   0.30 
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    37   0.31 
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    37   0.31 
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    37   0.31 
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    37   0.31 
TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6....    37   0.32 
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    37   0.32 
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    37   0.33 
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    37   0.34 
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    37   0.34 
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    37   0.34 
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    37   0.34 
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    37   0.34 
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    37   0.34 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    37   0.35 
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    37   0.35 
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    37   0.35 
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     37   0.36 
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    37   0.37 
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    37   0.37 
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    37   0.37 
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    37   0.38 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    37   0.38 
CAGL0H01507g Chr8 complement(147689..150073) [2385 bp, 794 aa] {...    37   0.38 
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    37   0.38 
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    37   0.39 
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    37   0.39 
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    37   0.39 
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    37   0.39 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    37   0.40 
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    37   0.40 
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    37   0.41 
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    37   0.41 
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    37   0.41 
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    37   0.42 
Ecym_5183 Chr5 complement(385669..388101) [2433 bp, 810 aa] {ON}...    37   0.43 
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    37   0.44 
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    37   0.44 
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    37   0.45 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    37   0.45 
YBR150C Chr2 complement(541209..544493) [3285 bp, 1094 aa] {ON} ...    37   0.45 
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 37   0.45 
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    37   0.45 
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 37   0.45 
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    37   0.45 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    37   0.45 
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    37   0.45 
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    37   0.46 
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      37   0.48 
Skud_12.346 Chr12 complement(616734..618818) [2085 bp, 694 aa] {...    37   0.49 
Ecym_7235 Chr7 (489574..492405) [2832 bp, 943 aa] {ON} similar t...    37   0.50 
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    37   0.52 
Kpol_1061.37 s1061 complement(102667..104616) [1950 bp, 649 aa] ...    36   0.53 
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    36   0.53 
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    37   0.53 
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    36   0.54 
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    36   0.55 
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    37   0.55 
KLTH0A00484g Chr1 (42443..44149) [1707 bp, 568 aa] {ON} conserve...    36   0.57 
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    34   0.57 
KLTH0E00176g Chr5 (8605..10311) [1707 bp, 568 aa] {ON} conserved...    36   0.57 
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    36   0.58 
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    36   0.61 
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    36   0.62 
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    36   0.64 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    36   0.64 
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    36   0.65 
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    36   0.66 
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    36   0.67 
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    36   0.67 
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    36   0.68 
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    36   0.68 
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    36   0.71 
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     36   0.72 
Ecym_3001 Chr3 (1150..3042) [1893 bp, 630 aa] {ON} similar to As...    36   0.74 
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     36   0.74 
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    36   0.75 
SAKL0C03960g Chr3 (380387..383488) [3102 bp, 1033 aa] {ON} conse...    36   0.75 
Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa] {...    36   0.77 
TBLA0C03390 Chr3 complement(814708..818028) [3321 bp, 1106 aa] {...    36   0.81 
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    36   0.82 
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    36   0.83 
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    36   0.84 
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    35   0.84 
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    36   0.84 
Suva_15.425 Chr15 (750153..752087) [1935 bp, 644 aa] {ON} YLR098...    36   0.86 
Skud_7.2 Chr7 (5094..6749) [1656 bp, 551 aa] {ON} YLR098C (REAL)       35   0.89 
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    36   0.91 
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    35   0.91 
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    36   0.91 
Ecym_3395 Chr3 complement(750356..753481) [3126 bp, 1041 aa] {ON...    36   0.97 
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    36   0.98 
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    35   1.00 
AER291C Chr5 complement(1172383..1174374) [1992 bp, 663 aa] {ON}...    35   1.0  
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    35   1.0  
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    35   1.0  
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    35   1.0  
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    35   1.1  
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    35   1.1  
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    35   1.1  
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    35   1.1  
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    35   1.1  
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    35   1.1  
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    35   1.1  
KLLA0C19228g Chr3 (1713787..1715562) [1776 bp, 591 aa] {ON} simi...    35   1.1  
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      33   1.1  
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    35   1.2  
AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON...    35   1.2  
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      35   1.2  
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     35   1.2  
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    35   1.3  
TBLA0A07010 Chr1 (1713923..1716046) [2124 bp, 707 aa] {ON}             35   1.3  
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    35   1.3  
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               35   1.4  
CAGL0L09383g Chr12 (1020856..1021956) [1101 bp, 366 aa] {ON} som...    35   1.4  
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    35   1.4  
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    35   1.4  
SAKL0G14256g Chr7 (1230063..1232306) [2244 bp, 747 aa] {ON} cons...    35   1.4  
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    35   1.4  
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    35   1.5  
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    35   1.5  
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    35   1.5  
Smik_4.68 Chr4 (133172..134758) [1587 bp, 528 aa] {ON} YDL170W (...    35   1.5  
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    35   1.5  
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    35   1.6  
SAKL0B12518g Chr2 (1072142..1073932) [1791 bp, 596 aa] {ON} cons...    35   1.6  
ACR241C Chr3 complement(784358..786745) [2388 bp, 795 aa] {ON} S...    35   1.6  
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    35   1.6  
TPHA0L02050 Chr12 complement(423921..426563) [2643 bp, 880 aa] {...    35   1.6  
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    35   1.7  
ZYRO0G00374g Chr7 complement(28649..30553) [1905 bp, 634 aa] {ON...    35   1.7  
NCAS0D02960 Chr4 complement(563406..566924) [3519 bp, 1172 aa] {...    35   1.7  
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    35   1.8  
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      35   1.8  
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    34   1.8  
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    35   1.8  
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    35   1.8  
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    35   1.9  
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    35   1.9  
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    35   2.0  
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    34   2.0  
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     34   2.0  
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    35   2.0  
AFR722C Chr6 complement(1765861..1768293) [2433 bp, 810 aa] {ON}...    35   2.0  
TPHA0M00150 Chr13 (29607..31919) [2313 bp, 770 aa] {ON}                35   2.1  
NDAI0F04500 Chr6 complement(1093752..1096181) [2430 bp, 809 aa] ...    35   2.1  
TDEL0G00830 Chr7 complement(170169..172229) [2061 bp, 686 aa] {O...    34   2.1  
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    34   2.2  
TBLA0B07050 Chr2 (1669768..1671996) [2229 bp, 742 aa] {ON}             34   2.2  
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    34   2.2  
SAKL0A08074g Chr1 (711985..715425) [3441 bp, 1146 aa] {ON} simil...    34   2.3  
CAGL0I02552g Chr9 (227257..230274) [3018 bp, 1005 aa] {ON} weakl...    34   2.4  
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    34   2.5  
Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON} ...    34   2.5  
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    34   2.5  
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    34   2.6  
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    34   2.6  
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    34   2.6  
Skud_14.399 Chr14 (715444..717267) [1824 bp, 607 aa] {ON} YNR063...    34   2.7  
YHR178W Chr8 (459299..461530) [2232 bp, 743 aa] {ON}  STB5Transc...    34   2.8  
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    34   2.8  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    34   3.0  
KLTH0F03014g Chr6 (260568..262406) [1839 bp, 612 aa] {ON} simila...    34   3.1  
TDEL0C05790 Chr3 (1045249..1047057) [1809 bp, 602 aa] {ON}             34   3.2  
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    33   3.2  
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             33   3.6  
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    33   3.8  
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    33   3.8  
Skud_8.242 Chr8 (430739..432958) [2220 bp, 739 aa] {ON} YHR178W ...    33   4.1  
KLLA0A03091g Chr1 (276333..277484) [1152 bp, 383 aa] {ON} some s...    33   4.2  
Smik_12.341 Chr12 complement(613817..615922) [2106 bp, 701 aa] {...    33   4.2  
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    33   4.4  
Skud_6.15 Chr6 complement(24031..25701) [1671 bp, 556 aa] {ON} Y...    33   4.6  
KLLA0A09251g Chr1 (808253..810319) [2067 bp, 688 aa] {ON} simila...    33   4.8  
KLTH0E06116g Chr5 complement(553784..556297) [2514 bp, 837 aa] {...    33   5.1  
SAKL0C00242g Chr3 (14453..16954) [2502 bp, 833 aa] {ON} weakly s...    33   5.1  
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    33   5.1  
TBLA0D04050 Chr4 (1007986..1009809) [1824 bp, 607 aa] {ON} Anc_8...    33   5.2  
TDEL0B04000 Chr2 (715716..716981) [1266 bp, 421 aa] {ON} Anc_6.1...    33   5.3  
Smik_8.262 Chr8 (436380..438584) [2205 bp, 734 aa] {ON} YHR178W ...    33   5.3  
NDAI0E04190 Chr5 complement(944753..948466) [3714 bp, 1237 aa] {...    33   5.5  
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    33   5.5  
Suva_15.378 Chr15 (665572..667815) [2244 bp, 747 aa] {ON} YHR178...    33   6.1  
SAKL0F16588g Chr6 complement(1369763..1371610) [1848 bp, 615 aa]...    33   6.9  
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    33   6.9  
SAKL0H13266g Chr8 (1138536..1140362) [1827 bp, 608 aa] {ON} some...    33   6.9  
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    32   8.0  
AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic ho...    32   9.3  
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    32   9.4  
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    32   9.7  

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8 Zinc
            cluster transcriptional activator
          Length = 1206

 Score = 2153 bits (5578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1056/1206 (87%), Positives = 1056/1206 (87%)

Query: 1    MGERENESFGPRFIRTLGSQSISVINPLXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXX 60
            MGERENESFGPRFIRTLGSQSISVINPL              K                 
Sbjct: 1    MGERENESFGPRFIRTLGSQSISVINPLSSQPSSISQSPAQPKANTNTQTTATASISPTA 60

Query: 61   XXXXXXNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXX 120
                  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY    
Sbjct: 61   SVTPSSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETL 120

Query: 121  XXXXXXXXXXXXXXXXXCDLKDEQMHLVYKYSSNKRPEPXXXXXXXXXXXXXXXXXXXXX 180
                             CDLKDEQMHLVYKYSSNKRPEP                     
Sbjct: 121  EERVRELEAENRRLVALCDLKDEQMHLVYKYSSNKRPEPSSTEEEQMLEQLSSSNGGSLR 180

Query: 181  XXXTNLYLLNKTSPAGHEVPENHKCQGIDCNHTSHPHLHEKPVSTTLSDPTTISFEQHEA 240
               TNLYLLNKTSPAGHEVPENHKCQGIDCNHTSHPHLHEKPVSTTLSDPTTISFEQHEA
Sbjct: 181  VSSTNLYLLNKTSPAGHEVPENHKCQGIDCNHTSHPHLHEKPVSTTLSDPTTISFEQHEA 240

Query: 241  PGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYT 300
            PGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYT
Sbjct: 241  PGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYT 300

Query: 301  ASLLASLKEPSQAVVPTTDGLTELKCTSLWEIDDPMRFFKDSCKFNLGSDNDVXXXXXXX 360
            ASLLASLKEPSQAVVPTTDGLTELKCTSLWEIDDPMRFFKDSCKFNLGSDNDV       
Sbjct: 301  ASLLASLKEPSQAVVPTTDGLTELKCTSLWEIDDPMRFFKDSCKFNLGSDNDVELLSISE 360

Query: 361  XXXXXXXYFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSISYKI 420
                   YFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSISYKI
Sbjct: 361  IEDLISIYFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSISYKI 420

Query: 421  FACILLVVCQLGIMSKVKREQLPAKSKFSRIMAYYNNAILALKLNPYFSVKTTSVKTXXX 480
            FACILLVVCQLGIMSKVKREQLPAKSKFSRIMAYYNNAILALKLNPYFSVKTTSVKT   
Sbjct: 421  FACILLVVCQLGIMSKVKREQLPAKSKFSRIMAYYNNAILALKLNPYFSVKTTSVKTLQL 480

Query: 481  XXXXXXXXXNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF 540
                     NVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF
Sbjct: 481  MSLLLFYFLNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF 540

Query: 541  WGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLL 600
            WGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLL
Sbjct: 541  WGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLL 600

Query: 601  RFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNGTINMEEL 660
            RFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNGTINMEEL
Sbjct: 601  RFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNGTINMEEL 660

Query: 661  NSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAAKPLLGGASEVDTDATLXXXXX 720
            NSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAAKPLLGGASEVDTDATL     
Sbjct: 661  NSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAAKPLLGGASEVDTDATLAFDDA 720

Query: 721  XXXXXXXXXXYVLLQQATNTFLSVQSSLKSRHLPLALNLPRIKARFALLSARGILEYTKG 780
                      YVLLQQATNTFLSVQSSLKSRHLPLALNLPRIKARFALLSARGILEYTKG
Sbjct: 721  SSGADRSSSSYVLLQQATNTFLSVQSSLKSRHLPLALNLPRIKARFALLSARGILEYTKG 780

Query: 781  GALFQGNKALLLDVVKELETTKRLEIPGSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLL 840
            GALFQGNKALLLDVVKELETTKRLEIPGSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLL
Sbjct: 781  GALFQGNKALLLDVVKELETTKRLEIPGSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLL 840

Query: 841  EAKLSYYNKLMGRSANVASTKRKKEEDNTSLSNATKLTPLXXXXXXXXEKRVKLEHTDKV 900
            EAKLSYYNKLMGRSANVASTKRKKEEDNTSLSNATKLTPL        EKRVKLEHTDKV
Sbjct: 841  EAKLSYYNKLMGRSANVASTKRKKEEDNTSLSNATKLTPLSSDSSSPSEKRVKLEHTDKV 900

Query: 901  GETPVGVENTGQPNGNTQEHYAATWSNQNQPHSTVAEAFHLDPVLNNNPFSNGDLTAFFS 960
            GETPVGVENTGQPNGNTQEHYAATWSNQNQPHSTVAEAFHLDPVLNNNPFSNGDLTAFFS
Sbjct: 901  GETPVGVENTGQPNGNTQEHYAATWSNQNQPHSTVAEAFHLDPVLNNNPFSNGDLTAFFS 960

Query: 961  TDNGMPNLSGGASMLNMVGVDQAHSTAGNDAQNTVNANSQQSTLFNDGLFRVPSNGDFLK 1020
            TDNGMPNLSGGASMLNMVGVDQAHSTAGNDAQNTVNANSQQSTLFNDGLFRVPSNGDFLK
Sbjct: 961  TDNGMPNLSGGASMLNMVGVDQAHSTAGNDAQNTVNANSQQSTLFNDGLFRVPSNGDFLK 1020

Query: 1021 DYYRVPGAXXXXXXXXXXXXXXXXXXXRQAKQQQTNTTDPGFGFTVDASLGLAPLLAWSP 1080
            DYYRVPGA                   RQAKQQQTNTTDPGFGFTVDASLGLAPLLAWSP
Sbjct: 1021 DYYRVPGASSSQLNLMLMGSGSSGSNQRQAKQQQTNTTDPGFGFTVDASLGLAPLLAWSP 1080

Query: 1081 EAAQEPIAETSDHDTRNDSGLRRKSGAETAGVLVAGHSQLADSSTDPASQQQRRVGSYDH 1140
            EAAQEPIAETSDHDTRNDSGLRRKSGAETAGVLVAGHSQLADSSTDPASQQQRRVGSYDH
Sbjct: 1081 EAAQEPIAETSDHDTRNDSGLRRKSGAETAGVLVAGHSQLADSSTDPASQQQRRVGSYDH 1140

Query: 1141 TYAQDQSVEDSAITMPTRPHRGPRRRWNSTTGAAAITPNSDRPRNAPASETDENLQDLFR 1200
            TYAQDQSVEDSAITMPTRPHRGPRRRWNSTTGAAAITPNSDRPRNAPASETDENLQDLFR
Sbjct: 1141 TYAQDQSVEDSAITMPTRPHRGPRRRWNSTTGAAAITPNSDRPRNAPASETDENLQDLFR 1200

Query: 1201 WQNSGF 1206
            WQNSGF
Sbjct: 1201 WQNSGF 1206

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
            (CAT8) - Zinc-cluster protein involved in activating
            gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score = 1519 bits (3933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 768/1210 (63%), Positives = 870/1210 (71%), Gaps = 5/1210 (0%)

Query: 1    MGERENESFGPRFIRTLGSQSISVINPLXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXX 60
            MGERENESFGPRFIRTLGSQS+S  NPL              +                 
Sbjct: 1    MGERENESFGPRFIRTLGSQSLSGTNPLSSQPSSISQSPAQPRTNNSAAPNAARSISPVT 60

Query: 61   XXXXXXNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXX 120
                  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY    
Sbjct: 61   SATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYTETL 120

Query: 121  XXXXXXXXXXXXXXXXXCDLKDEQMHLVYKYSSNKRPEPXXXXXXXXXXXXXXXXXXXXX 180
                             CDLKDEQMHLV KYSSNKR EP                     
Sbjct: 121  EERVRELEAENRRLVALCDLKDEQMHLVSKYSSNKRHEPSSTEEGRMLEQLSNSDGGSLR 180

Query: 181  XXXTNLYLLNKTSPAGHEVPENHKCQGIDCNHTSHPHLHEKPVSTTLSDPTTISFEQHEA 240
               TNLYLLNKT+PA  +  E HKCQG+ CNH SHPHLHEKPVST+LSDP  ISFEQ+EA
Sbjct: 181  VSSTNLYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLHEKPVSTSLSDPAAISFEQNEA 240

Query: 241  PGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYT 300
            PGLPAVKAL++MANHEYS QLA LVALSVPRST+EILFIPQLLARLGQVHGLTSKQCLY+
Sbjct: 241  PGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEILFIPQLLARLGQVHGLTSKQCLYS 300

Query: 301  ASLLASLKEPSQAVVPTTDGLTELKCTSLWEIDDPMRFFKDSCKFNLGSDNDVXXXXXXX 360
            ASLLA+LKE SQ     +    +LK  SLWEIDD M FFK  CKFNL S  D        
Sbjct: 301  ASLLAALKESSQTSFQGSPDYKDLKDKSLWEIDDCMTFFKTGCKFNLTSSKDAECLTISE 360

Query: 361  XXXXXXXYFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSISYKI 420
                   YF ECHALIPVLNE EFYKYYNKFK +LT DP FF  +  SFA RSKSISYKI
Sbjct: 361  IEELISIYFGECHALIPVLNEAEFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKI 420

Query: 421  FACILLVVCQLGIMSKVKREQLPAKSKFSRIMAYYNNAILALKLNPYFSVKTTSVKTXXX 480
            FACILLV+CQ G+M+KVKREQLP K+KFS +M+YY+NA+LALK NPYFSVK TS++T   
Sbjct: 421  FACILLVICQFGLMAKVKREQLPTKNKFSLLMSYYSNALLALKTNPYFSVKNTSIQTLQL 480

Query: 481  XXXXXXXXXNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF 540
                     NVGEVSSVYE+RGT+VSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF
Sbjct: 481  LSLLLFYYLNVGEVSSVYEIRGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLF 540

Query: 541  WGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLL 600
            WGIYYLDVF ALQLGVPRLLKDHEIECALPISE+ H GVSLADQVI+LEGQVSE SLSLL
Sbjct: 541  WGIYYLDVFGALQLGVPRLLKDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLL 600

Query: 601  RFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNGTINMEEL 660
            RFSKILGNILDSIFKRGMTSS AQQVALIHENALD+WRRGLPKNLTFELDVNGTI +EEL
Sbjct: 601  RFSKILGNILDSIFKRGMTSSAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEEL 660

Query: 661  NSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAAKPLLGGASEVDTDATLXXXXX 720
               +   +D++   S D + LM+LYFLVKCLVHLPVLAAKPLLGG+SE D DAT      
Sbjct: 661  TGSAQNNQDFTKNASSDKKILMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPAFDDA 720

Query: 721  XXXXXXXXXXYVLLQQATNTFLSVQSSLKSRHLPLALNLPRIKARFALLSARGILEYTKG 780
                      YVLLQQATNTFLSVQS  K+RHLPLA++LPRIKARFALLSARGILEYTKG
Sbjct: 721  SSGADRSSSSYVLLQQATNTFLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKG 780

Query: 781  GALFQGNKALLLDVVKELETTKRLEIPGSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLL 840
            GALFQ NKALLL+VVKELE +K+LE+PGSLSWHSLILLDMA  LIMQPP TK  KLDKLL
Sbjct: 781  GALFQDNKALLLEVVKELEASKKLELPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLL 840

Query: 841  EAKLSYYNKLMGRSANVASTKRKKEEDNTSLSNATKLTPLXXXXXXXXEKRVKLEHTDKV 900
            E +L+YYNKLMGRS   ++ KRK EE N + S  +KLTPL        +KR+K+E     
Sbjct: 841  ETRLNYYNKLMGRSTLTSNGKRKNEE-NDATSKVSKLTPLSSEYNTPSDKRIKVESIGSS 899

Query: 901  GETPVGVENTGQPNGNTQEHYAATWSNQNQPHSTVAEAFHLDPVLNNNPFSNGDLTAFFS 960
            G  P   E+    +    + ++  W + N   + +AEAFHLDPVLN NPFSNGDLTAFF+
Sbjct: 900  GNVPSNSESVHHFDDIQNDKFSTNWPSNNPQPNAIAEAFHLDPVLNGNPFSNGDLTAFFN 959

Query: 961  TDNGMPNLSGGASMLNMVGVDQAHSTAGNDAQNTVNANSQQ--STLFNDGLFRVPSNGDF 1018
            +DNG+P + GG+S+LN+ G+  A+S   N+  N       +  +T  NDGLFRVPSNGDF
Sbjct: 960  SDNGIPQIGGGSSVLNLAGIGAANSNELNNNNNEAAGGGPRKVATTVNDGLFRVPSNGDF 1019

Query: 1019 LKDYYRVPGAXXXXXXXXXXXXXXXXXXXRQAKQQQTNTTDPGFGFTVDASLGLAPLLAW 1078
            LKDYYR+PGA                        Q+ N T PGFGFTVDASLGLAPLLAW
Sbjct: 1020 LKDYYRIPGASSSQLNLMFMGPGNTGANQNAPNNQKNNFTVPGFGFTVDASLGLAPLLAW 1079

Query: 1079 SPEAAQEPIAETSDHDTRNDSGLRRKSGAETAGVLVAGHSQ-LADSSTDPASQQQRRVGS 1137
            SPEA Q  + E + +  R DS    ++   +A +  +  +  ++  S +   ++Q R  S
Sbjct: 1080 SPEAPQPSMPEIAQNADRRDSDPLSRTRLPSATIPASDPTHVISQDSNNVHLREQYRSNS 1139

Query: 1138 YDHTYAQDQSVEDSAITMPTRPHRGPRRRWNSTTGAAAITPNSDRPRNAPASETD-ENLQ 1196
            ++  YAQDQS++D+AIT+PTR HRGPRRRWNS+ G   ITPNSDRPRN P+SE++ EN +
Sbjct: 1140 FNQLYAQDQSLDDTAITIPTRSHRGPRRRWNSSNGTTVITPNSDRPRNPPSSESENENYK 1199

Query: 1197 DLFRWQNSGF 1206
            DLFRWQNSGF
Sbjct: 1200 DLFRWQNSGF 1209

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1270

 Score = 1135 bits (2936), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/1297 (48%), Positives = 802/1297 (61%), Gaps = 118/1297 (9%)

Query: 1    MGERENESFGPRFIRTLGSQSISVINPLXXXXXXXXXXXXXXKXX--------------- 45
            M +RE E+F PR IRTLGSQS+S +NP                                 
Sbjct: 1    MSKRERETFAPRIIRTLGSQSLSGLNPFSSSNPSSLSQSPATSSTVPHVAANNTTMSPTP 60

Query: 46   --XXXXXXXXXXXXXXXXXXXXXNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKV 103
                                   NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+
Sbjct: 61   LNSNNMGTGTSVTSGADTPASASNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKI 120

Query: 104  SDKLSRRAFPRGYXXXXXXXXXXXXXXXXXXXXXCDLKDEQMHLVYKYSSNKRPEPXXXX 163
            SDKLSRRAFPRGY                     CDLK+EQ+HLV KYS+ +  E     
Sbjct: 121  SDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQLHLVSKYSNKRTSEISENE 180

Query: 164  XXXXXXXXXXXXXXXXXXXXTNLYLLNKTSPAGHEVPENH-------KCQGIDCNHTSHP 216
                                TNLYLLNKT+P   +  E+         C G+ CNH+  P
Sbjct: 181  DEQILQQLSAANGGSLRVSSTNLYLLNKTTPGDQQDEEDQMSSKTTVDCNGVGCNHSHQP 240

Query: 217  HLHEKPVSTTLSDPTTISFEQHEAPGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEI 276
            ++H+KPVST L+DPT+ISFEQ+EAPGLPAVKAL+SMANHE+S QLA LVALSVPRSTEEI
Sbjct: 241  NIHDKPVSTNLNDPTSISFEQNEAPGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEI 300

Query: 277  LFIPQLLARLGQVHGLTSKQCLYTASLLASLKEPSQAVVPTTDGLTELKCTSLWEIDDPM 336
            L IPQLLAR+GQVHGLTSKQ LYTASLLASLKE     +PT   +  LK T+LWE+DD +
Sbjct: 301  LLIPQLLARIGQVHGLTSKQSLYTASLLASLKESIPLTLPTNVDM--LKSTNLWEVDDVI 358

Query: 337  RFFKDSCKFNLGSDNDVXXX---XXXXXXXXXXXYFEECHALIPVLNENEFYKYYNKFKE 393
            +FF+   KF++ +++                   +F + +  IP+L+++EFY YYNKFK 
Sbjct: 359  QFFQTVFKFDIQAESSTTSQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKT 418

Query: 394  SLTVDPNFFGKANSSFAHRSKSISYKIFACILLVVCQLGIMSKVKREQLPAKSKFSRIMA 453
             L +DPNFF    + F  R+KSISYKIF CILL++CQ+G++SKVK E LPA +K+S++MA
Sbjct: 419  DL-MDPNFFDDEKNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLPATNKYSQLMA 477

Query: 454  YYNNAILALKLNPYFSVKTTSVKTXXXXXXXXXXXXNVGEVSSVYELRGTIVSMAQQLRL 513
            YY+  +  L +NPYF++K+TS+++            N+GEVSSVY+LRG +VSM+QQLRL
Sbjct: 478  YYDIVVRQLMMNPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRL 537

Query: 514  HRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISE 573
            HRCPSAVLG  GS +SK++QG+RR+LFWGIYYLDVFSALQLGVPRLLKDHEIECALP+++
Sbjct: 538  HRCPSAVLGGNGSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVAD 597

Query: 574  NGHPGVSLADQVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHENA 633
            N    V+LA Q+I LEG+VS  SLS++RF+K+LGNILDSIFKRGM++S+ +Q++L+HENA
Sbjct: 598  NDDQKVNLAGQMIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENA 657

Query: 634  LDSWRRGLPKNLTFELDVNGTINMEELNSGSHWKKDYSTAP--SCDNRTLMVLYFLVKCL 691
            LD+WRRGLP+ L FELDVNGTINM+E N   H K+  ++    S +N++LMVLYF+ KC+
Sbjct: 658  LDNWRRGLPQQLKFELDVNGTINMDEFN---HLKQLDTSGNMYSKENKSLMVLYFMAKCM 714

Query: 692  VHLPVLAAKPLLGGASEVDTDATLXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSSLKSR 751
            +HLPV+A +PL+    +    +T                YVLLQQATNT L+V +SL++ 
Sbjct: 715  IHLPVVAKRPLVNDPEQSPESST----PSNNCGDRSSSSYVLLQQATNTLLNVFTSLRNV 770

Query: 752  HLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGSLS 811
            + P+ +N+ R K RF+LLSARG LEYTKGGALFQ NKALLLD+VKELE  K+LE+PG+LS
Sbjct: 771  YPPIPINVSRTKTRFSLLSARGSLEYTKGGALFQDNKALLLDLVKELEVDKKLELPGTLS 830

Query: 812  WHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGRSANVASTK---------R 862
            WHSL LLDM++SLI+QP +TK  KL+K+L+ KL+YYNKL  R +N+   +         +
Sbjct: 831  WHSLKLLDMSISLILQPANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSPGGNSK 890

Query: 863  KKEEDNTSLSNATKLTPLXXXXXXXXEKRVKLEHTDKVGETPV-GVENTGQPNGNTQEHY 921
            +K ++N   +   KLTP         +K++KLE T   G  PV  V    Q +    E++
Sbjct: 891  RKLDENQGSAEPPKLTPASSKGDTPPDKKIKLEDT---GFVPVRAVSQHSQSDSEKFENF 947

Query: 922  AATWSNQNQPHSTVAEAFHLDPVLNNNPFSNGDLTAFFSTDNG-MP-NLSGGASMLNMVG 979
                +    P +++AEAFHLDPVLNNNPFSN DL AFF+T+NG +P  L  G S+ N+  
Sbjct: 948  QPPVA----PQNSIAEAFHLDPVLNNNPFSNTDLNAFFNTNNGNVPAALRSGGSLFNIAA 1003

Query: 980  VDQAHSTAGNDAQNTVNANSQQSTLFNDGLFRVPSNGDFLKDYYRVPGAXXXXXXXXXXX 1039
               A   +GN+A +T  +N+      N+GLF+VPSNGDFLKDYY VPGA           
Sbjct: 1004 TAAA---SGNNANSTAPSNT-----LNEGLFKVPSNGDFLKDYYNVPGASSSQLNLLFLN 1055

Query: 1040 XXXXXXXXR------QAKQQQTNTTDPGFGFTVDASLGLAPLLAWSPEAAQEPIAETSDH 1093
                    +       +  Q  N  + GFGF VDAS GLAPLL WSP  A +P+   + +
Sbjct: 1056 NNASNGKPQLNGSSAHSGTQAQNNDNNGFGFAVDASWGLAPLLEWSP--AGKPVDPGTCN 1113

Query: 1094 DTRND-----SGLRRKSGAETAGVLVAGHSQLADSS------TDPASQ------------ 1130
               N      S    +S   T G L +      D+       T P+S+            
Sbjct: 1114 ANENSIILDTSAANMESEMATGGRLHSNTRSYTDAKNLDIVPTLPSSKQQQQQQHRLQKG 1173

Query: 1131 --QQRRVGSY---------DHTYAQDQSVEDSAITMPTRPHRGPRRRWNSTTG------- 1172
              QQ R  S           +      S +D  +TM TR HRGPRRRWNSTTG       
Sbjct: 1174 ASQQPRSASIPTRKQSLCESNPTTATGSRDDGVLTMGTRNHRGPRRRWNSTTGQNTRTQL 1233

Query: 1173 AAAITPNSDRPRNAPASE---TDENLQDLFRWQNSGF 1206
            A   TP S+R ++    E   T+++L DLFRWQNSG 
Sbjct: 1234 ATMNTPQSERSKSQNIGEPGSTEDSLHDLFRWQNSGL 1270

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
            YMR280C
          Length = 1301

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/1014 (49%), Positives = 639/1014 (63%), Gaps = 76/1014 (7%)

Query: 67   NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXXX 126
            N RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC++SDKLSRRAFPRGY          
Sbjct: 95   NLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYTETLEERVRE 154

Query: 127  XXXXXXXXXXXCDLKDEQMHLVYKYSSNKRPEPXXXXXXXXXXXXXXXXXXXXXXXXTNL 186
                       CD+K++Q+HLV  + +NK+                           TNL
Sbjct: 155  LEAENRRLVALCDIKEQQIHLVSHFPTNKKK--IGGNDEQMLQELTGANNGRLRISSTNL 212

Query: 187  YLLNKT----SPA------------GHEVPENHKCQGIDCNHTSHPHLHEKPVSTTLSDP 230
            +LLNK      PA             HE    H+C  +DCN+     LH KPVST L+DP
Sbjct: 213  FLLNKARDGKQPATISNGDDHMTKPDHEHTGKHRCDELDCNN----KLHSKPVSTNLNDP 268

Query: 231  TTISFEQHEAPGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARLGQVH 290
            T ISFEQ+EAPGLPAVKAL+SMA  E STQLA LVALSVPRSTEEILFIPQLLAR+ Q+H
Sbjct: 269  TAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEEILFIPQLLARIIQIH 328

Query: 291  GLTSKQCLYTASLLASLKE--PSQAVVPTTDGLTELKCTSLWEIDDPMRFFKDSCKFNL- 347
            G TSKQCLY+ SLLASLK   P   +V   D L  LK T+LWE+D+  +FF ++ KFN+ 
Sbjct: 329  GFTSKQCLYSVSLLASLKNNLPGPQLV-KWDELDYLKTTNLWEVDNLDKFFHETLKFNIL 387

Query: 348  ----GSDNDVXXXXXXXXXXXXXXYFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFG 403
                  D +               +F+     IP+L++ EF+ YY+K K+ ++  P  F 
Sbjct: 388  RPGVSDDGESLGLSIKEIDELVNLFFDSWAVHIPILDKEEFFSYYDKLKKDISTQPGLFQ 447

Query: 404  KANSSFAHRSKSISYKIFACILLVVCQLGIMSKVKREQL-PAKSKFSRIMAYYNNAILAL 462
            +  S+FA R+K ISYKIFACIL  VCQ+G+++KVK E++  A S + ++ +YY+ AI  +
Sbjct: 448  EGPSNFARRNKIISYKIFACILFTVCQMGLLTKVKGEKITSADSPYVKLTSYYHRAISLI 507

Query: 463  KLNPYFSVKTTSVKTXXXXXXXXXXXXNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLG 522
             LNPYF V TTS+++            N G VS++YELRG +VSMAQQLRLHRCPSAVLG
Sbjct: 508  YLNPYFGVLTTSLQSLQFLSLLLFYFVNTGNVSAIYELRGRVVSMAQQLRLHRCPSAVLG 567

Query: 523  TEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLA 582
              GSTM+K EQGDRR+LFWGIYYLDVFSALQLGVPRL+KD EIECALP++EN    VSLA
Sbjct: 568  GSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVAENDDREVSLA 627

Query: 583  DQVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLP 642
             Q+IRLEG+VS+FSL+++RF+K+LGNILD++FKRGMT S+++++ALIHENALD+WRRGLP
Sbjct: 628  GQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMTESVSKKLALIHENALDNWRRGLP 687

Query: 643  KNLTFELDVNGTINMEELNSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAAKPL 702
              L FE++VNGTINM++ N     K++ +T  + +   L+V YFL KC++HLPV+A +PL
Sbjct: 688  AELIFEIEVNGTINMDKFN---EMKQNNATVENVEQMVLLVSYFLAKCMIHLPVVATRPL 744

Query: 703  LGGA---SEVDTDATLXXXXXXXX-XXXXXXXYVLLQQATNTFLSVQSSLKSRHLPLALN 758
                   S++  +  +                YVLLQQATNT L+V  SLKS +LPL  N
Sbjct: 745  PSSDDPNSDIKEEEEVNDKNGESNFAIRSSSSYVLLQQATNTMLNVLESLKSIYLPLPFN 804

Query: 759  LPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGSLSWHSLILL 818
            + R KARFALLSARG LEY KGGALF  NKALLLDVVK +E  ++LEIPG +SWH L LL
Sbjct: 805  VARTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLEIPGVISWHGLKLL 864

Query: 819  DMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGRSANVAST--------KRKKEEDNTS 870
            DM +SL++QPP+TK  KLD+LL+ KL+YY+++MGR     S+        +R   +D  S
Sbjct: 865  DMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSLRQEANGKRRNSSDDKLS 924

Query: 871  LSN------ATKLTPLXXXXXXX-XEKRVKLEHTDKVGETPVGVENTGQPNGNTQEHYAA 923
             S       AT LTP+         EK++KLE            E++   N    + Y  
Sbjct: 925  RSGTEENFRATNLTPISSKSDGSPVEKKIKLED-----------ESSDTSNALVDKSYTD 973

Query: 924  TWSNQ-NQP------HSTVAEAFHLDPVLNNNPFSNGDLTAFFSTDNGMPNLSGG--ASM 974
              S+  NQP       + +AEA HLDPVLNNN  S  DL AFF  +  MP   G   +S 
Sbjct: 974  DLSSSANQPQVPASTQTAIAEALHLDPVLNNNILSVADLAAFFGGN--MPAAGGNQHSSY 1031

Query: 975  LNMVGVDQAHSTAGND-AQNTVNANSQQSTLFNDGLFRVPSNGDFLKDYYRVPG 1027
             N       H     + A  +  A+ + S    DGLFRVPSN DFL D Y   G
Sbjct: 1032 TNQNDFAPKHMRKEKEPAAFSDLAHKKSSVTGVDGLFRVPSNADFLMDEYYPSG 1085

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/20 (85%), Positives = 17/20 (85%)

Query: 1062 FGFTVDASLGLAPLLAWSPE 1081
            F F VDASLGLAPLL WSPE
Sbjct: 1161 FNFAVDASLGLAPLLDWSPE 1180

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 21/28 (75%)

Query: 1  MGERENESFGPRFIRTLGSQSISVINPL 28
          M E   +  GP++IRT+GSQS+S +NPL
Sbjct: 1  MKEMAAKDGGPKYIRTMGSQSLSGLNPL 28

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR280C
            (CAT8)
          Length = 1285

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 571/1338 (42%), Positives = 737/1338 (55%), Gaps = 194/1338 (14%)

Query: 4    RENESFGPRFIRTLGSQSISVINPLXXXXXXXXXXXXXXKXX--XXXXXXXXXXXXXXXX 61
            +E + +GPR IRTLGSQ++                                         
Sbjct: 6    KEKDGYGPRIIRTLGSQALGGAGGSSRASSVSQSPGGPEGATGGASPAAAPQSTTGTPLS 65

Query: 62   XXXXXNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXX 121
                 NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+SDKLSRRAFPRGY     
Sbjct: 66   SLTPTNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLE 125

Query: 122  XXXXXXXXXXXXXXXXCDLKDEQMHLVYKYS-----------SNKRPEPXXXXXXXXXXX 170
                            CDLK+EQ+ LV KY            +NK+ +            
Sbjct: 126  ERVRELEAENRRLVALCDLKEEQLRLVSKYGCASAPATSSSSANKKGDSDHTTLEDEQIL 185

Query: 171  XXXXXXX--XXXXXXTNLYLLNKTS---PAGHEVPENHKCQGIDCN-----HTSHPHLHE 220
                           TNLYLLNK +   P    V +N     +  N       S  H+ E
Sbjct: 186  QQLSNSDGGALRVSSTNLYLLNKKTAAFPLVQPVQQNLSPTQLRSNPYTRATLSPSHVAE 245

Query: 221  -------------KPVS-------------TTLSDPTTISFEQHEAPGLPAVKALSSMAN 254
                          PV+             T L+DPT+ISFEQ +APGLPAVKALSS+A+
Sbjct: 246  ADHVTDLRKGLPANPVAISSSVGQVPPYPFTNLNDPTSISFEQDQAPGLPAVKALSSLAS 305

Query: 255  HEYSTQLACLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYTASLLASLKEPSQAV 314
            HE S+QLA LVA+S+PR+TEEILF+PQLLAR+GQ+HG TSKQCLYTAS+LASLKE    +
Sbjct: 306  HEESSQLAALVAVSIPRTTEEILFVPQLLARIGQMHGFTSKQCLYTASVLASLKE----I 361

Query: 315  VP--TTDGLTELKCTSLWEIDDPMRFFKD----------SCKFNLGSDN----------- 351
             P  T+  L +LK  +LWEID+   F  +          S  FNL + N           
Sbjct: 362  TPRKTSSILEQLKAKNLWEIDNVDTFLLEGLQIDIRRGSSGDFNLENPNGYKLENEYHQT 421

Query: 352  --------DVXXXXXXXXXXXXXXYFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFG 403
                    ++              +F++ ++LIP+ + +EF  Y+ KFK++++  P FF 
Sbjct: 422  KDAHPELQELTPLTFQEIEELIQLFFDDWYSLIPIFDRSEFESYWVKFKDNVST-PGFFT 480

Query: 404  KANSSFAHRSKSISYKIFACILLVVCQLGIMSKVKREQLPAKSKFSRIMAYYNNAILALK 463
              ++ F  R KSISYKIFAC+LL VCQ+G+MSKVKRE+     + + +M YY+ AI  + 
Sbjct: 481  SGDTLFDRRHKSISYKIFACLLLTVCQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVI 540

Query: 464  LNPYFSVKTTSVKTXXXXXXXXXXXXNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGT 523
            +NPYFS  +TS+++            NVG+VS+VYELRG +VS+ QQLRLHRCPSAVLG+
Sbjct: 541  MNPYFSSSSTSIQSLQLLSLLLFYFLNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGS 600

Query: 524  EGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLAD 583
            +GST+ K +QG+RR+LFWG+YYLDVFS+LQLGVPRL+KDHEIECALP+S +    V+LA 
Sbjct: 601  DGSTVGKIQQGERRVLFWGVYYLDVFSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAG 660

Query: 584  QVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPK 643
            Q+I LEG++S FSLS++RFSK+LGN+LDSIFKRGMT S+ +QVAL+HENALD+WR  LP 
Sbjct: 661  QMIALEGKMSPFSLSIIRFSKVLGNVLDSIFKRGMTESMTKQVALVHENALDNWRHALPD 720

Query: 644  NLTFELDVNGTINMEELNSGSHWKKDY---STAPSCDNRTLMVLYFLVKCLVHLPVLAAK 700
            NL F+LDVNGTINME+LN     K+DY    TA   +N   M LYFL K ++HLPV+A K
Sbjct: 721  NLRFQLDVNGTINMEDLN---QLKRDYLNKDTALKLNNAIFMALYFLAKIMIHLPVVATK 777

Query: 701  PLLGGASE-VDTDATLXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSSLKSRHLPLALNL 759
            P++      VDT+                  YVLLQQATNTFL+V SS+ S +LPL LN+
Sbjct: 778  PIIDKPQPVVDTNIP------GSQIDRSSSSYVLLQQATNTFLNVLSSVSSLYLPLPLNI 831

Query: 760  PRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGSLSWHSLILLD 819
             R K RF L+SARG LEYTKGGALFQ NK LLLD++K+LE  K+L +PG++SWHSL LLD
Sbjct: 832  TRTKTRFGLVSARGSLEYTKGGALFQDNKNLLLDLLKDLEADKKLNMPGTISWHSLKLLD 891

Query: 820  MAVSLIMQPPHTKAGKLDKLLEAKLSYYNKL----MGRSANV------------------ 857
            MAV+LI+QPP+TK  K +KLL+ K++YYNKL    +G +A++                  
Sbjct: 892  MAVNLILQPPNTKPEKQEKLLQKKINYYNKLIDSHLGPTASLPTPGQTAPRKPEPAHARP 951

Query: 858  -------ASTKRKKEEDNTSLSNATKLTPLXXXXXXXXEKRVKLEHTDKVGET---PVGV 907
                    S+KR + +DN     A  + PL        EK+VKLE       T   P+  
Sbjct: 952  IPEKEKPPSSKRHRGDDNA----AASMPPL-------LEKKVKLEAPASNMPTPPAPISA 1000

Query: 908  ENTGQP---NGNTQEHYA-ATWSNQNQP----HST----VAEAFHLDPVLNNNPFSNGDL 955
             +   P   +G+   + + A  + +++P    HS+    + EAF LDP+L   PFSN DL
Sbjct: 1001 LHEDVPRVLDGHLGANSSLAVLAAKHEPEGSLHSSAGNAITEAFQLDPILQPTPFSNTDL 1060

Query: 956  TAFFSTDN--GMPNLSGGASMLNMVGVDQAHSTAGNDAQNTVNANSQQSTLFNDGLFRVP 1013
             +FF  D     P L    +       D+    A      T            D LF+VP
Sbjct: 1061 PSFFGVDQYAAPPELQPFPA--GYAAPDKVPQAAAQGPSATAGPPLSS----KDSLFKVP 1114

Query: 1014 SNGDFLKDYYRVPGAXXXXXXXXXXXXXXXXXXXRQAKQQQTNTTD-----PGFGFTVDA 1068
            SNGDFLKDYY                         +A Q     +D     PG+GF VDA
Sbjct: 1115 SNGDFLKDYY---SGMSSAQLNSLFTAPDRRDVRPRAPQPDRAPSDGLQQQPGYGFVVDA 1171

Query: 1069 SLGLAPLLAWSPEAAQEPIAETSDHDTRNDSGLRRKSGAETAGV-LVAGHSQLADSSTDP 1127
            SLGLAPLLAWSP  A        D    +D G +  S      V  ++    L  +   P
Sbjct: 1172 SLGLAPLLAWSPRPA--------DDLLLDDKGAKLASARSFTHVNKLSSIPTLMSTQPPP 1223

Query: 1128 ASQQQRRVGSYDHTYAQDQSVEDSAITMPTRPHRGPRRRWNSTTGAAAITPNSDRPRNAP 1187
            AS    ++G        DQ  +D  +T+P R  RGPRR WNS    A            P
Sbjct: 1224 ASAPHAKLG---QPAPPDQ--DDGILTIPPRDQRGPRRLWNSALNQA-----------RP 1267

Query: 1188 ASETDENLQDLFRWQNSG 1205
            A+  D+++ DLFRWQNSG
Sbjct: 1268 AAALDDSISDLFRWQNSG 1285

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1445

 Score =  884 bits (2285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/1329 (40%), Positives = 720/1329 (54%), Gaps = 255/1329 (19%)

Query: 68   YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXXXX 127
            YRVAQACDRCR+KK RCDGKRPQC+QCAAVGFECK+SDKLSRRAFPRGY           
Sbjct: 177  YRVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYTETLEERVREL 236

Query: 128  XXXXXXXXXXCDLKDEQMHLVYKYSSNKRP---EPXXXXXXXXXXXXXXXXXXXXXXXXT 184
                      CDLK+EQ+HLV KYS++K     E                         T
Sbjct: 237  EAENRRLVALCDLKEEQLHLVSKYSNSKDENGVEIPSTEEEQILHELSKTNGGSLRVSST 296

Query: 185  NLYLLNKTSPAGHEVPENHKCQGIDCNH--TSHPHLHEKPVSTTL--------------- 227
            NLYLLNK +  G            D +H  +S P +  + V+ T                
Sbjct: 297  NLYLLNKKASPG------------DDSHIESSEPSIPVRKVAITAPSPRIMSPRNSVADS 344

Query: 228  -------------------------SDPTTISFEQHEAPGLPAVKALSSMANHEYSTQLA 262
                                     +DP  ISFEQ+EAPGLPA+KALSS++ ++  TQLA
Sbjct: 345  DPSQTNTGNNDHIHSNNNNHNQNNSTDPYGISFEQNEAPGLPALKALSSLSKYKQGTQLA 404

Query: 263  CLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYTASLLASLKEPSQAVVPTTDGLT 322
             LVA+SVPR+TEEILF+PQLLAR+GQ+HG TSKQC+YTAS+LASLKE + + +P    L 
Sbjct: 405  TLVAVSVPRTTEEILFVPQLLARIGQIHGFTSKQCIYTASVLASLKENNISSIPPE--LE 462

Query: 323  ELKCTSLWEIDDPMRFFKDSCKFNLGS----DNDVXXXXXXXXXXXXXXYFEECHALIPV 378
             LK  +LWEIDD + F+K+  K +  +    D+                +F++ + LIP+
Sbjct: 463  VLKNHNLWEIDDVLHFWKNVFKLDFMTHTAVDHSSTHLNFAEVEELMQLFFQDWYELIPL 522

Query: 379  LNENEFYKYYNKFKESLTVDPNFF-GKANSSFAHRSKSISYKIFACILLVVCQLGIMSKV 437
             ++NEF  YY KFK ++T DPNFF  K ++ F +R++SISYKIF+C+L+++ Q+G++SK+
Sbjct: 523  FDKNEFNSYYEKFKLNVT-DPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKI 581

Query: 438  KREQLPAKSKFSRIMAYYNNAILALKLNPYFSVKTTSVKTXXXXXXXXXXXXNVGEVSSV 497
            KR+++ +  K S +M YY+  +  + +NPYF+ + TS++             NVG++SS+
Sbjct: 582  KRDKITS-GKLSTLMKYYDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSI 640

Query: 498  YELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVP 557
            YELRG +VSM+QQLRLHRCPSAVLG +GST+SK +QG+RR+LFW IYYLDVFSALQLGVP
Sbjct: 641  YELRGKVVSMSQQLRLHRCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVP 700

Query: 558  RLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRG 617
            RLLKD EIECALP++ +    V+LA Q+I LEG+VS+FSLS++RF+K++GNILDS FKRG
Sbjct: 701  RLLKDFEIECALPVTSDDDRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRG 760

Query: 618  MTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNGTINMEELNSGSHWKKDYS---TAP 674
            MT+S+ +Q AL+HENALD+WR GL K+L F+LDVNGTINM+E N    + K  S    A 
Sbjct: 761  MTTSLTKQAALVHENALDNWRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAF 820

Query: 675  SCDNRTLMVLYFLVKCLVHLPVLAAKPLLGGASEVDTDATLXXXXXXXXXXXXXXXYVLL 734
            + ++  LM LYF+ KC++HLPV+A KPL+  A +  TD                  YVLL
Sbjct: 821  THNSLVLMTLYFMAKCMIHLPVVATKPLVAEAIQTPTD----NQTENGSVDRSLSSYVLL 876

Query: 735  QQATNTFLSVQSSLKSRHLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDV 794
            QQATNT L+V ++L S +LPL +NL R K RF L SARG LEYTKGGALFQ NKALLLD+
Sbjct: 877  QQATNTLLNVLTALNSIYLPLPINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDL 936

Query: 795  VKELETTKRLEIPGSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGR- 853
            VKELET K+LE+PG+ SWHSL L D++++LI+QP ++   K +K+++ K++YYNKLMG+ 
Sbjct: 937  VKELETDKKLELPGNTSWHSLKLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQP 996

Query: 854  ----------SANVASTKRKKEEDNTSLSNATKLTPLXXXXXXXXEKRVKLEHTDKVGET 903
                       A   ++K+ K ED+ S  N   +T          E+ VK    D   E 
Sbjct: 997  TVAVKRKRDPKATENTSKKVKVEDDHSQDNLHNITTGETTDTVHSEELVK----DVPKEL 1052

Query: 904  PVGVENTGQPNGNTQEHYAATWSNQNQPHSTVAEAFHLDPVLNNNPFSNGDLTAFFST-- 961
             V  EN                      ++T+ EAF +DPVLN N FSN DL   F++  
Sbjct: 1053 NVYPEN----------------------YTTIEEAFQMDPVLNTNLFSNTDLKTLFNSGI 1090

Query: 962  --------------------------------------------DNGMPNLSGGASMLNM 977
                                                        D+GM   S  AS+LN+
Sbjct: 1091 FENAGSIHNNINDNNNNNNNTNNTNNNNGSSRNIHNLGAGIEDIDHGMSLRSNDASLLNL 1150

Query: 978  VGVDQAHSTAGNDAQNTVNANSQQSTLFN----DGLFRVPSNGDFLKDYY---------- 1023
                  H   GN A+   +  S  S L N    D LF+VPSNGDFLKDYY          
Sbjct: 1151 SNALGNH---GNSAEGMKDGTS-VSNLLNLSTSDSLFKVPSNGDFLKDYYINNMSNTGLS 1206

Query: 1024 --------RVP------------GAXXXXXXXXXXXXXXXXXXXRQAKQQQTNTTDPGFG 1063
                    + P            G+                      KQ+     D GF 
Sbjct: 1207 NLHTSSVNKGPSLSQLGSLFMSSGSGTNLPYSNVRGESKHPSGVNLNKQRAQPAMD-GFS 1265

Query: 1064 FTVDASLGLAPLLAWSPEA---------------AQEPIAETSDHDTRNDSGL------- 1101
            F  DASLGLAPLLAWSP+A               A   + E+ D+D+ N S +       
Sbjct: 1266 FAADASLGLAPLLAWSPDAKPQLNSNNGNDGLNPATGIVLESGDNDSTNASVVQLQQHQQ 1325

Query: 1102 -----------------------RRKS-GAETAGVLVAGHS-QLADSSTDPASQQQRRVG 1136
                                   R+ S   +  G   + HS  + + ++     Q + +G
Sbjct: 1326 QTHHPPSHNSSSIPMGKQSSTSDRQNSHHQDNVGSFHSMHSPTIPEQTSAQGLHQHQMLG 1385

Query: 1137 SYDHTYAQDQSVEDSAIT--MPTRPHRGPRRRWNSTTGAAAITPNSDRPRNAPASETDEN 1194
              + T   D +   + +T  + +   RGPRRRWN+   ++            P S  D +
Sbjct: 1386 MPNSTLNSDTNTGGANVTNSISSTNRRGPRRRWNNAASSS-----------DPNSAGDSS 1434

Query: 1195 LQDLFRWQN 1203
            + DL RWQN
Sbjct: 1435 VSDLLRWQN 1443

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 18/19 (94%)

Query: 10 GPRFIRTLGSQSISVINPL 28
          GPRFIRTLGSQS+S +NPL
Sbjct: 19 GPRFIRTLGSQSLSGLNPL 37

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
            {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
            ABL121Cp and similar to YMR280C uniprot|P39113
            Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
            transcriptional activator
          Length = 1250

 Score =  825 bits (2131), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/1106 (45%), Positives = 631/1106 (57%), Gaps = 127/1106 (11%)

Query: 67   NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXXX 126
            N RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+SD+LSRRAFPRGY          
Sbjct: 97   NLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYTETLEERVRE 156

Query: 127  XXXXXXXXXXXCDLKDEQMHLVYKYSSNKRPEPXXXXXXXXXXXXXXXXXXXXXXXXTNL 186
                       CD+K++Q+HL   +S    P                          TNL
Sbjct: 157  LEAENRRLVALCDIKEQQIHL---FSQQHSPGGRRKDDERMLRELQSANGGSLNISSTNL 213

Query: 187  YLLNKTSPAGHEVP-------------ENHKCQGIDCNHTSHPHLHEKPVSTTLSDPTTI 233
            YLLN  S                    + H C G+ C       LH KPVST L+DPT++
Sbjct: 214  YLLNTGSHQRQGPQGPQQQEQLTQQKRQPHVCDGLCCAG----KLHVKPVSTNLNDPTSV 269

Query: 234  SFEQHEAPGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARLGQVHGLT 293
            SFEQ EAPGLPAV+AL+S+A  E S QLA LVALSVPRSTEEILFIPQLLAR+ Q++G T
Sbjct: 270  SFEQSEAPGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILFIPQLLARIRQIYGFT 329

Query: 294  SKQCLYTASLLASLKE--PSQAVVPTTDGLTELKCTSLWEIDDPMRFFKDSCKFNLGSDN 351
            SKQCLYT SLL+SLK   P   +V   + L  L  T+LWE+DD  +FF +  KF L S +
Sbjct: 330  SKQCLYTVSLLSSLKSSLPEPHLV-KHEPLETLASTNLWEMDDLEQFFAEIFKFKLESKS 388

Query: 352  DV-----XXXXXXXXXXXXXXYFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFG--- 403
                                 +FE     IP+L ++EFY Y+N+FKE++  +  F     
Sbjct: 389  PSSYKGGAQLNLSEIEELISIFFEHSSIHIPILVKDEFYHYFNQFKENVLQNLEFLKTPL 448

Query: 404  KANSSFAHRSKSISYKIFACILLVVCQLGIMSKVKREQLPAKSKFSRIMAYYNNAILALK 463
            +  +  A R K ISYKIF CI+L++CQLG++SK+K E L A SK  R+ +YY+ AI  + 
Sbjct: 449  QGPALTARRGKIISYKIFGCIILMLCQLGLLSKIKAENLGATSKHHRLASYYHKAISLVY 508

Query: 464  LNPYFSVKTTSVKTXXXXXXXXXXXXNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGT 523
            +NPYF V +TS+++            N+G VS++YELRG +VSMAQQLRLHRCPSAVLG 
Sbjct: 509  MNPYFGVLSTSLQSLQFLSLVLFYFLNIGNVSAIYELRGRVVSMAQQLRLHRCPSAVLGG 568

Query: 524  EGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLAD 583
             GSTM+K EQGDRR+LFWGIYYLDVFSALQLGVPRL+KD EIECALP+++N    V+LA 
Sbjct: 569  AGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVNLAG 628

Query: 584  QVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPK 643
            Q IRLEGQV+ +SL+++RFSK+LGNILDSIFKRGMT SI +QV+LIHENALD+WR GLPK
Sbjct: 629  QQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIHENALDNWRHGLPK 688

Query: 644  NLTFELDVNGTINMEELNSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAAKPLL 703
             L FELDVNGTIN++E N     K+   T    +N TL+V+YFL KC++HLPV+A +PL 
Sbjct: 689  ELIFELDVNGTINIDEFN---RLKQMNVTVERSENMTLLVMYFLAKCMIHLPVVATRPLP 745

Query: 704  GGASEVDTDATLXXXX--------------XXXXXXXXXXXYVLLQQATNTFLSVQSSLK 749
               S  DT  T                              YVLLQQATNT L+V  SLK
Sbjct: 746  TNDSN-DTGETSNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTMLNVLESLK 804

Query: 750  SRHLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGS 809
            +  LPL LN+ R KARFALLSARG LEYTKGGALF  NK+LLLDV+K+LE  ++L++PG 
Sbjct: 805  TLFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKLDLPGV 864

Query: 810  LSWHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGRSANVASTKRKKEEDNT 869
            +SW+SL LLDM+++L++QPP+T+ GKLD+LL+ KL+YYN+LMGR         K  +   
Sbjct: 865  ISWNSLKLLDMSINLLLQPPNTEVGKLDRLLKKKLNYYNRLMGRPTVKQEPASKGHDLTP 924

Query: 870  SLSNATKLTPLXXXXXXXXEKRVKLEHTDKVGETPVGVENTGQP---------------- 913
            + S   + TP          KR+K+E T      P   ++   P                
Sbjct: 925  ASSKDEEDTP--------AAKRIKIEETSIPLAVPQQQQHMQAPAPVMVQEKQQPQPQPQ 976

Query: 914  -NGNTQEHYAATWSNQNQPHSTVAEAFHLDPVLNNN-PFSNGDLTAFFSTDNGMPNLSGG 971
                 Q            P +  AEA  LDPVLN+N  F N   T  +   +  P+    
Sbjct: 977  PQPQPQPQLQPQPQQLQLPQTAFAEALQLDPVLNSNVSFQNAPPTTLYDGPHDQPH---- 1032

Query: 972  ASMLNMVGVDQAHSTAGNDAQNTVNANSQQSTLFNDGLFRVPSNGDFLKD---------- 1021
                      Q    A    Q+  + +++ S   + GLF+VPS  DFL D          
Sbjct: 1033 ----------QYQHHAQTQPQDP-HLDTRSSDKLH-GLFKVPSTADFLMDDSANSQLNFL 1080

Query: 1022 ---------------YYRVPG---AXXXXXXXXXXXXXXXXXXXRQAKQQQTNT------ 1057
                           Y   PG   A                       Q  TNT      
Sbjct: 1081 LGTTELGVLDPSQPSYTNNPGSGSAIGINNMPSGLNLSNLFDLEGSTDQPPTNTNATQAT 1140

Query: 1058 --TDPGFGFTVDASLGLAPLLAWSPE 1081
                 GF F VDASLGLAPLLAW+P+
Sbjct: 1141 QANSGGFNFAVDASLGLAPLLAWTPD 1166

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257 bp,
            1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/1156 (37%), Positives = 591/1156 (51%), Gaps = 189/1156 (16%)

Query: 5    ENESFGPRFIRTLGSQSISVINPLXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXX 64
            + +   PR IRTLGSQ++   N                                      
Sbjct: 6    DRQGLEPRIIRTLGSQTLGTTNAPHKALNTEANPNFSENIKEALIKTNSPTPLSTPI--- 62

Query: 65   XXNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXX 124
               YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC++SDKL R+A+P+GY        
Sbjct: 63   ---YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERV 119

Query: 125  XXXXXXXXXXXXXCDLKDEQMHLVYKYSSNKRPEPXXXXXXXXXXXXXXXXXXXXXXXXT 184
                         CD+K++Q++LV    S  RP P                        T
Sbjct: 120  RELEAENKRLLALCDIKEQQINLV----SQSRP-PTSLDNTVSDNFKQDLKDAPLNLSST 174

Query: 185  NLYLLNKT----------------SPAG-----HEVPE-NHKCQGIDCNHTSHPHLHEKP 222
            N+YLLN+T                S  G       +P+ +H C G+ C +    +LH KP
Sbjct: 175  NIYLLNQTVNKQLQNGKIDTNRSDSTMGLLATSPPLPQKDHVCDGVSCTN----NLHAKP 230

Query: 223  VSTTLSDPTTISFEQHEAPGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQL 282
             ST+L+DPT ISFEQ+EAPGLPAVKAL SM  H+ STQLA LV+LS+PRSTEEILFIPQL
Sbjct: 231  TSTSLNDPTAISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQL 290

Query: 283  LARLGQVHGLTSKQCLYTASLLASLKE----PSQAVVPTTDGLTE---------LKCTSL 329
            L R+ Q+ G  SKQCLYT SLL+SLK     P   +  T+  + E          + TSL
Sbjct: 291  LTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPKLLLSSTSTKIKENDDSKFLNTFETTSL 350

Query: 330  WEIDDPMRFFKDSCKFNLG-------------SDNDVXXXXXXXXXXXXXXYFEECHALI 376
             E  D  +F   S KF++              SDND+              +F+     +
Sbjct: 351  AEFGDLKKFLI-SLKFDINSFSNQQPEVQNNKSDNDL--LSLNEIKELLHLFFKFWSNQV 407

Query: 377  PVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSISYKIFACILLVVCQLGIMSK 436
             +LN + F  Y+N F E +   P    K N +  H   + +++IFA  LL++ Q+G++ K
Sbjct: 408  SILNNDHFLLYFNNFVEVIKALPLELKKTNGTKTH--ATTNHQIFALKLLIMLQMGLLIK 465

Query: 437  VKREQLP------AKSKFSRIMAYYNNAILALKLNPYF-SVKTTSVKTXXXXXXXXXXXX 489
            VKRE++         SKF+++M YY+     +  NPYF ++ TTS+ +            
Sbjct: 466  VKREKIKDTVPGNQNSKFAKLMVYYHQVSSIIPKNPYFLNMSTTSLPSLQLLSLTSFYFL 525

Query: 490  NVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGS-TMSKSEQGDRRLLFWGIYYLDV 548
            NVG++ ++Y LRG IVSM+QQLRLHRCPSAVL    +  + + EQ +RRLLFW +YY+DV
Sbjct: 526  NVGDIPAIYGLRGRIVSMSQQLRLHRCPSAVLSVHSNPVLQRFEQSERRLLFWAVYYIDV 585

Query: 549  FSALQLGVPRLLKDHEIECALPISENGHPGVSLADQV-------------IRLEGQVSEF 595
            F++LQLGVPRLLKD +IECALPIS+     V   DQ+             I+L+GQVS F
Sbjct: 586  FASLQLGVPRLLKDFDIECALPISD-----VEFEDQLASENEKTKNKTKKIQLQGQVSSF 640

Query: 596  SLSLLRFSKILGNILDSIFKRGMTSS-IAQQVALIHENALDSWRRGLPKNLTFELDVNGT 654
            SL ++RF+KILGNILDSIFKRGM    +  +VAL+HENALD+WR  LP+   F++ VNGT
Sbjct: 641  SLQIIRFAKILGNILDSIFKRGMMDERVTSEVALVHENALDNWRNQLPEMYYFQITVNGT 700

Query: 655  INMEELNS----GSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAAKPLLGGA---- 706
            +N++++ +     +  K D       +   L++ YFL K ++HLPV+A KPL        
Sbjct: 701  VNLDDIRANNSRNTEAKFDRKDIICFEKNVLLLFYFLAKSMIHLPVIATKPLPKTVDNST 760

Query: 707  ------------SEVDTDATLXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSSLKSRHLP 754
                        S  + D ++               Y++LQQATN  L++  S+ S +LP
Sbjct: 761  KKKHSMFNNDTKSINNQDHSVVDVDMTSPAIRTSSSYIILQQATNATLTLFQSINSVYLP 820

Query: 755  LALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGSLSWHS 814
            L LN+ R   RF+LL ARG LEYTKGGALF  NK LLLD +K++E  + L++PG  SWH+
Sbjct: 821  LPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGVASWHT 880

Query: 815  LILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGRSANVASTKRKKEEDNTSLSNA 874
            L L DM ++L+++ P+ K  +LDK LE KL+YYN+LMG      ++           S+ 
Sbjct: 881  LKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPPTTTTSSEPL------FSSQ 934

Query: 875  TKLTPLXXXXXXXXEKRVKLEHTDKVGETPVGVENTGQPNGNTQEHYAATWSNQN----- 929
            +K TP          KR   E+    G+        G  NGNT     +T   +N     
Sbjct: 935  SKNTPANGSRSSIV-KRENPENEYLYGD--------GINNGNTDMDKPSTEDARNVNKRL 985

Query: 930  QPHSTVAEAFHLDPVLNNN---------------------PFSNGDLTAFF--------- 959
            +   +++++   D +  N                       FSN DLTA F         
Sbjct: 986  KHEKSISQSIDDDNMSRNQNGSKFQQDSKKNMSTSNLFPFSFSNTDLTALFTNPEGLNFA 1045

Query: 960  -------------STDNGMPNLSGGASMLNMVGVDQAHST-AGNDAQNTVNANSQQSTLF 1005
                         STD    N +G  S LNM    QA +T  G D    V+ NS      
Sbjct: 1046 DTNDYDKNDGNKTSTDTADTN-TGNLSFLNMAPFLQAGNTNQGIDDNKVVDKNS------ 1098

Query: 1006 NDGLFRVPSNGDFLKD 1021
               +F +PSN D +KD
Sbjct: 1099 ---IFSLPSNLDLMKD 1111

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 74/175 (42%), Gaps = 40/175 (22%)

Query: 1062 FGFTVDASLGLAPLLAWSPEAAQEPIAETSDHDTRN----------DSGLRRKSGAETAG 1111
            + + VDASLGLAPLL  +P+ +      T+ + ++N          DS     +  E   
Sbjct: 1251 YDYIVDASLGLAPLLVDTPDISNTNTTSTTSNRSKNSIILDPTFNDDSDRSHSNAREVLN 1310

Query: 1112 VLVAGHSQLADSSTDP-ASQQQRRVGSYDHTYAQDQSVEDSA------ITMPT------- 1157
               +  SQ   SS  P  +  QR + S +++ +   S ++S       +  P+       
Sbjct: 1311 PTDSILSQSVISSISPRTTSNQRSLSSGNYSKSNGNSRKNSKNAKGEQLDTPSTLFKMKR 1370

Query: 1158 ------RPHRGPRRRWNSTTGAAAITPNSDRPRNAP--ASETDENLQDLFRWQNS 1204
                    HRGPRR      G       +D P++     S TD NL DLF+WQN+
Sbjct: 1371 TSSSSSTSHRGPRRPPKHRYG-------TDHPKSPSDVGSNTD-NLPDLFQWQNA 1417

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
            CAT8Zinc cluster transcriptional activator necessary for
            derepression of a variety of genes under non-fermentative
            growth conditions, active after diauxic shift, binds
            carbon source responsive elements
          Length = 1433

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/1099 (38%), Positives = 582/1099 (52%), Gaps = 185/1099 (16%)

Query: 68   YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXXXX 127
            YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC++SDKL R+A+P+GY           
Sbjct: 64   YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 123

Query: 128  XXXXXXXXXXCDLKDEQMHLVYKYSSNKRPEPXXXXXXXXXXXXXXXXXXXXXXXXTNLY 187
                      CD+K++Q+ LV    S  RP+                         TN+Y
Sbjct: 124  EAENKRLLALCDIKEQQISLV----SQSRPQ-TSTDNTINGNFKHDLKDAPLNLSSTNIY 178

Query: 188  LLNKT-------------------SPAGHEVPENHK---CQGIDCNHTSHPHLHEKPVST 225
            LLN+T                   SP G   P  HK   C G+ C +    HLH KP ST
Sbjct: 179  LLNQTVNKQLQNGKMDGDNSGSAMSPLGAPPPPPHKDHLCDGVSCTN----HLHVKPTST 234

Query: 226  TLSDPTTISFEQHEAPGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLAR 285
            +L+DPT ISFEQ EAPGLPAVKAL SM  H+ STQLA LV+LS+PRSTEEILFIPQLL R
Sbjct: 235  SLNDPTAISFEQDEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTR 294

Query: 286  LGQVHGLTSKQCLYTASLLASLKEPSQA---VVPTTDG-----------------LTELK 325
            + Q+ G  SKQCLYT SLL+SLK    A   + P+T                   +   +
Sbjct: 295  IRQIFGFNSKQCLYTVSLLSSLKNRLPAPRLLAPSTSTKLKEKDEDKKLDDDSAFVKRFQ 354

Query: 326  CTSLWEIDDPMRFFKDSCKFNLGS----------DNDVXXXXXXXXXXXXXXYFEECHAL 375
             T+L E  D  +F   S KFN+ S          D D               +F+     
Sbjct: 355  STNLSEFVDLKKFLI-SLKFNINSFSKQSEKPANDQDDELLSLTEIKELLHLFFKFWSNQ 413

Query: 376  IPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKS---ISYKIFACILLVVCQLG 432
            +P+LN + F  Y+N F E +          N    + +KS    +++IFA  LL++ Q+G
Sbjct: 414  VPILNNDHFLIYFNNFVEVVK----HLSTENLETNNTTKSTVTTNHEIFALKLLMMLQMG 469

Query: 433  IMSKVKREQLP------AKSKFSRIMAYYNNAILALKLNPYF-SVKTTSVKTXXXXXXXX 485
            ++ K+K E++        K+K++R+MAYY+   L +  NPYF ++ TTS+ +        
Sbjct: 470  LLVKIKMEKIKYTVPKNPKAKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLAS 529

Query: 486  XXXXNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGS-TMSKSEQGDRRLLFWGIY 544
                NVG++S++Y +RG IVSMAQQLRLHRCPSAVL    +  + K EQ +RRLLFW IY
Sbjct: 530  FYYLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIY 589

Query: 545  YLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQV-------------IRLEGQ 591
            Y+DVF++LQLGVPRLLKD +IECALPIS+     V   DQ+             I+L+GQ
Sbjct: 590  YVDVFASLQLGVPRLLKDFDIECALPISD-----VEYKDQLSMENEKADKKAKKIQLQGQ 644

Query: 592  VSEFSLSLLRFSKILGNILDSIFKRGMTSS-IAQQVALIHENALDSWRRGLPKNLTFELD 650
            VS FSL ++RF+KILGNILDSIFKRGM    I  +VAL+HENALD+WR  LP+   F++ 
Sbjct: 645  VSSFSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWRNQLPEMYYFQIT 704

Query: 651  VNGTINMEELNS----GSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAAKPL---L 703
            VNGT+N++E+ +     +  K D       + + L++ YFL K ++HLPV+A KPL   +
Sbjct: 705  VNGTVNLDEIRATNQRNTETKFDKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPKNV 764

Query: 704  GGASE-------------VDTDATLXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSSLKS 750
              A++              + D  +               Y++LQQATN  L++  ++ S
Sbjct: 765  DNATKKKQSMFNNDSKGATNQDHMILDVDMTSPAIRTSSSYIILQQATNATLTIFQAINS 824

Query: 751  RHLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGSL 810
             +LPL LN+ R   RF+LL ARG LEYTKGGALF  NK LLLD +K++E  + L++PG  
Sbjct: 825  MYLPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGIA 884

Query: 811  SWHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGRSANVASTKRK--KEEDN 868
            SWH+L L DM+++L+++ P+ K  +LDK LE KL+YYN+LMG      ++ +     +  
Sbjct: 885  SWHTLKLFDMSINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPPATTTSLKPLFGSQSK 944

Query: 869  TSLSNATKLTPLXXXXXXXXEKRVKLEH------------TDKVGETPVGVENTGQPNGN 916
             SL N  + TP          KR   EH              + G +P+    T   NGN
Sbjct: 945  NSLENRQR-TP--------NVKRENPEHEYLYGNDSNNNNNSEAGHSPM----TNTTNGN 991

Query: 917  TQEHY------------------AATWSNQNQPHSTVAEAFHLDPVLNNNPFSNGDLTAF 958
             +  Y                  A  + N  + + + +  F          FSN DLTA 
Sbjct: 992  KRLKYEKDAKRNAKDGGISKGENAHNFQNDTKKNMSTSNLFPFS-------FSNTDLTAL 1044

Query: 959  FSTDNGMPNLS----GGASMLNMVGVDQAHSTAGNDA-------QNTVNANSQQSTLFN- 1006
            F+   G PN +    G   + N    D   +   N +         T N+N  Q+T+ N 
Sbjct: 1045 FTHPEG-PNCTNTNNGNVDVCNRASTDATDANIENLSFLNMAPFLQTGNSNIGQNTIENK 1103

Query: 1007 ----DGLFRVPSNGDFLKD 1021
                D +F +PSN D +KD
Sbjct: 1104 PMHMDAIFSLPSNLDLMKD 1122

 Score = 40.4 bits (93), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 75/177 (42%), Gaps = 44/177 (24%)

Query: 1062 FGFTVDASLGLAPLLAWSPE-------------AAQEPIAETSDHDTRNDSGLR-RKSGA 1107
            + + VDASLGLAPLL  +P+             +    I +T+ +D  + S +  R+   
Sbjct: 1266 YDYIVDASLGLAPLLVDTPDISNTNTTSTTSNRSKNSIILDTTFNDDLDRSRMNAREVLN 1325

Query: 1108 ETAGVLVAGHSQLADSSTDPASQQQRRVGSYDHTYAQDQSVEDSAITM------------ 1155
             T  +L  G   +  S +   +  QR + S + +     S E+S                
Sbjct: 1326 PTDSILSQG---MVSSVSTRNTSNQRSLSSGNDSKGDSSSQENSKSATGNQLDTPSTLFQ 1382

Query: 1156 -------PTRPHRGPRRRWNSTTGAAAITPNSDRPRNAPASETD-ENLQDLFRWQNS 1204
                   P+  HRGPRR   +         N+DR +++    ++ +N+ DLF+WQN+
Sbjct: 1383 MRRTSSGPSASHRGPRRPQKNRY-------NTDRSKSSGGGSSNTDNVSDLFQWQNA 1432

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/919 (41%), Positives = 524/919 (57%), Gaps = 109/919 (11%)

Query: 67  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXXX 126
           N R+AQACDRCRSKKTRCDGKRPQCSQCA VGFECK+SDKL R++FPRGY          
Sbjct: 74  NLRIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFPRGYTETLEEKVR- 132

Query: 127 XXXXXXXXXXXCDLKDEQMHLVYKYSSNKRPEPXXXXXXXXXXXXXXXXXXXXXXXXTNL 186
                       +L++E   L+     NK                               
Sbjct: 133 ------------ELENENRRLLAICQFNKLQSQKNDTIDNSTTQEEVYSIRS-------- 172

Query: 187 YLLNKTSPAGHEVPEN-HKCQGIDCNHTSHPHLHEKPVSTTLSDPTTISFEQHEAPGLPA 245
              N  S    E   N   C   +CN+ +H HLH KPVST       ISFEQ+EAPGL A
Sbjct: 173 ---NSASSTAIETDSNITTCLDTNCNNDTHNHLHMKPVSTK-PPQNIISFEQNEAPGLSA 228

Query: 246 VKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYTASLLA 305
           VKAL SMANHE STQLA LVAL++PRST+EILFIPQLL+++ Q  G TSK CLYT SLL+
Sbjct: 229 VKALKSMANHEQSTQLATLVALAIPRSTDEILFIPQLLSKIRQNFGFTSKHCLYTVSLLS 288

Query: 306 SLKE---PSQAVVP----TTDGLTELKCTSLWEIDDPMRFFKDSCKFN-LGSDNDVXXXX 357
           SLK    P + +      T   L +LK T+LW+ DD  +F     K + L   N      
Sbjct: 289 SLKPNLPPPKMIANNLEMTKKLLNQLKITNLWKFDDLSQFINQYLKLDPLNQKNSNDLLN 348

Query: 358 XXXXXXXXXXYFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSI- 416
                     +F++ + +IP++N+ EF   YN FK  L          NS     S ++ 
Sbjct: 349 QIEMDELINFFFQDWNDIIPIINKEEFLSNYNAFKLDL---------KNSERDKLSSNLK 399

Query: 417 -SYKIFACILLVVCQLGIMSKVKREQLPAKSK----FSRIMAYYNNAILALKLNPYFSVK 471
            +YKIF CIL+++CQ+G+++K+K      KS        IMAYY+  I  L +N +F + 
Sbjct: 400 MNYKIFGCILVLMCQMGLLTKIKATN--GKSSPNIHLKSIMAYYHQLIANLPINNFFQIA 457

Query: 472 TTSVKTXXXXXXXXXXXXNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKS 531
           T S+              NVG++S++YELRG I+SM+QQLRLHRCPSAVL     TM+K 
Sbjct: 458 TISIPQLKLYVLILFYNLNVGDISAIYELRGRIISMSQQLRLHRCPSAVLSGSSLTMNKL 517

Query: 532 EQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQV-IRLEG 590
           +Q +RR+LFW IY LD  S+LQLGVPRLLKD+EIECALPI+          D+  I+LEG
Sbjct: 518 DQSNRRILFWTIYSLDALSSLQLGVPRLLKDYEIECALPITMEDKE----RDKTKIKLEG 573

Query: 591 QVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFELD 650
            VS FSL++ RFSKILGNILD IFKR MT S+ + V+LIHENALD WR  LP++LTF+L+
Sbjct: 574 TVSPFSLAIFRFSKILGNILDMIFKRNMTESMTKSVSLIHENALDQWRYDLPEDLTFKLN 633

Query: 651 VNGTINMEELNSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAAKPLLGGASEVD 710
           + G+I++  ++ G       ++ P   N  LM  YF    ++HLPV+AA+PL    +  D
Sbjct: 634 IQGSIDLNVMHQG-------NSTPGKKNLILMFFYFFAVSMIHLPVVAARPLDVKNAMPD 686

Query: 711 TDATLXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSSL----KSRHLPLALNLPRIKARF 766
             ++                Y+ LQ A NT L+V   L    K+ +LP+ +N+ R++ R 
Sbjct: 687 RSSS---------------SYIALQHAINTMLNVLELLNNQPKNYYLPVPINMSRLQIRS 731

Query: 767 ALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGSLSWHSLILLDMAVSLIM 826
           AL+S+RG+L+Y KGGALF  NK LLL V+K LE  + L++PG +SWHSL L D+ ++L +
Sbjct: 732 ALISSRGMLDYIKGGALFLDNKTLLLQVIKNLERDRTLDLPGVVSWHSLKLFDLTITLFI 791

Query: 827 QPPHTKAGKLDKLLEAKLSYYNKLMGR----SANVASTKRKKEEDNTSLSNATKLTPLXX 882
           Q  + K  KLDK+LE K +YYNKLMG+    + N   + +K++++   +S  +  +P   
Sbjct: 792 QNSNIKLEKLDKILEKKSNYYNKLMGKPTSNNTNNNISSKKRKQETIEISTPSPTSP--- 848

Query: 883 XXXXXXEKRVKLEHTDKVGETPVGVENTGQPNGNTQEHYAATWSNQNQPHSTVAEAFHLD 942
                      L+   K  ++P+ +++T  P+   Q +            + +A+A   D
Sbjct: 849 ----------PLKKMSKKSKSPI-LQSTILPSQTLQNYNNNI-------QNQLADALQFD 890

Query: 943 PVLNNNP--FSNGDLTAFF 959
           P+LN+N   FSN DL+ +F
Sbjct: 891 PILNSNSYNFSNFDLSNYF 909

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 60/165 (36%), Gaps = 49/165 (29%)

Query: 1049 QAKQQQTNTTD------PGFGFTVDASLGLAPLLAWSPEAAQEPIAETSDHDTRNDSGLR 1102
            Q + Q  NT D        +G+ VDASLGLAPLL            E +++D  N     
Sbjct: 1039 QEQNQPRNTNDDVGMTNSNYGYFVDASLGLAPLL------------ELANNDNNN----- 1081

Query: 1103 RKSGAETAGVLVAGHSQLADSSTDPASQQQRRVGSYDHT---YAQDQSVEDSAITMPTRP 1159
                     +L      ++ SS  P S  +       H    + Q  +  +    + T P
Sbjct: 1082 --------FILDDESKTISHSSKTPESILKDEDPVIHHNNLLFNQLNTSNEKPRHLQTEP 1133

Query: 1160 HRGPRRRWNSTTGAAAITPNSDRPRNAPASETDENLQDLFRWQNS 1204
            +  P+ + N  T               P +   EN+ +LF W N+
Sbjct: 1134 NYPPKGKLNQKT---------------PFARKKENIDELFNWHNT 1163

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] {ON}
            YMR280C (REAL)
          Length = 1432

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1098 (38%), Positives = 575/1098 (52%), Gaps = 183/1098 (16%)

Query: 68   YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXXXX 127
            YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC++SDKL R+A+P+GY           
Sbjct: 63   YRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVREL 122

Query: 128  XXXXXXXXXXCDLKDEQMHLVYKYSSNKRPEPXXXXXXXXXXXXXXXXXXXXXXXXTNLY 187
                      CD+K++Q+ LV    S  RP                          TN+Y
Sbjct: 123  EAENKRLLALCDIKEQQISLV----SQSRPS-TSLDSNVDGNCKKELKDAPLNLSSTNIY 177

Query: 188  LLNKT----------------------SPAGHEVPENHKCQGIDCNHTSHPHLHEKPVST 225
            LLN+T                      + +    P++H C G+ C +     LH KP ST
Sbjct: 178  LLNQTVNKQLQSGKMDNDNSDAAIDSLAASPSPPPKDHVCDGVSCTN----RLHVKPTST 233

Query: 226  TLSDPTTISFEQHEAPGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLAR 285
            +LSDPT ISFEQ+EAPGLPAVKAL SM  H+ STQLA LV+LS+PRSTEEILFIPQLL R
Sbjct: 234  SLSDPTAISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTR 293

Query: 286  LGQVHGLTSKQCLYTASLLASL------------------KEPSQAVVPTTDG--LTELK 325
            + Q+ G  SKQCLYT SLL+SL                  KE ++   P  D   L   +
Sbjct: 294  IRQIFGFNSKQCLYTVSLLSSLKNRLPAPSILLPSTSTNSKEKNEDKTPNDDSAFLKTFQ 353

Query: 326  CTSLWEIDDPMRFFKDSCKFNL------------GSDNDVXXXXXXXXXXXXXXYFEECH 373
             TSL E  D  +F   S KF++            G D+D+              +F+   
Sbjct: 354  STSLSEFVDLKKFLI-SLKFDIDSFSKQPEKQANGHDSDL--LSLTEIKELLHLFFKFWS 410

Query: 374  ALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSISYKIFACILLVVCQLGI 433
              +P+LN + F  Y+N F E +        KANS+    + + +++IF   LL++ Q+G+
Sbjct: 411  NQVPILNNDHFLLYFNNFVEIIKDFSLISTKANST-TKNNVTTNHEIFTLKLLMMLQMGL 469

Query: 434  MSKVKREQ----LPAKS--KFSRIMAYYNNAILALKLNPYF-SVKTTSVKTXXXXXXXXX 486
            + K+K+++    +P  S  K+ R+M+YY+   L +  NPYF ++ TTS+ +         
Sbjct: 470  LIKIKKDKIKDTVPRNSNAKYIRLMSYYHQISLIIPKNPYFLNMSTTSLPSLQLLSLASF 529

Query: 487  XXXNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGS-TMSKSEQGDRRLLFWGIYY 545
               NVG++S++Y +RG IVSMAQQLRLHRCPSAVL    +  + K EQ +RRLLFW IYY
Sbjct: 530  YYLNVGDISAIYGIRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYY 589

Query: 546  LDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQV-------------IRLEGQV 592
            +DVF++LQLGVPRLLKD +IECALPIS+     V   DQ+             I+L+GQV
Sbjct: 590  VDVFASLQLGVPRLLKDFDIECALPISD-----VEYKDQLSMENEKMKNKAKKIQLQGQV 644

Query: 593  SEFSLSLLRFSKILGNILDSIFKRGMTSS-IAQQVALIHENALDSWRRGLPKNLTFELDV 651
            S FSL ++RF+KILGNILDSIFKRGM    I+ +VAL+HENALD+WR  LP+   F++ V
Sbjct: 645  SSFSLQIIRFAKILGNILDSIFKRGMMDERISSEVALVHENALDNWRNQLPEMYYFKITV 704

Query: 652  NGTINMEEL--NSGSHWKKDYSTAPSC--DNRTLMVLYFLVKCLVHLPVLAAKPLLGGAS 707
            NGT+N++E+  N+    +  + T      + + L++ YFL K ++HLPV+A KPL     
Sbjct: 705  NGTVNLDEIRANNSRDIETPFETKDIILFEKKILLLFYFLAKSMIHLPVIATKPLSKNVD 764

Query: 708  EV----------------DTDATLXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSSLKSR 751
             V                + D                  Y++LQQATN  L++  S+   
Sbjct: 765  NVMKKKQSMFNNDSKGTNNHDHMAVDVDMTSPAIRTSSSYIILQQATNATLTIFQSINWM 824

Query: 752  HLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGSLS 811
            +LPL LN+ R   RF+LL ARG LEYTKGGALF  NK LLLD +K++E  + LE+PG  S
Sbjct: 825  YLPLPLNVSRTLVRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLELPGIAS 884

Query: 812  WHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMG---------------RSAN 856
            WH+L L DM ++L+++ P+ K  +LDK LE KL+YYN+LMG               +S N
Sbjct: 885  WHTLKLFDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMGLPLATTTSLKPLFGFQSKN 944

Query: 857  VASTKRKKEEDNTSLSNATKLTPLXXXXXXXXEKRVKLEHTDKVGETPVGVEN------- 909
               TK +K       S   + TP                 TD+     VG  N       
Sbjct: 945  SPETKPRK-------STVKRETPDNDYLYGNDTNNNNNPETDQPRTANVGNTNKRLKYAK 997

Query: 910  ----TGQPNGNTQEHYAATWSNQNQPHSTVAEAFHLDPVLNNNPFSNGDLTAFF------ 959
                +   +G  +   A+ + + N+   + +  F          FSN DLTA F      
Sbjct: 998  DTRQSVDKDGIAKAQDASNFHHDNKKTMSASNLFPFS-------FSNTDLTALFAHPEEP 1050

Query: 960  ----------------STDNGMPNLSGGASMLNMVGVDQAHSTAGNDAQNTVNANSQQST 1003
                            STD    N+ G  S LNM    QA +   N  QN V       T
Sbjct: 1051 NCADSNSNNLNDCNKSSTDAADANI-GNLSFLNMAPFLQADNVTTN--QNAV----CDKT 1103

Query: 1004 LFNDGLFRVPSNGDFLKD 1021
            +  D +F +PSN D +K+
Sbjct: 1104 IHKDAIFSLPSNLDLMKN 1121

 Score = 34.3 bits (77), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 76/179 (42%), Gaps = 48/179 (26%)

Query: 1062 FGFTVDASLGLAPLLAWSPEAAQEPIAETSDHDTR---------NDSGLRRKSGAE---- 1108
            + + VDASLGLAPLL  +P+ +      T+ + ++         ND   R  + A     
Sbjct: 1265 YDYIVDASLGLAPLLVDTPDISNTNTTSTTSNRSKNSIILDSTFNDDLDRSHTNAREVLN 1324

Query: 1109 ------TAGVLVAGHSQLADSSTDPASQQQRRVGSYDHTYAQDQSVE--DSAITM----- 1155
                  + G++ +  ++ AD     +S    +   Y     ++ +    D+  T+     
Sbjct: 1325 HADSILSQGIMSSISTRTADIQRSSSSGNDSKSNGYSQKNPKNANNGQLDAPSTLFQMRR 1384

Query: 1156 ----PTRPHRGPRR----RWNS--TTGAAAITPNSDRPRNAPASETDENLQDLFRWQNS 1204
                P+  HRGPRR    R+++  + G +  + N+D            NL DLF+WQN+
Sbjct: 1385 TSSGPSTSHRGPRRPQKHRYSTDQSKGFSGGSSNAD------------NLPDLFQWQNA 1431

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa]
           {ON} YMR280C (REAL)
          Length = 1433

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/945 (41%), Positives = 519/945 (54%), Gaps = 122/945 (12%)

Query: 5   ENESFGPRFIRTLGSQSISVINPLXXXXXXXXXXXXXXKXXXXXXXXXXXXXXXXXXXXX 64
           + +   PR IRTLGSQ++S  N                                      
Sbjct: 7   DRQGLEPRVIRTLGSQALSGPN------ISNRTLSSEANSHSSENTKDAMIKTTSPTPLS 60

Query: 65  XXNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXX 124
              YR+AQACDRCRSKKTRCDGKRPQCSQCAAVGFEC++SDKL R+A+P+GY        
Sbjct: 61  TPIYRIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERV 120

Query: 125 XXXXXXXXXXXXXCDLKDEQMHLVYKYSSNKRPEPXXXXXXXXXXXXXXXXXXXXXXXXT 184
                        CD+K++Q+ LV    S  RP P                        T
Sbjct: 121 RELEAENKRLLALCDIKEQQISLV----SQSRP-PTSMDNTANGSFKQELKDAPLNLSST 175

Query: 185 NLYLLNKT--------------------SPAGHEVP--ENHKCQGIDCNHTSHPHLHEKP 222
           N+YLLN+T                    S A   +P  ++H C GI C +    HLH KP
Sbjct: 176 NIYLLNQTVNKQLQNGKMDSDNSNTVMNSLAAAPLPPQKDHVCDGISCTN----HLHVKP 231

Query: 223 VSTTLSDPTTISFEQHEAPGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQL 282
            ST+L+DPT ISFEQ EAPGLPAVKAL  M  H+ STQLA LV+LS+PRSTEEILFIPQL
Sbjct: 232 TSTSLNDPTAISFEQDEAPGLPAVKALKLMTTHQRSTQLATLVSLSIPRSTEEILFIPQL 291

Query: 283 LARLGQVHGLTSKQCLYTASLLASLKE--PSQAVVPTTDGLTELKCTSLWEI-DDPMRFF 339
           L R+ Q+ G  SKQCLYT SLL+SLK   P+  ++P +   T+LK     +I DD   FF
Sbjct: 292 LTRIRQIFGFNSKQCLYTVSLLSSLKNRLPAPRLLPPSTS-TKLKEKGEDKILDDDSAFF 350

Query: 340 KD-----------------SCKF----------NLGSDNDVXXXXXXXXXXXXXXYFEEC 372
           K                  S KF          NL +D+D               +F+  
Sbjct: 351 KKFQTTNLSEFVDLKGFLVSLKFDIDSFSKQSENLPNDHDNELLSLTEIKELLHLFFKFW 410

Query: 373 HALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSI---SYKIFACILLVVC 429
              +P+LN + F  Y+N F E +         AN      + SI   ++++FA  L ++ 
Sbjct: 411 SNQVPILNNDHFLLYFNNFVEVVKD----LSSANLKTNVTNTSIVTTNHELFALKLSMML 466

Query: 430 QLGIMSKVKREQLP------AKSKFSRIMAYYNNAILALKLNPYF-SVKTTSVKTXXXXX 482
            +G++ K+K E++         SK++R+MAYY+   L +  NPYF ++ TTS+ +     
Sbjct: 467 LMGLLVKIKMEKIKYTVPKNPNSKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLS 526

Query: 483 XXXXXXXNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGS-TMSKSEQGDRRLLFW 541
                  NVG++S++Y +RG IVSMAQQLRLHRCPSAVL    +  + K EQ +RRLLFW
Sbjct: 527 LASFYYLNVGDISAIYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFW 586

Query: 542 GIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQV-------------IRL 588
            IYY+DVF++LQLGVPRLLKD +IECALPIS+     V   DQ+             I+L
Sbjct: 587 AIYYVDVFASLQLGVPRLLKDFDIECALPISD-----VEYKDQLFMENKKTNKKAKKIQL 641

Query: 589 EGQVSEFSLSLLRFSKILGNILDSIFKRGMTSS-IAQQVALIHENALDSWRRGLPKNLTF 647
           +GQVS FSL ++RF+KILGNILDSIFKRGM    I  +VAL+HENALD+WR  LPK   F
Sbjct: 642 QGQVSSFSLQIIRFAKILGNILDSIFKRGMMDERITSEVALVHENALDNWRSQLPKMYYF 701

Query: 648 ELDVNGTINMEEL--NSGSHWKKDYSTAPSC--DNRTLMVLYFLVKCLVHLPVLAAKPLL 703
           ++ VNGT+N++E+  N   + +  +        + + L++ YFL K ++HLPV+A KPL 
Sbjct: 702 QITVNGTVNLDEIRVNDSKNIETRFEKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLP 761

Query: 704 GGASE----------------VDTDATLXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSS 747
                                 D D  +               Y++LQQATN  L +  +
Sbjct: 762 KNIDNGTKKKQSVFSNDSKGSNDQDHMIVDVDMTSPAIRTSSSYIILQQATNATLMIFQT 821

Query: 748 LKSRHLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIP 807
           +   ++PL LN+ R   RF+LL ARG LEYTKGGALF  NK LLLD +K++E  + L++P
Sbjct: 822 INWMYIPLPLNVSRTLIRFSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLP 881

Query: 808 GSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMG 852
           G+ SWH+L L DM ++L+++ P+ K  +LDK LE KL+YYN+LMG
Sbjct: 882 GTASWHTLKLYDMTINLLLKAPNVKVERLDKFLEKKLNYYNRLMG 926

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 47/177 (26%), Positives = 80/177 (45%), Gaps = 44/177 (24%)

Query: 1062 FGFTVDASLGLAPLLAWSPEAAQEPIAETSDHDTRN----------DSGLRRKSGAE--- 1108
            + + VDASLGLAPLL  +P+ +      T+ + ++N          D    R++  E   
Sbjct: 1266 YDYIVDASLGLAPLLVDTPDISNTNTTSTTSNRSKNSIILDPTFNDDMDQSRRNAKEVLN 1325

Query: 1109 -TAGVLVAGHSQLADSSTDPASQQQRRVGS-----YDHTYAQD-QSVEDSAITMPTR--- 1158
             T  +L  G   +  S +  A+  Q+ + S      D +Y ++ QS +   + MP+    
Sbjct: 1326 PTDSILSQG---ILSSMSTRATSNQKSLSSGNNPKGDGSYLENPQSTKSDKLDMPSTLFQ 1382

Query: 1159 ----------PHRGPRRRWNSTTGAAAITPNSDRPRNAPASETD-ENLQDLFRWQNS 1204
                       HRGPRR   S         N+DR +++    ++ +N+ DLF+WQN+
Sbjct: 1383 MRRTSSGPSASHRGPRRPQKSRY-------NTDRSKSSSDGSSNTDNVPDLFQWQNA 1432

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
            YMR280C
          Length = 1237

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/923 (41%), Positives = 519/923 (56%), Gaps = 114/923 (12%)

Query: 69   RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXXXXX 128
            R +QACDRCR KK +CD KRPQCS CA+VGFECK+SDKL+R +FPRGY            
Sbjct: 171  RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTESLEERIRELE 230

Query: 129  XXXXXXXXXCDLKDEQMHLVYKYSSNKRPEPXXXXXXXXXXXXXXXXXXXXXXXXTNLYL 188
                      DLK++Q+         K PE                          N+Y 
Sbjct: 231  SENRRLLAMNDLKEQQLF--------KIPE-------DIQSVVDVDAELNSSNQTKNMY- 274

Query: 189  LNKTSPAGHEVPENHKCQGIDCNHTSHPHLHEKPVSTT--LSDPTTISFEQHEAPGLPAV 246
                          H C GI C  T    LH +PV+T   L+DPT++SFEQ+EAPGL A 
Sbjct: 275  ------------ATHVCDGICCQDTK---LHSRPVATNFNLNDPTSVSFEQNEAPGLMAA 319

Query: 247  KALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYTASLLAS 306
            +A+  ++NHE STQLA LV+LS+PRSTEEILFIPQLLA++ QV G TSKQCLYT SLL+S
Sbjct: 320  RAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGFTSKQCLYTVSLLSS 379

Query: 307  LKEP---------SQAVVPTTDGLTELKCTSLWEIDDPMRFFKDSCKFNLGSDNDVXXXX 357
            LK+          S+ ++  +     L   +LW +++   FF++  K N+  D+D     
Sbjct: 380  LKDDLPPPNLLKNSKMILQNSSNFDILTSVNLWHLENLSNFFQNVLKLNILPDDDDHLKK 439

Query: 358  X------XXXXXXXXXYFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAH 411
                            YF+     IP+ NE EF   Y  FK  L         + +  + 
Sbjct: 440  NDDHLALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFKADL------MKLSKNGPSS 493

Query: 412  RSKSISYKIFACILLVVCQLGIMSKVKREQLPAKS-KFSRIMAYYNNAILALKLNPYFSV 470
                ++ KIF C+L V+CQ+GI+  +K +    KS KF ++++YY++ +  L  N YF V
Sbjct: 494  LENILNIKIFGCLLTVICQMGIL--IKYKNFKNKSPKFEKLLSYYHHLMYVLPKNSYFGV 551

Query: 471  KTTSVKTXXXXXXXXXXXXNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSK 530
             TTS+KT            N G++  +Y+LRG I+SMAQQLRLHRCPSAVL   GS M +
Sbjct: 552  ITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDR 611

Query: 531  SEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEG 590
             EQG+RR LFW IYYLDVF +LQLGVPRL+KDHEIECALP+S   H    +    ++LEG
Sbjct: 612  LEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDG--VQLEG 669

Query: 591  QVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFELD 650
             +SEFSLS++R +K+LGNILDSIFKR M+ SI +QV  IHENALDSWR  LPK   F+L+
Sbjct: 670  TMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKKYQFKLN 729

Query: 651  VNGTINMEELNSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAAKPLLGGASEVD 710
             NG +++E LN               +N  L++L+FLVK ++++P+ +A   L    +V 
Sbjct: 730  ANGMVDLEHLNH--------------ENLILVLLFFLVKSMIYMPLSSAITELANNPKVK 775

Query: 711  TDATLXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSSLKSRHLPLALNLPRIKARFALLS 770
             D  +               +  LQQ+ N  LSV  ++ +++LPL LN  R   RFAL+S
Sbjct: 776  NDYYM----------NHKVSHTSLQQSINALLSVFKNINNQYLPLPLNSSRTMTRFALVS 825

Query: 771  ARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGSLSWHSLILLDMAVSLIMQPPH 830
            A+G LEY KGG LF+ NK LLL V++E+E  ++LE+PG + WHSL LLD+AV+L +  P 
Sbjct: 826  AKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLFLLGPT 885

Query: 831  TKAGKLDKLLEAKLSYYNKLMGRS--ANVASTKRKKEEDNTSLSNATKLTPLXXXXXXXX 888
              + KL+K L+ K++YYNK+MG+    ++ S+K K+++    L  A K            
Sbjct: 886  INSDKLEKFLQKKINYYNKIMGKPLITSLPSSKTKRKQSKEDLFTANK----------KR 935

Query: 889  EKRVKLE-HTDKVGETPVGVE---NTGQPNGNTQEHYAATWSNQNQPHSTVAEAFHLDPV 944
            +++VK E  T +V   P  V+     GQ  GNT E             S   EA  LDP+
Sbjct: 936  KQQVKTELSTLEVKREPQQVQLLKREGQ--GNTTE----------STQSAFVEALQLDPI 983

Query: 945  LNNN--PFSNGDLTAFF-STDNG 964
            LN N   FS  DL+ FF S  NG
Sbjct: 984  LNANIYNFSGTDLSNFFISNQNG 1006

 Score = 38.9 bits (89), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 1050 AKQQQTNTTDP----GFGFTVDASLGLAPLLAWSPEAAQEPIAETSDH 1093
             KQ   NT +P     FG  VDASLGLAPLL  +PE   +P    SD 
Sbjct: 1110 GKQFTLNTGEPHSTYDFGMIVDASLGLAPLLNEAPEIPGQPEFFNSDE 1157

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {ON}
           Anc_8.845 YMR280C
          Length = 1246

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/778 (44%), Positives = 463/778 (59%), Gaps = 67/778 (8%)

Query: 203 HKCQGIDCNHTSHPHLHEKPVSTTLSDPTTISFEQHEAPGLPAVKALSSMANHEYSTQLA 262
           H C GI C    HP    +PV+T  +DPT+ISFEQ EAPGL A KAL S+ N E +TQLA
Sbjct: 243 HVCDGICCTDKLHP----QPVATNYNDPTSISFEQSEAPGLVAAKALKSINNQEEATQLA 298

Query: 263 CLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYTASLLASLKEPSQAVVPTTDGLT 322
            LV+LSVPRSTEEILFIPQLLA++ QVHG TSKQCLYT S        +    P +D L 
Sbjct: 299 ILVSLSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTVS--LLSSLKNSLPSPKSDFLM 356

Query: 323 E-------LKCTSLWEIDDPMRFFKDSCKFNLGSDNDVXXXXX-XXXXXXXXXYFEECHA 374
           +       LK T++W+I+D   FF D  KFN+ +D+                 YF     
Sbjct: 357 DNSQNSLLLKNTNIWQINDLNVFFTDLLKFNISNDSKTSTLLSFDDIDDLTNLYFNHWSN 416

Query: 375 LIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSISYKIFACILLVVCQLGIM 434
           LIPVLNE EF+  YN FK    +    F + N S   R     YK F C L+V+CQ+G++
Sbjct: 417 LIPVLNEEEFFNRYNNFK----IQCQSFIQGNQSNNLRD----YKFFGCFLMVMCQMGLL 468

Query: 435 SKVKREQLPAKSKFSRIMAYYNNAILALKLNPYFSVKTTSVKTXXXXXXXXXXXXNVGEV 494
            K+K  +  + +   +I+ YY+     L  NP +   TTS+K+            N+G +
Sbjct: 469 IKLKEHK--SNNSLFKILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNI 526

Query: 495 SSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQL 554
             +YELRG I+SMA QLRLHRCPSAVL   GSTM K EQ +RRLLFW IYYLDVFS+LQL
Sbjct: 527 EQIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQL 586

Query: 555 GVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLLRFSKILGNILDSIF 614
           GVPRLLKD+EIECALP+ +N     ++    I+LEG VS+ SL+L RF+K+LGNI+DSIF
Sbjct: 587 GVPRLLKDYEIECALPV-DNTTTMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIF 645

Query: 615 KRGMTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNGTINMEELNSGSHWKKDYSTAP 674
           KR M++SI++QVALIHENALD+WR  LP+   F+LDVNGTIN+ +L++            
Sbjct: 646 KRNMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLDT-----------E 694

Query: 675 SCDNRTLMVLYFLVKCLVHLPVLAAK-PLLGGASEVDTDATLXXXXXXXXXXXXXXXYVL 733
           + D   L+V YFL KC++HLPV + K  L    +E   D                  YV 
Sbjct: 695 NSDTIFLIVFYFLAKCMIHLPVCSTKVDLEDKVTETGNDVIY--------NDRFSTSYVS 746

Query: 734 LQQATNTFLSVQSSLKSRHLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLD 793
           LQQ+TNT L+    ++ ++LP+  N+ R   RF L+SA+G L+Y KGG+LF  NK LLLD
Sbjct: 747 LQQSTNTMLNALRMIRDKYLPMPFNVSRTLTRFTLISAKGSLDYIKGGSLFIDNKKLLLD 806

Query: 794 VVKELETTKRLEIPGSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGR 853
            V+++E  ++L++PG +SWHSL LLD+ ++L +Q  +TK  K++KLL+ KL+YYNKLMG+
Sbjct: 807 CVQDIEANRKLDLPGIISWHSLKLLDLTLNLFLQNSNTKPEKIEKLLQKKLNYYNKLMGK 866

Query: 854 --SANVASTKRKKEEDNTSLSNATKLTPLXXXXXXXXEKRVKLEHTDKVGET-PVGVENT 910
               N+   KR  +    +    ++             K+VK E  + +    P+ ++N 
Sbjct: 867 PLVKNLPIQKRTNQNKGNNNDEPSR-------------KKVKKELENDINSLHPILIDNE 913

Query: 911 GQPNGNTQEHYAATWSNQNQPHSTV----AEAFHLDPVLNNN--PFSNGDLTAFFSTD 962
           G    +       T SN N P  T     AEA  +DP+LN++   FSN DL   F++D
Sbjct: 914 GVTPSDAAPLINKTNSNTNNPVVTTQNEFAEALQVDPILNSDYYQFSNLDLATLFNSD 971

 Score =  129 bits (325), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 57/89 (64%), Positives = 64/89 (71%)

Query: 67  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXXX 126
           NYRV QACDRCRSKKTRCDG++PQCSQCAAVGFECKVSDKL R+A+PRGY          
Sbjct: 25  NYRVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIEERVRE 84

Query: 127 XXXXXXXXXXXCDLKDEQMHLVYKYSSNK 155
                      CDLK++Q+ LV KYSSNK
Sbjct: 85  LEAENRRLLALCDLKEQQISLVAKYSSNK 113

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 66/172 (38%), Gaps = 52/172 (30%)

Query: 1051 KQQQTNTTDPG-----------FGFTVDASLGLAPLLAWSPEAAQEPIAETSDHDTRNDS 1099
            KQ  TN  + G           F + +D SLGLAPLLA        P   T +++  N S
Sbjct: 1108 KQDLTNKNESGNMLSTENYLSDFSYIIDGSLGLAPLLA-------NPFKPTGENNLVNVS 1160

Query: 1100 GLRRKSGAETAGVLVAGHSQLADSSTDPASQQQRRVGSYDHTYAQDQSVEDSAITMPTRP 1159
             +          VL    SQ +D++ D                  D ++E+ A+      
Sbjct: 1161 SIETTGQCINPKVL---SSQSSDANKDDT----------------DLNLENGAV------ 1195

Query: 1160 HRGPRRRWNSTTGAAAITPNSD-------RPRNAPASETDENLQDLFRWQNS 1204
             R P RR+N   G      NS+       RP +    E  E L DLF WQNS
Sbjct: 1196 QRRP-RRYNGNFGLGGTGMNSNFSVSDLLRPDDQKKREK-ETLNDLFNWQNS 1245

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
            similar to Ashbya gossypii ABL121C
          Length = 1577

 Score =  563 bits (1452), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 265/491 (53%), Positives = 364/491 (74%), Gaps = 7/491 (1%)

Query: 368  YFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSISYKIFACILLV 427
            +F+E ++LIP+ +++EF  Y+ KFKE+++  P FF   ++ FA R KSISYKIFAC+L+ 
Sbjct: 606  FFDEWYSLIPIFDKSEFDNYWQKFKENVST-PEFFTSGDTIFAKRHKSISYKIFACLLVT 664

Query: 428  VCQLGIMSKVKREQLPAKSKFSRIMAYYNNAILALKLNPYFSVKTTSVKTXXXXXXXXXX 487
            V Q+G+M+KVKRE L  + K + +M YY+ A+  +  NPYF   +TS+++          
Sbjct: 665  VVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSIQSLQLLSLLLFY 724

Query: 488  XXNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLD 547
              NVG++S++YELRG +VS AQQLRLHRCPSAVLG +G T+S+ +QG+RR+LFWG+YYLD
Sbjct: 725  FLNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERRVLFWGVYYLD 784

Query: 548  VFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLLRFSKILG 607
            VF++LQLGVPRLLKDHEIECALP+S +    V+LA Q+I LEG++S FSLS++RFSK+LG
Sbjct: 785  VFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSLSVIRFSKVLG 844

Query: 608  NILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNGTINMEELNSGSH-W 666
            N+LDSIFKRGMT SI ++VAL+HENALD+WR GLP  L F+LDVNGTINM+E N   H +
Sbjct: 845  NVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTINMDEFNQLKHEY 904

Query: 667  KKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAAKPLLGGASEVDTDATLXXXXXXXXXXX 726
              + ++  + +N   M LYFL K ++H+PV+A KP +  + +   D  +           
Sbjct: 905  LNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQEKNDPAI-----SRQADR 959

Query: 727  XXXXYVLLQQATNTFLSVQSSLKSRHLPLALNLPRIKARFALLSARGILEYTKGGALFQG 786
                Y+LLQQATNTFL+V +S+++ +LPL +N+ R K RF L SARG LEYTKGGALFQ 
Sbjct: 960  SSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKGGALFQD 1019

Query: 787  NKALLLDVVKELETTKRLEIPGSLSWHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSY 846
            NK+LLL+++KELE  ++L IPG++SWHSL L DMA++LI+QPP+TK  K +KLL+ K+SY
Sbjct: 1020 NKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTKPEKEEKLLQKKISY 1079

Query: 847  YNKLMGRSANV 857
            YNKL+  S  +
Sbjct: 1080 YNKLIDHSVGM 1090

 Score =  160 bits (406), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 82/125 (65%), Positives = 98/125 (78%), Gaps = 6/125 (4%)

Query: 227 LSDPTTISFEQHEAPGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARL 286
           L+DPT+ISFEQ +APGL AVKALS+MANHE S+QLA LVA+S+PR+TEEILF+PQLLAR+
Sbjct: 384 LNDPTSISFEQDQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLARI 443

Query: 287 GQVHGLTSKQCLYTASLLASLKEPSQAVVP--TTDGLTELKCTSLWEIDDPMRFFKDSCK 344
           GQVHG TSKQCLYTAS+LASLKE    +VP  T+  L  L+  SLWEIDD   F     +
Sbjct: 444 GQVHGFTSKQCLYTASVLASLKE----IVPYQTSPELELLRSKSLWEIDDVDSFLSKGLR 499

Query: 345 FNLGS 349
           F+  S
Sbjct: 500 FSFPS 504

 Score =  132 bits (331), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 62/85 (72%)

Query: 67  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXXX 126
           +YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK+SDKLSRRAFPRGY          
Sbjct: 122 SYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVRE 181

Query: 127 XXXXXXXXXXXCDLKDEQMHLVYKY 151
                      CDLK+EQ+ LV KY
Sbjct: 182 LEAENRRLVALCDLKEEQLRLVSKY 206

 Score = 66.2 bits (160), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/185 (29%), Positives = 82/185 (44%), Gaps = 47/185 (25%)

Query: 1061 GFGFTVDASLGLAPLLAWSPEAAQEPIAETSDHDTRNDS--------------------G 1100
            G+GF VDASLGLA LL WSP+   +  A     D ++DS                     
Sbjct: 1400 GYGFVVDASLGLASLLGWSPKPGNDD-AIILGSDPKDDSEPKLNTARSFTTVNKLDMIPT 1458

Query: 1101 LRRKSGAETAGVLVAGHSQLADSSTDPAS-------------QQQRRVGS-YDHTYAQDQ 1146
            L   + + T     AG       + +PAS             +Q  + G+   + ++ D 
Sbjct: 1459 LMSTTKSTTTAPSDAGLPSSIRPNQNPASIKLVQNPLPLSTRKQFAQAGNPSRYPFSPDL 1518

Query: 1147 SVEDSAITMPTRPHRGPRRRWNSTTGAAAITPNSDRPR------NAPASETDENLQDLFR 1200
              ED  +T+ TR  RGPRR WN+T  +      +D+P+         + + D+N+ DLF+
Sbjct: 1519 LQEDGMLTINTRSPRGPRRYWNNTASS------TDQPQIHKNNTQQQSQQLDDNINDLFK 1572

Query: 1201 WQNSG 1205
            WQNSG
Sbjct: 1573 WQNSG 1577

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 58/106 (54%), Gaps = 20/106 (18%)

Query: 935  VAEAFHLDPVLNNNPFSNGDLTAFFSTDNG--MPNLSGGASMLNMVGVDQAHS-TAGNDA 991
            +AEAF LDPVL+  PFS+ DLT+F    NG  + N S  A  ++  G+    +  +G++ 
Sbjct: 1209 IAEAFQLDPVLHATPFSSTDLTSFL---NGEVVTNASMFADTMHTTGIGGGLTDVSGHNG 1265

Query: 992  QNTVNANSQQSTL--------------FNDGLFRVPSNGDFLKDYY 1023
              + N+    S++                DGLF+VPSNGDFLKDYY
Sbjct: 1266 LPSNNSLLNMSSIGFGIGSGPSLANLSSKDGLFKVPSNGDFLKDYY 1311

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]
           {ON} similar to uniprot|P39113 Saccharomyces cerevisiae
           YMR280c CAT8 transcription factor involved in
           gluconeogenesis
          Length = 1254

 Score =  545 bits (1404), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 336/834 (40%), Positives = 466/834 (55%), Gaps = 81/834 (9%)

Query: 68  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYXXXXXXXXXXX 127
           YRVAQACDRCR KKT+CDGK PQCSQCA VGFECK+SD+L+R++FPRGY           
Sbjct: 54  YRVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYTETLEERVREL 113

Query: 128 XXXXXXXXXXCDLKDEQMHLVYKYSSNKRPEPXXXXXXXXXXXXXXXXXXXXXXXXTN-- 185
                     C+             SN R +                          N  
Sbjct: 114 ETENKRLMALCN---------SDLGSNTRSDGLEKQSPSKRKRSPSMERDSERGFTENME 164

Query: 186 LYLLNKTSPAGHEVPENHKCQGIDCNHTSHPHLHEKPV-STTLSDPTT-ISFEQHEAPGL 243
           L L    S  G+  P NH+C            +H KPV S  + D  T +SFEQ+ APGL
Sbjct: 165 LQLQQSCSSCGNSDP-NHRC------------VHLKPVVSNIIVDSNTDVSFEQNVAPGL 211

Query: 244 PAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYTASL 303
           PAVKAL+SMA  E S QLA LV+L++PRSTEEILFIPQL+A + +  G +SKQ LYT SL
Sbjct: 212 PAVKALNSMAEREESAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGFSSKQSLYTVSL 271

Query: 304 LASLKEPSQAVVPTTDGLTELKCTSLWEIDDPMRFFKDSCKFNLGSDNDVXXXXXXXXXX 363
           L+SLK+      P ++   E    + +  +D   FF +  KF++  + +           
Sbjct: 272 LSSLKK--NLPTPNSNSSDENLSPNYYVSEDFRPFFYEVLKFDILGETETENGSNRNESP 329

Query: 364 XXX--------------------XYFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFG 403
                                   YFE     IP+ +   F K    FK    VD  F  
Sbjct: 330 DSTIPNSRSDDLLSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTE--VDK-FGD 386

Query: 404 KANSSFAHRSKSISY-KIFACILLVVCQLGIMSKVKR-----EQLPAKSKFSRIMAYYNN 457
           +    +      I++ KIFA +L V+CQ+ ++S++K+     ++L  K +   ++A+YN 
Sbjct: 387 RLFEVYKTEQIKINFLKIFATVLAVMCQMALLSRLKQLEATTQELECK-RTQNLIAHYNQ 445

Query: 458 AILALKLNPYF-SVKTTSVKTXXXXXXXXXXXXNVGEVSSVYELRGTIVSMAQQLRLHRC 516
            I  + L+ +F  + TT+V++            NVG++  +Y+LRGT++SMAQQLRLHRC
Sbjct: 446 LIEKIHLDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRC 505

Query: 517 PSAVL-GTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENG 575
           PSAVL    GSTM K EQG+RRLLFW IYYLDVF +LQLGVPRL+KDHEIECALP+SE  
Sbjct: 506 PSAVLLSASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSE-- 563

Query: 576 HPGVSLADQVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIA-QQVALIHENAL 634
                  ++  +LEG+VS+FSL+++R++K+LGNILDSIFKR M S  A + +A +HE AL
Sbjct: 564 -------EEDSQLEGRVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKAL 616

Query: 635 DSWRRGLPKNLTFELDVNGTINMEELNSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHL 694
           D W+  LP+   F L+ NG  N +EL    + +KD       +  ++++ YFL KC++HL
Sbjct: 617 DIWKNRLPEKYGFRLEANGLFNFDELTVVKNSEKDL-----IEKSSILLFYFLAKCMIHL 671

Query: 695 PVLAAKPL-----LGGASEVDTDATLXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSSLK 749
           PV+A +       L   +  DT  T                Y+L+Q+A +T L V     
Sbjct: 672 PVIATRSASLEQQLQPGTSSDTSET-PKESQNKTPTRVCPSYILMQKAASTMLQVMHYTS 730

Query: 750 SRHLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGS 809
             +LP  +N+ R KARFALL+A   +EY KGG+L+   K LL +++ +LE  ++L++PG 
Sbjct: 731 EYYLPSPINISRTKARFALLTACSAVEYLKGGSLYVETKNLLENLIIKLELERKLDLPGI 790

Query: 810 LSWHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGRSANVASTKRK 863
           +SWHSL LLDMA+ L++Q P TK  KLDKL++ K+++YN+ MG  A   S  RK
Sbjct: 791 ISWHSLKLLDMALMLLLQSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLSNSRK 844

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score =  500 bits (1287), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 288/703 (40%), Positives = 399/703 (56%), Gaps = 72/703 (10%)

Query: 203 HKCQGIDCNHTSHPHLHEKPVSTTLSDPTTISFEQHEAPGLPAVKALSSMANHEYSTQLA 262
           H   G     T+  HLH KPVST  +   +ISFEQ+EAPGL  VKAL SM N E +TQLA
Sbjct: 275 HTTNGKLHRDTNDHHLHPKPVSTNSNGLNSISFEQNEAPGLSTVKALKSMVNDEKNTQLA 334

Query: 263 CLVALSVPRSTEEILFIPQLLARLGQVHGLTSKQCLYTASLLASLKEPS-------QAVV 315
            LV+L++PRSTEEILFIPQ+LA++ Q  G TSK CLYT SLL+SLK           A  
Sbjct: 335 TLVSLAIPRSTEEILFIPQILAKVRQNFGFTSKHCLYTVSLLSSLKSFLSNSNNSISAAS 394

Query: 316 PTTDGLTELKCTSLWEIDDPMRFFKDSCKFNL------------------------GSDN 351
                L  LK T+LW+ +   +FF    K +                          + +
Sbjct: 395 ADNKNLETLKNTNLWKFNALFQFFTAFLKLDFLDSSLEKQNKGKKNGKVNNNNNNSANQD 454

Query: 352 DVXXXXXXXXXXXXXXYFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAH 411
            +              +F+     + ++NE EFY+YY+ FK  L          N S   
Sbjct: 455 GISPLSSSEIDELLKLFFQNWSDFVLMINEKEFYQYYSVFKSDL-------QNNNISKMS 507

Query: 412 RSKSISYKIFACILLVVCQLGIMSKVKREQLPAKSK-------FSRIMAYYNNAILALKL 464
            S  ++YKIF  I+L+ CQ+G++SK+K      KSK         ++M YY+N I  L  
Sbjct: 508 LSTLMNYKIFGLIILLFCQMGLLSKIKLSSNNTKSKNFKQQYHLKKVMNYYHNLINKLMW 567

Query: 465 NPYFSVKTTSVKTXXXXXXXXXXXXNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTE 524
           N +F +   ++++            ++G +S++YELR  ++SM+QQLRLHRCPSAVL   
Sbjct: 568 NEFFKISNVTLQSLKLLSLILFYNLHMGNISNIYELRSKVISMSQQLRLHRCPSAVLCGS 627

Query: 525 GSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPI-------SEN--- 574
              + K EQ +RRLLFW IYYLD+F++LQLGVPRLLKDHEIECALPI       S+N   
Sbjct: 628 TLKIHKLEQSNRRLLFWNIYYLDIFASLQLGVPRLLKDHEIECALPIPMDTDSKSDNQSQ 687

Query: 575 --GHPGVSLADQVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHEN 632
                     D  I+LEG VS  SL ++R+S+I+GNILD IFKR MT S+ + +ALIH +
Sbjct: 688 RSAATNAENDDNKIKLEGCVSHLSLVIIRYSQIVGNILDMIFKRNMTESMTKSIALIHIH 747

Query: 633 ALDSWRRGLPKNLTFELDVNGTINMEELNSGSHWKKDYSTAPSCDNRTLMV--LYFLVKC 690
           ALD WR  LP NL F+L+VNG+I++       +  ++         + L+V  LYF    
Sbjct: 748 ALDDWRNTLPSNLKFDLNVNGSIDLSSFIDQQNLNEE---EQRTQQQKLLVIFLYFFGVN 804

Query: 691 LVHLPVLAAKPLLGGASEVDTDATLXXXXXXXXXXXXXXXYVLLQQATNTFLSVQSSLKS 750
           ++H+PV+A++PL      V+ D+                 Y+ LQ ATNT L+V   L  
Sbjct: 805 MIHMPVVASRPL----PLVENDS------LNQIPDRSSSSYIALQHATNTMLNVLDLLSP 854

Query: 751 RHLPLALNLPRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGSL 810
            ++PL +N+ R   RF+++SA G+L++ KGG+LF  NKALL  VVK +ET + L++PG +
Sbjct: 855 TYVPLPINMSRTMVRFSMISACGMLDFIKGGSLFLENKALLAQVVKNIETDRFLDLPGVI 914

Query: 811 SWHSLILLDMAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGR 853
           SWHSL L D+ ++L  Q  + K  KLDKLLE K +YYN+LMG+
Sbjct: 915 SWHSLKLFDLTLTLFFQNTNIKLEKLDKLLEKKSNYYNRLMGK 957

 Score =  107 bits (267), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 46/48 (95%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R++QACDRCRSKKTRCDGKRPQCSQCA VGFECKVSDKL R+++PRGY
Sbjct: 103 RISQACDRCRSKKTRCDGKRPQCSQCAIVGFECKVSDKLQRKSYPRGY 150

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 60/134 (44%), Gaps = 20/134 (14%)

Query: 899  KVGETPVGVENTGQPNGNTQEHYAATWSNQNQPHSTVAEAFHLDPVLNNNP--FSNGDLT 956
            +V +T VGV  +   +     +YA     QNQ     A+A   DP+LN+N   FSN DL+
Sbjct: 1067 EVSQTQVGVPRSSTSSTAQNSNYANI---QNQ----FADALQFDPILNSNSFNFSNLDLS 1119

Query: 957  AFFSTDNGMPNLSGGASMLNMVGVDQAHSTAGNDAQNTVNANSQQ------STLFNDGLF 1010
            + F T   +   S   + L +   +     A N    TV   S Q      S + ND + 
Sbjct: 1120 SLFKT---VDKDSQKTNNLQVPTQNSDQPVAANGISTTVPTTSIQSFPTPKSLIQNDQIL 1176

Query: 1011 --RVPSNGDFLKDY 1022
              ++PS  DF KDY
Sbjct: 1177 LSKIPSFNDFFKDY 1190

 Score = 35.8 bits (81), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 60/156 (38%), Gaps = 35/156 (22%)

Query: 1055 TNTTDPGFGFTVDASLGLAPLLAWS------PEAAQEPIAETSDHDTRNDSGLRRKSGAE 1108
            T+T  P + + VDASLGLAPLL         PE +Q P+  TS+     ++ L   +   
Sbjct: 1368 TDTPIPDYNYFVDASLGLAPLLETQRRHNSFPETSQ-PLVNTSNAMNLGNASLSSTANNN 1426

Query: 1109 TAGVLVAGHSQLADSSTDPASQQQRRVGSYDHTYAQDQSVEDSAITMPTRPHRGPRRRWN 1168
                 +A +    +     +S+Q+ R                    +PT    G    +N
Sbjct: 1427 NTMPSIANNVGYNNPPLLSSSKQKPR-------------------HLPTN-DTGDILNFN 1466

Query: 1169 STTGAAAITPNSDRPRNAPASETDENLQDLFRWQNS 1204
                      +  R R        ENL+DLF WQNS
Sbjct: 1467 GDLSNLNFRRDVRRKR--------ENLEDLFSWQNS 1494

>Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON}
           (51828..55088) [3261 nt, 1087 aa]
          Length = 1086

 Score = 89.4 bits (220), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 33/48 (68%), Positives = 38/48 (79%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R++QACDRCR KK +CDG +P CSQC  V F CK SDKL+RR FPRGY
Sbjct: 93  RLSQACDRCRLKKIKCDGLKPNCSQCLKVNFICKTSDKLTRRGFPRGY 140

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 85.1 bits (209), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 38/48 (79%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R +QACDRCR KK +CDG RP C+ C  +G++CK SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFPRGY 71

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.277
           YJL089W
          Length = 725

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 38/49 (77%)

Query: 68  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           +RV+QACDRCR KK +CDG++P+CS C  + F C +S KLSRR  P+GY
Sbjct: 10  FRVSQACDRCRLKKIKCDGQKPRCSNCKKINFNCAISTKLSRRGLPKGY 58

>TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {ON}
           Anc_1.277 YJL089W
          Length = 1044

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%)

Query: 67  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           N R++QACDRCR KK +CDG +P C+ C+ + F CK SD+L+RR FP+GY
Sbjct: 77  NIRLSQACDRCRLKKIKCDGLKPSCTHCSKIKFACKTSDRLTRRGFPKGY 126

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
           uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 36/48 (75%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R +QACDRCR KK +CDG +P CS C  +G+ C  SDKL+RR FPRGY
Sbjct: 58  RFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRRGFPRGY 105

>ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa]
           {ON} weakly similar to uniprot|P46954 Saccharomyces
           cerevisiae YJL089W SIP4 Possibly involved in Snf1p
           regulated transcriptional activation shows homology to
           DNA binding domain of Gal4p has a leucine zipper motif
           and acidic region lexA-Sip4p activates transcription
          Length = 1027

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 37/48 (77%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R +QACDRCR KK +CDG +P CSQC  V F C+ SD+L+RR FPRGY
Sbjct: 33  RQSQACDRCRLKKIKCDGMKPTCSQCTKVNFTCRTSDRLTRRGFPRGY 80

>KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 862

 Score = 82.8 bits (203), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 38/48 (79%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R++QACDRCR KK +CDG +P C+ C  +GF C+ SDKLSRR FPRGY
Sbjct: 24  RMSQACDRCRLKKIKCDGIKPTCTPCTKIGFHCQTSDKLSRRGFPRGY 71

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
           similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 82.8 bits (203), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 38/48 (79%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R +QACDRCR KK +CDG RP C+ C  +G++C+ SDKL+RR FPRGY
Sbjct: 25  RSSQACDRCRLKKIKCDGVRPSCTSCKKIGYQCRTSDKLTRRGFPRGY 72

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 919

 Score = 82.4 bits (202), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 37/48 (77%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R +QACDRCR KK +CDG +P C+ C  VGF C+ SDKL+RR FPRGY
Sbjct: 24  RSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTRRGFPRGY 71

>Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089W
           (REAL)
          Length = 829

 Score = 82.4 bits (202), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 34/48 (70%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R A ACDRCR KK RCDG +P CS C  + F CK SDKLSRR  P+GY
Sbjct: 41  RKAHACDRCRLKKIRCDGLKPNCSNCTKINFPCKTSDKLSRRGLPKGY 88

>YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zinc
           cluster transcriptional activator that binds to the
           carbon source-responsive element (CSRE) of gluconeogenic
           genes; involved in the positive regulation of
           gluconeogenesis; regulated by Snf1p protein kinase;
           localized to the nucleus
          Length = 829

 Score = 81.6 bits (200), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 35/48 (72%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R A ACDRCR KK +CDG +P CS CA + F CK SDKLSRR  P+GY
Sbjct: 41  RKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSDKLSRRGLPKGY 88

>Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OFF}
           YJL089W (SIP4) - shows homology to DNA binding domain of
           Gal4p, has a leucine zipper motif and acidic region;
           lexA-Sip4p activates transcription [contig 304] PARTIAL
          Length = 201

 Score = 75.9 bits (185), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 37/48 (77%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R++QACDRCR KK +CDG +P C  C+ + F C+ SDKLSRR FPRGY
Sbjct: 24  RMSQACDRCRLKKIKCDGVKPTCGPCSKIKFHCQTSDKLSRRGFPRGY 71

>Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089W
           (REAL)
          Length = 833

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 35/48 (72%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R A ACDRCR KK +CDG +P CS C+ + F CK SDKLSRR  P+GY
Sbjct: 41  RKAHACDRCRLKKIKCDGLKPNCSNCSKIDFPCKTSDKLSRRGLPKGY 88

>Suva_6.161 Chr6
           complement(283370..284500,284547..284764,284948..285781,
           285812..286127) [2499 bp, 832 aa] {ON} YJL089W (REAL)
          Length = 832

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 34/48 (70%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R A ACDRCR KK +CDG +P CS C  + F CK SDKLSRR  P+GY
Sbjct: 41  RKAHACDRCRLKKIKCDGLKPNCSNCGKIDFPCKTSDKLSRRGLPKGY 88

>TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.277
           YJL089W
          Length = 945

 Score = 79.0 bits (193), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 30/48 (62%), Positives = 35/48 (72%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R + ACDRCR KK RCDG +P CSQC+   F C  SDKL+RR FP+GY
Sbjct: 54  RHSHACDRCRLKKVRCDGLKPSCSQCSRANFRCTTSDKLTRRGFPKGY 101

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
           {ON} some similarities with uniprot|P46954 Saccharomyces
           cerevisiae YJL089w SIP4 interacts with SNF1 protein
           kinase
          Length = 1209

 Score = 78.6 bits (192), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 37/48 (77%), Gaps = 1/48 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R +QACDRCRSKK +CDG +P CS CA +G+ C  SDKLSRR  P+GY
Sbjct: 24  RHSQACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSDKLSRRGLPKGY 70

>NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON} 
          Length = 1186

 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 34/48 (70%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R  QACDRCR KK +CD  +P CSQC    F+CK +DKL+RR F RGY
Sbjct: 117 RKIQACDRCRLKKIKCDDLKPSCSQCLKADFQCKTTDKLARRGFSRGY 164

>KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1.277
           YJL089W
          Length = 1072

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 35/49 (71%)

Query: 68  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           +R  QACDRCR KK +CDG +P C+ CA + F CK S KLSRR  P+GY
Sbjct: 22  FRKNQACDRCRLKKIKCDGLKPTCTNCAKINFLCKTSHKLSRRGLPKGY 70

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 33/48 (68%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R +QACDRCR KK +CDG  P C+ C  + F C+ + KLSRR  P+GY
Sbjct: 96  RHSQACDRCRLKKIKCDGLIPHCTNCRKINFNCQTTHKLSRRGLPKGY 143

>NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa]
           {ON} Anc_1.277
          Length = 932

 Score = 65.1 bits (157), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 30/45 (66%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           QACDRCR KK +CD + P C+ C   G  C+ +++L RR F +GY
Sbjct: 43  QACDRCRLKKIKCDDRTPDCTPCMKAGIPCRTTERLKRRGFAKGY 87

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {ON}
           weakly similar to uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 775

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 26/49 (53%)

Query: 68  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           YR   AC RCR +K +CD K P C++C      C   D  +RR  PR Y
Sbjct: 14  YRSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIPRSY 62

>KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]
           {ON} some similarities with uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 678

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 25/44 (56%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC  C+ ++ RCDG  PQC  C   G +C   DK++ R  PR Y
Sbjct: 66  ACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVDKITGRELPRDY 109

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 26/42 (61%), Gaps = 1/42 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
           RV +ACD CR KK +CDG++P C  C    +EC  +   +RR
Sbjct: 61  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPSTRR 101

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 42/82 (51%), Gaps = 2/82 (2%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRC-PSAVLGT-EGSTMSKSEQGDRRLLFWGIYYLDVF 549
             +S+ Y   G  +  A +  LHR  P+  +GT   S  +  E   R+ LF+ IY LD++
Sbjct: 392 ARLSTCYSYIGVALRSALREGLHRVIPTNKIGTGTDSRFNCIEIEMRKRLFYTIYKLDIY 451

Query: 550 SALQLGVPRLLKDHEIECALPI 571
               LG+PR +  ++ + +LP 
Sbjct: 452 VNAMLGLPRSISPNDFDQSLPF 473

>SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {ON}
           similar to uniprot|P07272 Saccharomyces cerevisiae
           YLR014C PPR1 Zinc finger transcription factor containing
           a Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 898

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R   AC+RCR+KKT+CD   P C++CA++G  C   D  + R   R Y
Sbjct: 48  RSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVDPATGRVVSRSY 95

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 906

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 26/48 (54%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R   AC RCR KK +CD K P CS+CA+    C   D  + R  PR Y
Sbjct: 38  RSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLDPATGRDVPRSY 85

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 27/45 (60%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           QACD CR KK +C  ++P+C++C   G+EC  S K  R    R +
Sbjct: 10  QACDICRIKKLKCSREKPKCAKCMKNGWECCYSPKAKRSPLTRAH 54

>YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}
           GAL4DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose;
           repressed by Gal80p and activated by Gal3p
          Length = 881

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + QACD CR KK +C  ++P+C++C    +EC+ S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDGK+P C  C    +EC
Sbjct: 9   RVTRACDECRKKKVKCDGKQP-CIHCTVYNYEC 40

 Score = 35.8 bits (81), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 11/117 (9%)

Query: 536 RRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEF 595
           R+ LF+ IY +D++    LG+PR +   + +  LP+  N      + +  I  E Q    
Sbjct: 461 RKRLFYTIYKMDIYINTMLGLPRTISPRDFDQELPLELNDD---YITEDAIYPEEQGDVL 517

Query: 596 SLSLL--RFSKILGNILDSIFK-----RGMTSSIAQQVALIHENALDSWRRGLPKNL 645
           S + +  + +KIL  ILD I       +   + I+ Q+    E  L  W   LP  L
Sbjct: 518 SSAGIANQHTKILM-ILDQIMADLYPIKKTNNLISHQMVTNLELKLRQWLDQLPPEL 573

>Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C
           (REAL)
          Length = 878

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + QACD CR KK +C  ++P+C++C    +EC+ S K  R    R +
Sbjct: 7   IEQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279
          Length = 890

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           + QACD CR KK +C  + P+CS+C   G +C  S K+ R    R
Sbjct: 16  IEQACDNCRLKKLKCSKETPKCSKCLKNGMKCLYSPKVKRSPLTR 60

>KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.279
           YPL248C
          Length = 875

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 25/50 (50%)

Query: 67  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           N    QACD CR KK +C   +P C +CA  G+ C  S K  R    R +
Sbjct: 14  NSSTDQACDLCRIKKLKCSKDKPACRKCAKNGWNCTYSPKAKRSPLTRAH 63

 Score = 39.7 bits (91), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 92/214 (42%), Gaps = 32/214 (14%)

Query: 368 YFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSISYKIFACILLV 427
           YFE+ H   P++NE EF  ++ K +++L V  +    A++     + +I ++    I+L 
Sbjct: 253 YFEKFHPFHPIINEREFMAHF-KSRDTLMVPDDIKDWASTKKTLSTDNIEWQFLLSIVLA 311

Query: 428 V---CQLGIMSKVKREQLPAKSKF---SRIMAYYNNAILALKLNPYFSVKTTSVKTXXXX 481
           +   C  G  + + R    + + +   + ++ + ++  L + LN  FS+  T   T    
Sbjct: 312 LGSWCNDGESTDIDRYYYKSAAFYLNDANMLLFTSSVNLIVTLN-LFSLYLTIKNTFW-- 368

Query: 482 XXXXXXXXNVGEVSSVYELRGTIVSMAQQLRLH--RCPSAVLGTEGSTMSKSEQGDRRLL 539
                       ++S Y++ G  + MA  L L+    P++   TE  TM K     R+LL
Sbjct: 369 ----------NNLNSAYQINGLAIRMAVSLGLNIKDIPTS---TENVTMLKQ----RKLL 411

Query: 540 FWGIYYLDVFSALQLGVPRLLKDHEIECALPISE 573
           ++ +   D+   +      L         +PI E
Sbjct: 412 WYALVNQDILLNMHFDRSNLFNSLNY---IPIDE 442

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
           {ON} Anc_7.17
          Length = 1059

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 22/34 (64%)

Query: 68  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           YR++  C  CR  KT+CD ++P CS+C  +G  C
Sbjct: 47  YRLSFVCQECRKSKTKCDKEKPSCSRCLKIGITC 80

>ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} similar
           to uniprot|P04386 Saccharomyces cerevisiae YPL248C GAL4
           DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose
           repressed by Gal80p and activated by Gal3p
          Length = 794

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 27/47 (57%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           +  ACD CR KK RC  + P+C++C   G+EC  S K +R    R +
Sbjct: 7   IDHACDSCRQKKLRCSKEEPKCAKCIQNGWECCYSPKANRTPLTRAH 53

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {ON}
           Anc_2.231 YIL130W
          Length = 848

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 44

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 25/113 (22%), Positives = 52/113 (46%), Gaps = 3/113 (2%)

Query: 536 RRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEF 595
           ++ LF+ +Y +D++    LG+PR L+  + +  LPI  +     +      R +G++S  
Sbjct: 372 KKRLFYNVYKMDIYINAMLGLPRSLRVEDFDQTLPIELSDENITAEGYFYERQKGELSSI 431

Query: 596 SLS--LLRFSKILGNILDSIFKRGMTSS-IAQQVALIHENALDSWRRGLPKNL 645
           ++S    +   +   I+  ++    T++ I+ +     E  L  W   LP  L
Sbjct: 432 AISNQHTKLIMVFDTIVSELYPLKKTNNMISHETVTRLEAKLTEWVDNLPVEL 484

>NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {ON}
           Anc_5.235
          Length = 890

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 25/44 (56%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCRSKK +CD K P C +CA +   C   D  + +  PR Y
Sbjct: 40  ACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVDPATGQDVPRSY 83

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
           {ON} Anc_2.231
          Length = 906

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 55/126 (43%), Gaps = 19/126 (15%)

Query: 536 RRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEF 595
           R+ LF+ IY LD++    LG+PR +   + +  LPI         L+D+ I   G + E 
Sbjct: 408 RKRLFYTIYKLDIYVNAMLGLPRSISPDDFDQTLPI--------ELSDENITEHGYLPEN 459

Query: 596 SLSLLRFSKI------LGNILDSIFK-----RGMTSSIAQQVALIHENALDSWRRGLPKN 644
              +L  + I      L  IL+SI +     +   + I+ +     E  L +W   LP  
Sbjct: 460 QNGVLSSTGIANQHTKLLMILNSIVRELYPIKKTNNLISHETVTRLELKLRTWMDELPTE 519

Query: 645 LTFELD 650
           L   L+
Sbjct: 520 LVPNLE 525

>KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON} 
          Length = 888

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCRSKKT+CD K P C +C  +   C   D  +    PR Y
Sbjct: 45  ACKRCRSKKTKCDQKLPSCGKCTKLNTPCISVDPATGEDVPRSY 88

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {ON}
           Anc_2.231 YIL130W
          Length = 930

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 109
           RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 34  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 73

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 71/170 (41%), Gaps = 24/170 (14%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
             +S+ Y   G  +  A +  LHR     +G   S  +  E   R+ LF+ IY LD++  
Sbjct: 392 ARLSTCYSYIGVAMRSALREGLHR----QVG-PNSGFNPIEIEMRKRLFYTIYKLDIYVN 446

Query: 552 LQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLLRFSKI------ 605
             LG+PR +  ++ +  LP+         L+D+ I  +G   E    +L  + I      
Sbjct: 447 AMLGLPRSISANDFDQTLPL--------ELSDENITEQGYFPENQNGVLSSTGIANEHTK 498

Query: 606 LGNILDSIFK-----RGMTSSIAQQVALIHENALDSWRRGLPKNLTFELD 650
           L  ILD+I       +   + I+ +     E  L +W   LP  L   L+
Sbjct: 499 LLMILDAIVGELYPIKKTNTFISHETIATLEQKLRNWLDDLPNELAPNLE 548

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
           (REAL)
          Length = 1012

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 68/165 (41%), Gaps = 24/165 (14%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
             +S+ Y   G  +  A +   HR  S+      S  S  E   R+ LF+ IY LDV+  
Sbjct: 363 ARLSTCYTYIGVAMRSALRAGFHRKLSS-----SSGFSPIEIEMRKRLFYTIYKLDVYIN 417

Query: 552 LQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLL----------R 601
             LG+PR +   + +  LP+         L+D+ I     + E   S+L          +
Sbjct: 418 AMLGLPRSISPDDFDQTLPL--------DLSDENITEVAYLPENQHSVLSSTGISNEHTK 469

Query: 602 FSKILGNILDSIFKRGMTSS-IAQQVALIHENALDSWRRGLPKNL 645
              IL  I+  ++    TS+ I+ +     E  L +W   LPK L
Sbjct: 470 LFLILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKEL 514

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)
          Length = 954

 Score = 49.3 bits (116), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 113
           RV +ACD CR KK +CDG++P C  C    +EC       R   P
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYKKPTKRTQNP 59

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 69/161 (42%), Gaps = 16/161 (9%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
             +S+ Y   G  +  A +   HR     LGT  S  S  E   R+ LF+ IY LDV+  
Sbjct: 361 ARLSTCYTYIGVAMRSALRAGFHR----KLGT-NSGFSPIEIEMRKRLFYTIYKLDVYIN 415

Query: 552 LQLGVPRLLKDHEIECALPI---SENGHPGVSLADQ---VIRLEGQVSEFSLSLLRFSKI 605
             LG+PR +   + +  LP+    EN      L +    V+   G  +E +   L    I
Sbjct: 416 AMLGLPRSISPDDFDQTLPLDLSDENITETAYLPENQNAVLSSTGISNEHTKLFL----I 471

Query: 606 LGNILDSIFKRGMTSS-IAQQVALIHENALDSWRRGLPKNL 645
           L  I+  ++    TS+ I+ +     E  L +W   LPK L
Sbjct: 472 LNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKEL 512

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.231
           YIL130W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 852

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 56/217 (25%), Positives = 89/217 (41%), Gaps = 42/217 (19%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
             +S+ Y   G  +  A +  LHR  S       S  S  E   R+ LF+ IY LDV+  
Sbjct: 346 ARLSTCYAYIGVAMRSALREGLHRSVSP-----DSGFSPIEIEMRKRLFYTIYKLDVYVN 400

Query: 552 LQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLL----------R 601
             LG+PR +  ++ +  LPI         L+D+ I  EG   E     L          +
Sbjct: 401 AMLGLPRSISSNDFDQTLPI--------ELSDENITEEGYFPENQKGKLSSAEIANQHTK 452

Query: 602 FSKILGNILDSIFK-RGMTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNGTINMEEL 660
              IL  I+  ++  R   + I  +V    E  L  W  GLP+ L     + G  ++   
Sbjct: 453 LIMILNVIVGELYPIRKTNNLIRHEVVTELELKLRQWLDGLPREL-----IPGIKDV--- 504

Query: 661 NSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVL 697
                  K+Y TA    N+ L + +F V+ +++ P +
Sbjct: 505 ------PKEYETA----NKLLHLSFFHVQLILYRPFI 531

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 109
           RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 15  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 54

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
           (REAL)
          Length = 926

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 68/161 (42%), Gaps = 16/161 (9%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
             +S+ Y   G  +  A +   HR  SA      S  +  E   R+ LF+ IY LDV+  
Sbjct: 360 ARLSTCYTYIGVAMRSALRAGFHRKLSA-----NSGFTPIEIEMRKRLFYTIYKLDVYIN 414

Query: 552 LQLGVPRLLKDHEIECALPISENGHPGVSLA------DQVIRLEGQVSEFSLSLLRFSKI 605
             LG+PR +   + +  LP+  +      +A      + V+   G  +E +   L    I
Sbjct: 415 AMLGLPRSISPEDFDQTLPLDLSDENITEVAYLPENQNAVLSSTGISNEHTKLFL----I 470

Query: 606 LGNILDSIFKRGMTSS-IAQQVALIHENALDSWRRGLPKNL 645
           L  I+  ++    T++ I+ +     E  L +W   LPK L
Sbjct: 471 LNEIISELYPIKKTNNIISHETVTSLELKLRNWLDSLPKEL 511

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
           cluster protein proposed to function as a
           transcriptional regulator involved in the stress
           response; null mutants have a respiratory deficiency,
           calcofluor white sensitivity and slightly increased
           cycloheximide resistance
          Length = 964

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 47

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 67/165 (40%), Gaps = 24/165 (14%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
             +S+ Y   G  +  A +   HR  S       S  S  E   R+ LF+ IY LDV+  
Sbjct: 360 ARLSTCYTYIGVAMRSALRAGFHRKLSP-----NSGFSPIEIEMRKRLFYTIYKLDVYIN 414

Query: 552 LQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLL----------R 601
             LG+PR +   + +  LP+         L+D+ I     + E   S+L          +
Sbjct: 415 AMLGLPRSISPDDFDQTLPL--------DLSDENITEVAYLPENQHSVLSSTGISNEHTK 466

Query: 602 FSKILGNILDSIFKRGMTSS-IAQQVALIHENALDSWRRGLPKNL 645
              IL  I+  ++    TS+ I+ +     E  L +W   LPK L
Sbjct: 467 LFLILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPKEL 511

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
           similar to Ashbya gossypii AER183C
          Length = 898

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
           RV++ACD CR+KK +C+G+ P CS C     EC  +  + RR
Sbjct: 22  RVSKACDTCRAKKIKCNGEEP-CSNCGKHDLECAYTHVIKRR 62

>Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 bp,
           881 aa] {ON} complement(81534..83840,83842..84180) [2646
           nt, 882 aa]
          Length = 881

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           Q CD CR KK +C  ++P+C +C    +EC  S K+ R    R +
Sbjct: 8   QVCDSCRLKKLKCSKEKPKCFKCLKHNWECNYSPKIKRSPLTRAH 52

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130w
          Length = 847

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 109
           +V +ACD CR KK +CDG +P C  C    +EC  +  L R
Sbjct: 15  KVTRACDDCRKKKVKCDGNQP-CIHCTVYSYECTYNHPLKR 54

 Score = 38.9 bits (89), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 52/117 (44%), Gaps = 9/117 (7%)

Query: 536 RRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEF 595
           R+ LF+ IY LDV+    LG+P  L   + +  LP+     P  +L +Q I  +      
Sbjct: 404 RKRLFYTIYKLDVYVNAMLGLPGSLDREDFDQELPLDL---PDEALTEQGINYDQNPYSL 460

Query: 596 SLSLL-----RFSKILGNILDSIFK-RGMTSSIAQQVALIHENALDSWRRGLPKNLT 646
           S + +     +   ILG+IL  ++  + +   I+ +     E  L  W   LP+ L 
Sbjct: 461 SSTGIANEHTKLFMILGDILKHLYPIKKINIFISHKTVTDLELKLKMWLEELPRELV 517

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 109
           RV +ACD CR KK +CDG++P C  C    +EC  +    R
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 49

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 71/160 (44%), Gaps = 13/160 (8%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
             +S+ Y   G  +  A +  LHR  +  +G  G T  + E   R+ LF+ IY +D++  
Sbjct: 294 ARLSTCYAYIGVAMRSALREGLHR--NLTMGAPGFTPIEIEM--RKRLFFTIYKMDIYLN 349

Query: 552 LQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLL-----RFSKIL 606
             LG+PR +   + + + P+  +      + +  I  E Q  E S + +     +   IL
Sbjct: 350 TMLGLPRAISQRDFDQSFPLEIDDE---YITEDGIYPERQGDELSSAGIANQHTKLIMIL 406

Query: 607 GNILDSIFKRGMTSS-IAQQVALIHENALDSWRRGLPKNL 645
            NI+  ++    T++ I+ +V    E  L  W   LP  L
Sbjct: 407 DNIVSELYPIKKTNNLISHEVVTNLELKLRQWLNQLPPEL 446

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 68/165 (41%), Gaps = 23/165 (13%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
             +S+ Y   G  +  A +  +HR     L  +  + +  E   R+ LF+ IY +DV+  
Sbjct: 308 ARLSTCYTYIGVAMRNALREGMHRN----LNADTHSYNPIEIEMRKRLFYTIYKMDVYVN 363

Query: 552 LQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLL----------R 601
             LG+PR +   + + ALP          L D+ I  +G   E   ++L          +
Sbjct: 364 TMLGLPRSVSQRDFDQALP--------AELTDEFITKDGLHFEKQGNVLSSAGIANQHTK 415

Query: 602 FSKILGNILDSIFKRGMTSS-IAQQVALIHENALDSWRRGLPKNL 645
              IL NI+  ++    T++ I+  V    E  L  W   LP  L
Sbjct: 416 LIMILDNIVAELYPVKKTNNLISHDVVTQLELKLRQWLDNLPPEL 460

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
           (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 72/164 (43%), Gaps = 19/164 (11%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
             +S+ Y   G  +  A +  +HR     L T+    S  E   R+ LF+ IY +DV+  
Sbjct: 339 ARLSTCYTYIGVAMRNALREGMHRN----LNTDTHGYSPIEIEMRKRLFYTIYKMDVYVN 394

Query: 552 LQLGVPRLLKDHEIECALP-------ISENG-HPGVSLADQVIRLEGQVSEFSLSLLRFS 603
             LG+PR +   + + ALP       I+E+G HP       V+   G  ++ +    +  
Sbjct: 395 TMLGLPRSVSQRDFDQALPAELTDEYITEDGLHP--EKQGDVLSSAGIANQHT----KLI 448

Query: 604 KILGNILDSIFKRGMTSS-IAQQVALIHENALDSWRRGLPKNLT 646
            IL NI+  ++    T++ I+  V    E  L  W   LP  LT
Sbjct: 449 MILDNIVAELYPVKKTNNLISHDVVTQLEFKLRQWLDNLPPELT 492

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           QACD CR KK +C  ++P+C++C    +EC  S K  R    R +
Sbjct: 11  QACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPKTRRSPLTRAH 55

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (55%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           V QACD CR +K RC  + P+CS+C    +EC  S K  R    R
Sbjct: 5   VQQACDSCRKRKLRCSKELPKCSKCLKHNWECCYSPKAVRSPLTR 49

>SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]
           {ON} conserved hypothetical protein
          Length = 971

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 507 MAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIE 566
           +AQ++ L R P++  G    T+ +S    RR+LFW I+ LD  ++L   +P L+K  E +
Sbjct: 388 LAQRVMLTRDPTSYHGITDPTLVQS----RRILFWQIFQLDTLTSLHNNLPPLIKLDEFD 443

Query: 567 CALPI 571
            ALP+
Sbjct: 444 TALPV 448

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.231
           YIL130W
          Length = 902

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 67/159 (42%), Gaps = 12/159 (7%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
             +S+ Y   G  +  A +   HR     +G E S +S  E   R+ LF+ IY LDV+  
Sbjct: 392 ARLSTCYAYIGVAMRSALREGFHR----KVGPE-SDLSPLEIEIRKRLFYTIYKLDVYVN 446

Query: 552 LQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLLRFSKILGNILD 611
             LG+PR +   + +  LP+  +       A    R +G +S   ++      I+  ILD
Sbjct: 447 AMLGLPRSISPEDFDQVLPLELSDENITEQAYYPEREDGSLSSTGIANCHTRLIM--ILD 504

Query: 612 SIFKRGM-----TSSIAQQVALIHENALDSWRRGLPKNL 645
           +I ++        + I+ +     E  L  W   LP  L
Sbjct: 505 TIMRKLYPIKRPNNVISHETVTNLEKLLRDWTNTLPAEL 543

>NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235
          Length = 889

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 23/44 (52%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCR KK +CD   P CS+CA +   C   D  +    PR Y
Sbjct: 21  ACKRCRLKKIKCDNNVPSCSRCAKLRVPCVAVDSATGEDVPRSY 64

>KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5.235
           YLR014C
          Length = 864

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCR+KK +CD + P C +CA V   C   D  +    PR Y
Sbjct: 33  ACKRCRAKKIKCDQEFPSCGKCAKVNEPCVSIDPATGEDIPRSY 76

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {ON}
           some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 979

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + ++ACD+CR KKTRCD   +RP CS C  +G  C       +R   +GY
Sbjct: 30  KTSRACDQCREKKTRCDFSDERPICSACQRMGKTCTFERVPMKRGPTKGY 79

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
           (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG++P C  C    + C
Sbjct: 31  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYNC 62

 Score = 39.3 bits (90), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 72/165 (43%), Gaps = 23/165 (13%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
             +S+ Y   G  +  A +  LHR     +  + S ++  +   R+ +F+ IY  D++  
Sbjct: 484 ARLSNCYSYIGIALRNALREGLHR----FVNPKSSNLNPLDIEMRKRVFYTIYKCDLYLN 539

Query: 552 LQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEG-----QVSEFSLSLL-----R 601
             LG+P+ L   + +  LP        V L+D+ I  EG     Q  E S + +     +
Sbjct: 540 SMLGLPKSLSSADFDQVLP--------VELSDENITEEGYFPDKQNGEVSSAAIANYHTK 591

Query: 602 FSKILGNILDSIFKRGMTSSIAQQVALIH-ENALDSWRRGLPKNL 645
              IL +I   ++    +++I     +   E  L++W + LP+ L
Sbjct: 592 LMLILADITKELYPNKKSNNIVSHETVTQLEMRLENWIQSLPQQL 636

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 89/215 (41%), Gaps = 40/215 (18%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
           G++ + Y   G  + +A +  LHR PS      G T  + E   R  LFW IY +D++  
Sbjct: 257 GDLKACYYYIGIALRIAIRENLHRKPSLT----GPTAIEDETKKR--LFWSIYKVDIYMN 310

Query: 552 LQLGVPRLLKDHEIECALPISENGHPGVSLADQVIR-----------LEGQVSEFSLSLL 600
             LG+P  L +  I+  LP   +    VS  D VI            +  + ++  L +L
Sbjct: 311 CTLGLPASLNESFIDQELPYDVDDEKIVS--DGVIFNENSNIISSCGMNNEHTKLILIML 368

Query: 601 RFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNGTINMEEL 660
           +  + L +I   I K      I   V L  E+ L +W   LP            + ++  
Sbjct: 369 KIYRTLYSIDVEILK------IDANVVLHLEDILFTWYNNLP------------LQLKHR 410

Query: 661 NSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLP 695
              ++ +++Y   PS   + L + Y L K ++  P
Sbjct: 411 EYATNKEREYYLKPS---KLLYLDYLLTKLILFKP 442

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 5/48 (10%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           RV +AC  CR KK RCDGK P CS CA     C+ ++     A PR +
Sbjct: 27  RVFKACIACRKKKRRCDGKSP-CSHCARTSIICEYTNT----ARPRSH 69

>Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C
           (PPR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 246]
           FULL
          Length = 881

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 25/48 (52%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R   AC RCR +K +CD K P CS+C +    C   D  + R  PR Y
Sbjct: 44  RSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSIDPATGRDVPRSY 91

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 70/165 (42%), Gaps = 23/165 (13%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
             +++ Y   G  +  A +   HR     +    +T++  E   R+ +F+ IY LDV+  
Sbjct: 433 ARLTTCYSYIGAALRAALKEGYHR----RVDPNNTTLNPIEIEMRKRIFYTIYKLDVYVN 488

Query: 552 LQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSE------FSLSLLRFSKI 605
             +G+PR L + + +  LPI         ++D+ I   G +SE       S+S+  +   
Sbjct: 489 SMMGLPRSLSEDDFDQELPI--------EISDECITENGYLSEQEGQQLSSISIANYHTK 540

Query: 606 LGNILDSIFKR-----GMTSSIAQQVALIHENALDSWRRGLPKNL 645
           L  IL  I +R         SI +   +  EN L  W   LP  L
Sbjct: 541 LYLILADIVQRLYSIKKKNRSITENTVISLENKLRKWADSLPHEL 585

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CDG+ P C  C    ++C
Sbjct: 67  RVTRACDECRKKKVKCDGQNP-CIHCTVYSYKC 98

>Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}
           YPL248C (REAL)
          Length = 895

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           + QACD CR KK +C  ++P+CS+C    +EC  S K  R    R
Sbjct: 7   MEQACDICRLKKLKCSKEKPKCSKCLKNNWECCYSPKTKRSPLTR 51

>KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 866

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 24/48 (50%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           R   AC RCR +K +CD K P CS+C      C   D  + R  PR Y
Sbjct: 33  RSIAACKRCRVRKVKCDQKFPSCSRCVTANEPCVSVDPATGRDVPRSY 80

>Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {ON}
           YLR014C (REAL)
          Length = 906

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRQKKIKCDQEFPSCKRCAKLKVPCVSLDPATGKDVPRSY 76

>TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.235
           YLR014C
          Length = 862

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCR KK +CD + P C +CA V   C   D  + R  PR Y
Sbjct: 29  ACKRCRLKKIKCDQEFPSCLKCARVKVPCVSLDPATGRDVPRSY 72

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger; overexpression increases salt
           tolerance through increased expression of the
           ENA1(Na+/Li+ extrusion pump) gene while gene disruption
           decreases both salt tolerance and ENA1 expression
          Length = 902

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 113
           RV++ACD CR+KK +CDG  P CS C  V  EC  +  + +R  P
Sbjct: 9   RVSKACDACRAKKIKCDGCDP-CSNCKKVSQECGYTYVVKKRQKP 52

>TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON} 
          Length = 647

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 57/114 (50%), Gaps = 14/114 (12%)

Query: 539 LFWGIYYLDVFSALQLGVPRLLKDHEIEC-ALP-ISENGHPGVSLADQVIRLEGQVSEFS 596
           +FW  Y  D   A++ G P  L D +++  +LP + E G+  VSL         +   F 
Sbjct: 322 IFWLCYIYDRLVAVRFGFPLNLDDLDVDVLSLPLVDEKGYYSVSL---------ETCHF- 371

Query: 597 LSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFELD 650
           +S ++ ++I   IL SI+ +   S I    A++ E  L +W   LP+NL  +LD
Sbjct: 372 VSQVKLARITTRILRSIYTKNSISFIQNCNAVLKE--LKTWFDDLPQNLILDLD 423

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV++ACD C+ +K RC G+ P C  C  +G
Sbjct: 5  RVSKACDVCKHRKKRCTGELP-CDYCTRIG 33

>TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.279
           YPL248C
          Length = 993

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           V QACD CR KK RC  + P+C++C    +EC  S +  R    R +
Sbjct: 8   VDQACDSCRIKKLRCSKENPKCAKCLKNKWECCYSPRKRRSPLTRAH 54

>TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%)

Query: 68  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           + + +ACD CR KK +C   RP+C +C   G++C  S ++ R    R
Sbjct: 2   FEMDRACDSCRHKKLKCSKTRPKCKKCLKNGWDCCYSPRIKRSPLTR 48

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 855

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCR+KK +CD + P C +CA     C   D  + R  PR Y
Sbjct: 32  ACKRCRTKKIKCDHEFPSCKKCARANKPCVSLDPATGRDVPRSY 75

>TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1154

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           QACD CR KK +C  ++P+C++C    +EC  S +  R    R +
Sbjct: 16  QACDSCRLKKLKCSKEKPKCAKCLKNIWECCYSPRAKRSPLTRNH 60

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
           similar to uniprot|P52960 Saccharomyces cerevisiae
           YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
           transcriptional activator of peroxisome proliferation
           may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 847

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 30/47 (63%), Gaps = 2/47 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK--VSDKLSRRAFP 113
           R++  C  CR +K +CD  +P+C +CA +G EC   +S+++S +  P
Sbjct: 27  RLSFVCRNCRKRKIKCDKAQPKCGRCAKLGLECNYDLSEQISLKKTP 73

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1033

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           + QACD CR KK +C    P+C QC    + C  S K+ R    R
Sbjct: 7   IEQACDNCRLKKLKCSKHFPKCGQCLKNNWPCIYSPKVKRSPLTR 51

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 4/37 (10%)

Query: 69  RVAQACDRCRSKKTRCDG----KRPQCSQCAAVGFEC 101
           RVA+ACDRCR +K +CD     K  +CS C   G EC
Sbjct: 118 RVARACDRCRKRKIKCDEIKNLKVNKCSNCVKYGAEC 154

>KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17
           YOR363C
          Length = 948

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR+ K +CD ++PQC +C  +G EC
Sbjct: 24  RLSYVCKACRTAKAKCDKEKPQCGRCYKLGVEC 56

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
           (REAL)
          Length = 469

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           V  ACD CR ++ +CDGK+P CS+C    FEC     L +R 
Sbjct: 4   VKYACDFCRVRRVKCDGKKP-CSRCIQHDFECTYQQPLRKRG 44

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {ON}
           YLR014C (REAL)
          Length = 903

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 32  ACKRCRLKKIKCDQEFPSCKRCAKLQVPCVSLDPATGKDVPRSY 75

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 994

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R++  C  CR  KTRCD ++P C++C  +  EC V D +++++ PR
Sbjct: 22  RISFVCQACRRSKTRCDKEKPICTRCKKLKLEC-VYD-MAKQSAPR 65

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
           YOR363C
          Length = 1232

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR  KT+CD K+P C++C   G +C
Sbjct: 47  RISFVCQHCRKSKTKCDKKQPHCARCIKHGIQC 79

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R++  C  CR  KT+CD ++P+CS+C   G +C V D +S++  PR
Sbjct: 61  RISFVCQACRKSKTKCDREKPECSRCIKHGLKC-VYD-VSKQPAPR 104

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 912

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           RV +AC+ C+ +K +CDG +P C+ C   G ECK      RR + R
Sbjct: 12  RVRKACEICKRRKVKCDGSQP-CANCVKHGQECKYISGTVRRRYRR 56

>SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {ON}
           weakly similar to uniprot|P40467 Saccharomyces
           cerevisiae YIL130W ASG1 Proposed transcriptional
           activator member of the Gal4p family of zinc cluster
           proteins and to YJL206C uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 780

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV++ACD CR +K RCDG++P C  C    + C
Sbjct: 27  RVSRACDVCRQRKVRCDGRQP-CIHCTVYSYNC 58

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 36/74 (48%), Gaps = 6/74 (8%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
            ++++ Y   G  +  A    LH      + T G +  ++E   R  LFW IY +DV+  
Sbjct: 355 AKLTTCYSYIGVALRAAITQGLH----TKVSTAGKSPVEAETCKR--LFWTIYKMDVYMN 408

Query: 552 LQLGVPRLLKDHEI 565
             LG+PR + + ++
Sbjct: 409 CILGLPRSISEEDV 422

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
           {ON} some similarities with uniprot|P52960 Saccharomyces
           cerevisiae YOR363C PIP2 peroxisome induction pathway 2
           (PIP2) transcriptional activator of peroxisome
           proliferation may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 619

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R    CD CR +K +CD  +P CS+CA  G EC
Sbjct: 10  RRLHVCDACRIRKLKCDKAKPNCSRCAKHGLEC 42

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
           MAL33MAL-activator protein, part of complex locus MAL3;
           nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           V  ACD CR ++ +CDGK+P CS+C    F+C     L +R 
Sbjct: 4   VKYACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKRG 44

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
           YOR363C
          Length = 951

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSR 109
           R++  C  CR  KT+CD ++P CS+C     EC    +L R
Sbjct: 60  RISFVCQACRKAKTKCDKEKPMCSRCRKQDLECVYDIELQR 100

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
           PPR1Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain, positively
           regulates transcription of URA1, URA3, URA4, and URA10,
           which are involved in de novo pyrimidine biosynthesis,
           in response to pyrimidine starvation; activity may be
           modulated by interaction with Tup1p
          Length = 904

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRSY 76

>SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {ON}
           some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 878

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 27/42 (64%), Gaps = 1/42 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
           RV++ACD CRSKK +C+G++  CS C   G  C  +  + +R
Sbjct: 11  RVSKACDSCRSKKIKCNGEQ-TCSNCLKYGCPCTYTHTIKKR 51

>KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {ON}
           Anc_4.113 YGL013C
          Length = 995

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 1/37 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 105
           +V QACD CR +K +C GK+P CS C A   +C  S+
Sbjct: 18  KVRQACDNCRKRKLKCTGKQP-CSTCEAYSCDCIYSE 53

 Score = 33.1 bits (74), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 21/35 (60%)

Query: 536 RRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALP 570
           RR L+W +YY +   A + G+P  + ++ + C LP
Sbjct: 503 RRTLWWKLYYYEKVIASKRGIPSRINENVMNCLLP 537

>KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {ON}
           Anc_6.279 YPL248C
          Length = 834

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + QACD CR KK RC  ++P C +C      C  S +  R    R +
Sbjct: 1   MEQACDICRVKKLRCSKEKPSCFKCLKNNLTCTYSPRAKRSPLTRAH 47

>KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {ON}
           conserved hypothetical protein
          Length = 370

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 105
           RV++ACD CR  KT+CDG+RP CS+C      C  S+
Sbjct: 17  RVSKACDACRKSKTKCDGERP-CSRCLKENKLCTYSN 52

>Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W
           (REAL)
          Length = 775

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 24/38 (63%), Gaps = 9/38 (23%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCA---------AVGFE 100
           ++C+ CR +K RCDGKRP+CS C          A+GFE
Sbjct: 10  RSCELCRKRKLRCDGKRPRCSTCVRKKSSECTYAIGFE 47

>KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {ON}
           conserved hypothetical protein
          Length = 873

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/344 (19%), Positives = 125/344 (36%), Gaps = 89/344 (25%)

Query: 368 YFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSISYKIFACILLV 427
           YF   H L+P++N+ EF K                       A+ + + S  +   IL V
Sbjct: 224 YFRYIHPLMPIMNQTEFRK-----------------------AYAANTCSIFLLQAILCV 260

Query: 428 VCQLG----IMSKVKREQLPAKSKFSRIMAYYN-----NAILALKLNPYFSVKTTSVKTX 478
             +L     +M K     L +   + R  + Y+     N +  L+     S +  + K  
Sbjct: 261 AVKLSRNPLLMDKNGSTDLASNIFYQRAKSLYDGRYEENEVCLLQGMMLLSKQAFNEKNT 320

Query: 479 XXXXXXXXXXXNVGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRL 538
                             +Y ++   V++AQ   LHR           T++ +E+  R+L
Sbjct: 321 IHM--------------PMYFIKNA-VTIAQTYGLHRS-----ADFHPTLTANEKRARKL 360

Query: 539 LFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSL- 597
           ++W +Y +D   ++ +G P+ +     +C +P+         L       EG+  E S+ 
Sbjct: 361 IWWILYVIDTLVSISIGRPQAINLD--DCDVPV---------LTHDDFVFEGEAPEHSMP 409

Query: 598 --------SLLRFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFEL 649
                   S ++ ++I+  I   + +       A+ +    +  L  WR  LP++LT+  
Sbjct: 410 VDHMDCIISTVQIAEIMSRISRELNRPAAAHCDAKFLIQHFDLLLQRWRNNLPESLTY-- 467

Query: 650 DVNGTINMEELNSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVH 693
                          H   +  T  S     +  LY+   CL+H
Sbjct: 468 ---------------HSNAEIFTKHSIPKAFVNALYYKTLCLLH 496

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGK-RPQCSQCAAVGFECKVSD 105
           R ++AC+ C  +K RCD   R  C+ C   G  C++ D
Sbjct: 14  RTSRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRD 51

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
           R+  +C  CR +K +CD KRP C+QC   G
Sbjct: 113 RIPLSCTICRKRKVKCDKKRPHCNQCTKTG 142

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
           weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 934

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 23/43 (53%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           R +  C  CR +K +CD KRP+CS+C   G  C      SR A
Sbjct: 14  RPSFVCQECRRRKIKCDKKRPRCSRCVDTGLPCTYLASGSRSA 56

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR KK +CD + P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDSRHP-CIHCTVYSYEC 44

>Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {ON}
           YLR014C (REAL)
          Length = 899

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           AC RCR KK +CD + P C +CA +   C   D  + +  PR Y
Sbjct: 33  ACKRCRLKKIKCDQEFPSCKRCANLEVPCVSLDPATGKDVPRSY 76

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1020

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           +V++ACD+CR KK +CD     P CS C  VG  C       +R   +GY
Sbjct: 31  KVSRACDQCRKKKIKCDVSEDNPVCSGCFKVGDRCTFERVPLKRGPSKGY 80

>AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YOL089C
           (HAL9)
          Length = 879

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
           RV++ACD CR+KK RC+G+ P C  C      C  +  + RR
Sbjct: 76  RVSKACDICRAKKIRCNGEEP-CVNCEKFNLGCTYTHVIKRR 116

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
           Ashbya gossypii AER370W
          Length = 826

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R+ +ACD CR KK +CD + P C  C    +EC
Sbjct: 17  RITRACDECRKKKVKCDNRHP-CIHCTVYSYEC 48

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 36/156 (23%), Positives = 65/156 (41%), Gaps = 27/156 (17%)

Query: 505 VSMAQQLR--LHR--CPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLL 560
           ++M   LR  LHR   P A +     + S  E   R+ +F+ IY +DV     LG+PR +
Sbjct: 336 LAMKSALREGLHRNLTPEASM-----SFSPIEIEMRKRVFYTIYRMDVMLNTMLGLPRSI 390

Query: 561 KDHEIECALPISENGHPGVSLADQVIRLEGQVSEFSLSLL----------RFSKILGNIL 610
              + +  LP+        +++D  I  EG +      +L          +   I+  I 
Sbjct: 391 SKEDFDQELPL--------TISDSCITEEGILRNKGSDILGSTGVTNQHTKLVMIMDEIA 442

Query: 611 DSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLT 646
           ++++   + + ++  V    E  L +W   LP  L 
Sbjct: 443 NTLYSPRLDNVVSHSVISDLELKLRAWLDQLPPELV 478

>Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W
           (REAL)
          Length = 1045

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R++  C  CR  KT+CD ++P+C +C   G +C V D +S++  PR
Sbjct: 61  RISFVCQACRKSKTKCDREKPECGRCTKHGLKC-VYD-VSKQPAPR 104

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 22/33 (66%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R +  C  C+++K RCD +RP CS+C  +G +C
Sbjct: 26  RRSHVCITCKNQKLRCDRERPSCSRCRRIGRDC 58

>Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W
           (REAL)
          Length = 1040

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R++  C  CR  KT+CD ++P+C +C   G +C V D +S++  PR
Sbjct: 61  RISFVCQACRKSKTKCDREKPECGRCIKHGLKC-VYD-VSKQPAPR 104

>ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 970

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 29/46 (63%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R++  C  CR  KT+CD ++P+CS+CA    +C V D   +RA PR
Sbjct: 27  RISFVCQACRKSKTKCDREKPRCSRCAKNNVKC-VYDIEKQRA-PR 70

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
           similarities with uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 571

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106
           RV+ ACD CR KK +CDG++P C  C     EC  SD+
Sbjct: 23  RVSHACDNCRLKKKKCDGQQP-CKLCKNSENECIYSDR 59

 Score = 32.3 bits (72), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/79 (24%), Positives = 36/79 (45%), Gaps = 6/79 (7%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
           G +   Y   G  +  A    LHR  S+++G      +  E   ++ LFW +Y +D++  
Sbjct: 203 GNLKRCYSYMGIALRAAIAEGLHR-KSSLMGP-----TPIEDESKKRLFWTVYKVDIYMN 256

Query: 552 LQLGVPRLLKDHEIECALP 570
             +G+P+ +    +   LP
Sbjct: 257 CIMGLPQSISQKTVNMELP 275

>KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17
           YOR363C
          Length = 1045

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR  KT+CD ++P+CS+CA     C
Sbjct: 24  RISLVCQACRKSKTKCDREKPRCSRCAKNNLRC 56

>Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {ON}
           [contig 206] FULL
          Length = 854

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 82/196 (41%), Gaps = 38/196 (19%)

Query: 505 VSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHE 564
           V++AQ   LHR           T++ +E+  R+L++W +Y +D   ++ +G P+ +    
Sbjct: 314 VTVAQTYGLHRS-----ADFHPTLTANEKRTRKLIWWILYVIDTLVSISIGRPQAINLD- 367

Query: 565 IECALP-------ISENGHPGVSLADQVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRG 617
            +C +P       I E G P  ++A   +       +  +S ++  +I+  I   + +  
Sbjct: 368 -DCDVPVLTHDDFIFEGGAPDHAVAVDYM-------DCIISTVQIVEIMSRISRELNRPA 419

Query: 618 MTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNGTINMEELNSGSHWKKDYSTAPSCD 677
            +   A+ +    +  L  WR+ LP++LT+                 H   +  T  S  
Sbjct: 420 ASQCDAKVLIQHFDMLLQRWRKNLPESLTY-----------------HSNAEIFTKHSIP 462

Query: 678 NRTLMVLYFLVKCLVH 693
              +  LY+   CL+H
Sbjct: 463 KAFVNALYYKTLCLLH 478

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGK-RPQCSQCAAVGFECKVSD 105
           R  +AC+ C  +K RCD   R  C+ C   G  C++ D
Sbjct: 14  RTNRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRD 51

>SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 983

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR  KT+CD ++P C++C   G EC
Sbjct: 23  RISFVCKACRKSKTKCDREKPSCTRCIKNGIEC 55

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar to
           uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
           transcription factor
          Length = 1107

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
           +V +ACD CR +K +C+G +P C  C   G EC  +D  S +
Sbjct: 26  KVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTYTDAKSTK 66

 Score = 37.0 bits (84), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 6/66 (9%)

Query: 505 VSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHE 564
           V+ A+++  HR    V G E ST  K     RRLL+W +Y  +  S ++ G   ++ D  
Sbjct: 567 VANAKKMGFHRWEFYV-GYEESTAEK-----RRLLWWKLYNYEKASTMKKGFFSVIDDAT 620

Query: 565 IECALP 570
           + C LP
Sbjct: 621 VNCLLP 626

>Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON}
           complement(89752..93018) [3267 nt, 1089 aa]
          Length = 1088

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
           R++  C +CR  KTRCD ++P C++C      C    +L ++
Sbjct: 34  RISFVCQQCRKAKTRCDKEQPNCTRCIKNNLNCIYDIELQKK 75

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1207

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVS 104
           +V++ACD CR +K +C G+RP C+ C     EC  S
Sbjct: 12  KVSKACDNCRRRKIKCSGERP-CAGCKTYNCECIFS 46

>SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {ON}
           conserved hypothetical protein
          Length = 362

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 105
           RV++ACD CR  KT+CDG+RP C +C +    C  S+
Sbjct: 6   RVSKACDTCRKSKTKCDGERP-CQRCLSENKICTYSN 41

>Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380W
           (REAL)
          Length = 542

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           RV +AC  CR +K +C+GK P C  C A G+ C  +D       PR
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCIAYGYACHYTDVDGSSTSPR 59

>YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}
           OAF1Oleate-activated transcription factor, acts alone
           and as a heterodimer with Pip2p; activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1047

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 28/46 (60%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R+   C  CR  KT+CD ++P+C +C   G +C V D +S++  PR
Sbjct: 61  RILFVCQACRKSKTKCDREKPECGRCVKHGLKC-VYD-VSKQPAPR 104

>KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {ON}
           weakly similar to uniprot|P04386 Saccharomyces
           cerevisiae YPL248C GAL4 DNA-binding transcription factor
           required for the activation of the GAL genes in response
           to galactose repressed by Gal80p and activated by Gal3p
          Length = 749

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           QACD CR KK +C  + P CS C    ++C  S K  R    R +
Sbjct: 9   QACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPKKVRSPLTRAH 53

>CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 1022

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           R++  C  CR  KT+CD ++P CS+C   G  C V D  S++A
Sbjct: 18  RLSFVCQGCRKAKTKCDKEKPACSRCLKHGIRC-VYDLTSQKA 59

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
           weakly similar to uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 922

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R++  C  CR +K +CD +RP C QCA  G  C V D + R+  PR
Sbjct: 20  RLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTC-VYD-IERQPAPR 63

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
           similar to uniprot|P35995 Saccharomyces cerevisiae
           YKL222C Hypothetical ORF and similar to uniprot|Q12340
           Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSDKLSRRAFP 113
           +V ++C  CR +K +CD K+P+CS CAA    EC   +K +    P
Sbjct: 14  KVIKSCLFCRKRKLKCDHKKPKCSTCAARNLPECVYVEKFTHEIDP 59

>Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to
           Ashbya gossypii ADR403C
          Length = 978

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R++  C  CR  KT+CD ++P+CS+CA    +C V D + +++ PR
Sbjct: 27  RISFVCQACRKSKTKCDREKPRCSRCAKNNIKC-VYD-IEKQSAPR 70

>KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]
           {ON} uniprot|P08657 Kluyveromyces lactis LAC9 Lactose
           regulatory protein LAC9
          Length = 865

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 22/45 (48%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           QACD CR KK +C    P C+ C     +C  S ++ R    R +
Sbjct: 93  QACDACRKKKWKCSKTVPTCTNCLKYNLDCVYSPQVVRTPLTRAH 137

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 88/230 (38%), Gaps = 44/230 (19%)

Query: 368 YFEECHALIPVLNENEFYKYYNKFKESLTVDPNFFGKANSSFAHRSKSISYKIFACILLV 427
           YF+  HAL P++++  F+  YN                      + K  + +I+  +L  
Sbjct: 392 YFKHYHALYPLVSKEMFFAQYND---------------------QIKPENVEIWHILLNA 430

Query: 428 VCQLGIMSKVKREQLPAKSKFSRIMAYYNNAILALKLNPYFSVKTTSVKTXXXXXXXXXX 487
           V  LG           + S  S    YY NA+  L       ++T S             
Sbjct: 431 VLALGSWC--------SNSCSSHHTLYYQNALSYLSTA---VLETGSTDLTIALILLTHY 479

Query: 488 XXNVGEVSSVYELRGTIVSMAQQLRLHR-CPSAVLGTEGSTMSKSEQGDRRLLFWGIYYL 546
              + + ++ + L G    MA  L LHR  P++ +          +Q  RR+L+W IY  
Sbjct: 480 VQKMHKPNTAWSLIGLCSHMATSLGLHRDLPNSTIH---------DQQLRRVLWWTIYCT 530

Query: 547 DVFSALQLGVPRLLKD-HEIECALPISENGHPGVSLADQVIRLEGQVSEF 595
               +L+ G P LL +   I+  LP S       S+   +I+ E Q S+ 
Sbjct: 531 GCDLSLETGRPSLLPNLQAIDIPLPASSATIKEPSIYSSIIQ-ESQWSQI 579

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar to
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate-activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1035

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRG 115
           R++  C  CR  KT+CD ++P+C +C   G  C V D + ++A PR 
Sbjct: 55  RISFVCKACRRSKTKCDREKPKCGRCVQHGIAC-VYD-VEKQAAPRN 99

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R    C  CR++K +CD +RP+C +C  +G EC
Sbjct: 15  RSYSGCWTCRARKVKCDTQRPKCCRCKQLGIEC 47

>ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; No
           homolog in Saccharomyces cerevisiae
          Length = 817

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 64/136 (47%), Gaps = 31/136 (22%)

Query: 494 VSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGD---RRLLFWGIYYLDVFS 550
           +SSV +L      +AQ+L+L   P  V G+        E  D   RR++FW I+ LD  +
Sbjct: 270 ISSVAQL----ARLAQRLQLTADPEYVPGSR-------EMADVQFRRIIFWQIFQLDTLT 318

Query: 551 ALQLGVPRLLKDHEIECALP--ISENG------------HPGVSLADQVIRLEGQVSEFS 596
           +LQ  +P LL+ +E E +LP    E G            +  V L + V R++  +S   
Sbjct: 319 SLQNRLPPLLRYNECETSLPSEFDEGGKLNPNLCFLNAKYQFVILVNDVCRMDAALSRSV 378

Query: 597 LS---LLRFSKILGNI 609
           LS   LL F + +  +
Sbjct: 379 LSDKDLLEFRERVAQL 394

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 4/37 (10%)

Query: 69  RVAQACDRCRSKKTRCDGKRP----QCSQCAAVGFEC 101
           RV++ACD CR +K +CD KR     +CS C     EC
Sbjct: 248 RVSRACDHCRKRKIKCDEKRDPNTNKCSNCIKYNSEC 284

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 3/36 (8%)

Query: 69  RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 101
           R A+AC+ CR +KT+CD   P   +CS C+  G +C
Sbjct: 173 RAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
           Anc_7.17 YAL051W
          Length = 944

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 68  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           YR++  C  CR  K +CD ++P CS+C+    EC
Sbjct: 34  YRLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLEC 67

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
           similar to uniprot|P05085 Saccharomyces cerevisiae
           YML099C ARG81 Zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type involved in
           the regulation of arginine-responsive genes acts with
           Arg80p and Arg82p
          Length = 848

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 22/41 (53%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 113
            C  CRS+K +CD  RP C +C   GFEC   D   R + P
Sbjct: 19  GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC--KVSDKLSRR 110
           RVA+ACD CR +K +CD   PQ   CS C      C  +V D + +R
Sbjct: 113 RVARACDHCRRRKIKCDPVNPQTNKCSNCTKYDANCTFRVRDDVEKR 159

>TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa]
           {ON} Anc_1.128 YJL206C
          Length = 691

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 23/30 (76%), Gaps = 1/30 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
           RV++AC+ CRSKK +CDG++P C  C  VG
Sbjct: 125 RVSRACEFCRSKKKKCDGQQP-CDLCKLVG 153

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 35/79 (44%), Gaps = 6/79 (7%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
             + + Y   G  +  A    LHR  S +    G T  + E   R  LFW +Y +D++  
Sbjct: 307 ANLKTCYSYIGIALRAAISEGLHRKNSLI----GPTPIEDETKKR--LFWSVYKVDLYMN 360

Query: 552 LQLGVPRLLKDHEIECALP 570
             LG+PR L +  I   LP
Sbjct: 361 CILGLPRTLSESAINQELP 379

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR  KT+C+  +P CS+C  +G  C
Sbjct: 69  RISFVCQSCRKSKTKCNKDKPSCSRCKKLGIFC 101

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
           PDR1Zinc cluster protein that is a master regulator
           involved in recruiting other zinc cluster proteins to
           pleiotropic drug response elements (PDREs) to fine tune
           the regulation of multidrug resistance genes
          Length = 1068

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106
           +V++ACD CR +K +C+GK P C+ C     EC  S +
Sbjct: 41  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFSTR 77

>TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa]
           {ON} 
          Length = 847

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R+   C  CR+KK +CD K+P C +C   G  C
Sbjct: 9   RLNNGCWTCRTKKVKCDSKKPFCDKCKDSGLHC 41

>Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W
           (REAL)
          Length = 468

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           ACD CR ++ +CDGK+P C +C    FEC     L +R 
Sbjct: 7   ACDYCRVRRVKCDGKKP-CRRCLQHNFECTHQQPLKKRG 44

>Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380W
           (REAL)
          Length = 546

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK--LSRRAFP 113
           RV +AC  CR +K +C+GK P C  C + G+ C   DK   S  +FP
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCISYGYVCHYMDKDRSSSSSFP 60

>KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON}
          uniprot|Q6DR96 Kluyveromyces lactis HAP1
          Length = 1253

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV  +C  CR +K +CD  RPQC QC   G
Sbjct: 20 RVPLSCTICRKRKVKCDKGRPQCQQCVKTG 49

>SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON}
           weakly similar to uniprot|P33200 Saccharomyces
           cerevisiae YBL005W PDR3 Transcriptional activator of the
           pleiotropic drug resistance network regulates expression
           of ATP-binding cassette (ABC) transporters through
           binding to cis-acting sites known as PDREs (PDR
           responsive elements)
          Length = 940

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVS 104
           +V++ACD CR +K +C GK+P CS C A    C+ S
Sbjct: 23  KVSRACDNCRRRKIKCTGKQP-CSNCQAYQCHCEYS 57

>Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}
           similar to Ashbya gossypii ACL058W
          Length = 885

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 41/75 (54%), Gaps = 5/75 (6%)

Query: 504 IVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDH 563
           +  +AQ+++L   P +  G     + +S    RR+LFW I+YLD  ++L   +P L+K  
Sbjct: 323 LFRLAQKIQLTLDPVSYHGMTDQALIRS----RRILFWQIFYLDTITSLHNNLPPLIKPG 378

Query: 564 EIECALPISENGHPG 578
           E +  L ++E  H G
Sbjct: 379 EFDTVL-MTELDHNG 392

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 74  CDRCRSKKTRCDGKRPQCSQCAAVGFECK--VSDKLSR 109
           C  C  +K +C  +RP C  C    FEC   V+D++SR
Sbjct: 38  CMPCHKRKVKCSRERPSCDNCLRNSFECVYFVNDRVSR 75

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6.60
           YLR266C
          Length = 795

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           ++ +AC  CR +K +CD  +P+C QC++    C
Sbjct: 9   KIIKACVFCRKRKLKCDLTKPKCKQCSSRNLNC 41

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 26/47 (55%), Gaps = 5/47 (10%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC--KVSDKLSRR 110
           RV++ACD CR +K RCD   PQ   CS C      C  K  D++ R+
Sbjct: 128 RVSKACDHCRKRKIRCDEVDPQTNKCSNCVKFQSACTFKHRDEILRK 174

>TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {ON}
           Anc_7.17 YOR363C
          Length = 989

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 21/33 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR  KT+CD ++P+C +C   G +C
Sbjct: 40  RISFVCQACRRSKTKCDREKPRCGRCQQHGLQC 72

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {ON}
           YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + ++ACD+CR KKTRCD   + P C+ C  +   C       +R   +GY
Sbjct: 34  KTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFERVPMKRGPTKGY 83

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
           {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
           lactis KLLA0A03421g and weakly similar to YAL051W
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate- activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta- oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 946

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           +++  C  CR  KT+CD ++P CS+C  +G +C
Sbjct: 24  KLSFVCQSCRKSKTKCDKQKPSCSRCLRLGHQC 56

>YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}
           RDR1Transcriptional repressor involved in the control of
           multidrug resistance; negatively regulates expression of
           the PDR5 gene; member of the Gal4p family of zinc
           cluster proteins
          Length = 546

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           RV +AC  CR +K +C+GK P C  C A G+ C   D     A P+
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYIDGRVPSASPQ 59

>KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some
           similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 703

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 71/161 (44%), Gaps = 27/161 (16%)

Query: 491 VGEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFS 550
           V + +  Y + G  + +A  L +H+             S + + +R  +FW  +  D   
Sbjct: 323 VDKSAFAYVMVGNAIRIAFTLGIHKT------------SATPKNNR--IFWLCFLYDRLL 368

Query: 551 ALQLGVPRLLKDHEIECALP-ISENGHPGVSLADQVIRLEGQVSEFSLSLLRFSKILGNI 609
           A++ G P L+  +EIE  +P  S      +S++ +    E QVS         +KI  NI
Sbjct: 369 AIRFGFPLLI--NEIEIEIPSCSSFDTDFLSISLEKYHFEAQVS--------LAKITTNI 418

Query: 610 LDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFELD 650
           +  I+ +  +S +    A++ E  L  W  GLP  L F+ +
Sbjct: 419 IKRIYTKNSSSFVHNCHAVLKE--LKDWFDGLPSELKFDYN 457

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 67 NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          N +  +AC+ C+ +K RC G  P C  C  +G
Sbjct: 11 NAKSKRACETCKRRKKRCSGGLP-CEYCVKIG 41

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {ON}
           
          Length = 1136

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R++  C  CR  K +CD ++P+C++C   G +C   ++  R+  PR
Sbjct: 45  RISFVCQNCRKSKMKCDREKPECTRCLKQGIKCVYDEE--RQPRPR 88

>Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W
           (REAL)
          Length = 545

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106
           RV +AC  CR +K +C+GK P C  C A G+ C  +++
Sbjct: 15  RVRKACVPCRERKRKCNGKSP-CEMCVAYGYVCHYTEE 51

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
           YKL222C (REAL)
          Length = 688

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           +  +AC  CR KK +CD  RPQC QC     EC
Sbjct: 11  KAIKACLNCRRKKQKCDQARPQCYQCRIRKTEC 43

>KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {ON}
           some similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222c
          Length = 658

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSD 105
           +V ++C  CR +K +CD KRP C+ C   G  EC  +D
Sbjct: 85  KVIKSCTFCRKRKLKCDRKRPMCTGCKMRGLSECVYTD 122

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8.879
           YML099C
          Length = 1132

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 20/34 (58%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 102
           R    C  CRS+K +CD ++PQC +C     +C+
Sbjct: 11  RTYSGCWTCRSRKIKCDQQKPQCKRCLKANLKCE 44

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {ON}
           
          Length = 1113

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 105
           +V++AC  CR +K +C G  P CS CAA   EC   D
Sbjct: 32  KVSKACANCRRRKIKCTGTYP-CSNCAAYQCECIFDD 67

>NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {ON}
           Anc_7.17
          Length = 1161

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR  KT+CD ++P C++C     +C
Sbjct: 64  RISFVCQECRKAKTKCDKEKPYCTRCVKQNIKC 96

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {ON}
           YGL013C (REAL)
          Length = 1069

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTTR 74

>Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {ON}
           YGL013C (REAL)
          Length = 1080

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTSR 74

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 22/36 (61%), Gaps = 3/36 (8%)

Query: 69  RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 101
           RV++ACD CR +K +CD  +P   +CS C     EC
Sbjct: 134 RVSKACDHCRKRKIKCDDVKPRTGKCSNCTKFNAEC 169

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 66/176 (37%), Gaps = 31/176 (17%)

Query: 498 YELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVP 557
           Y +  T V  AQ + LH   +         +S  E   RR+L+W  Y  D F +L+L  P
Sbjct: 518 YSIFATAVRFAQDMSLHNLDTY------KRLSYKECLKRRILWWHCYTTDKFLSLKLCKP 571

Query: 558 RLLKDHEIEC------ALPISENGHPGV----SLADQVIRLEGQ--------------VS 593
            L+ + ++         + I     P V       DQ+  +E                +S
Sbjct: 572 SLINERDMTVLTDESYVVLIKGQLLPQVGTDREAIDQITTIEEALRKLEEHCSFLPVFIS 631

Query: 594 EFSLSLLRF-SKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFE 648
            ++  L R  SKI  +       +G T        L  +N+L  W + LP ++  E
Sbjct: 632 YYTTKLARISSKIYYSFFTPTSLKGQTFDTMIDRVLEIKNSLSDWEKYLPGSIRLE 687

>CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON}
          similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256w HAP1 transcription factor
          Length = 1372

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV  +C  CR +K +CD  RP C+QC   G
Sbjct: 66 RVPLSCTICRRRKVKCDKSRPNCTQCVKTG 95

>KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa]
           {ON} weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 1040

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 22/36 (61%), Gaps = 1/36 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVS 104
           RV+  C  CR +KTRCD   P CS+C A+  EC  S
Sbjct: 70  RVSYVCYACRRRKTRCDRGNP-CSKCVALSTECVYS 104

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSDK 106
           RV ++C  CR +K++CD  +P CS C   G  EC+  D+
Sbjct: 21  RVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDR 59

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
           YGR288W (REAL)
          Length = 143

 Score = 39.7 bits (91), Expect = 0.009,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 1/42 (2%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           V QACD CR ++ +CDGK P C +C      C     L +R 
Sbjct: 37  VKQACDCCRVRRVKCDGKGP-CGRCLQRDLNCTYLQPLRKRG 77

>TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]
           {ON} Anc_6.75 YLR278C
          Length = 1530

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 23/43 (53%)

Query: 71  AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 113
           +++C  CR +K RCD K P C+ C   G +C    + S  A P
Sbjct: 38  SKSCLLCRRRKQRCDHKLPSCTACLKAGVKCVQPARYSNNAAP 80

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
           {ON} weakly similar to uniprot|P12383 Saccharomyces
           cerevisiae YGL013C PDR1 Zinc cluster protein that is a
           master regulator involved in recruiting other zinc
           cluster proteins to pleiotropic drug response elements
           (PDREs) to fine tune the regulation of multidrug
           resistance genes
          Length = 1082

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVS 104
           +V++ACD CR KK +C G  P C  C   G EC  S
Sbjct: 50  KVSRACDSCRKKKIKCSGTLP-CKSCETYGCECVYS 84

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL248C
           (GAL4)
          Length = 648

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           V QACD CR +K +C    P+C++C      C  S K+ R    R +
Sbjct: 5   VIQACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRRSPLTRAH 51

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R    C  CR++K RC+ +RP CS+C  +G  C
Sbjct: 10  RPTHVCAACRTQKLRCNRERPSCSRCQRIGRTC 42

>KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conserved
           hypothetical protein
          Length = 639

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 107
           R    C +C+S K +CD  +P C  C   GF+C  S  L
Sbjct: 12  RSYMGCQKCKSLKKKCDEVKPHCGYCKKRGFQCDYSRTL 50

>Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AGL233C
          Length = 926

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 23/34 (67%), Gaps = 1/34 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 101
           +V+++C  CR ++ +CD  RP+CS C + G  EC
Sbjct: 14  KVSKSCVFCRKRRVKCDKARPKCSTCVSKGLPEC 47

>CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256w HAP1 transcription factor
          Length = 1355

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 18 RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 47

>KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa]
          {ON} Anc_1.380 YLR256W
          Length = 1233

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 33 RIPLSCTICRKRKVKCDKIRPHCNQCTKTG 62

>Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 aa]
           {ON} YMR019W (REAL)
          Length = 911

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           RV +AC+ C+ +K +CDG RP C  C+    EC+   K + R   R
Sbjct: 41  RVQKACEICKRRKVKCDGNRP-CLNCSKHKKECRYDFKATNRRKKR 85

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
           similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
           cerevisiae YBR150c TBS1
          Length = 1049

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 69  RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 101
           R  +ACD CR +K RCD   P   +CS C     EC
Sbjct: 36  RSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVEC 71

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
            C  CRS+K +CD +RP C +C   G EC
Sbjct: 20  GCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48

>Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340)
          [3870 nt, 1290 aa]
          Length = 1289

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 22 RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 51

>CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184c
          Length = 835

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           RV +ACD CR +K +CDG +P CS C      C
Sbjct: 16  RVIRACDVCRKRKVKCDGDQP-CSSCMTASTVC 47

>YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON}
           PIP2Autoregulatory oleate-specific transcriptional
           activator of peroxisome proliferation, contains
           Zn(2)-Cys(6) cluster domain, forms heterodimer with
           Oaf1p, binds oleate response elements (OREs), activates
           beta-oxidation genes
          Length = 996

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRG 115
           R++  C  CR  KT+CD ++P+C +C      C + D ++R+A PR 
Sbjct: 20  RLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPRN 64

>Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa]
           {ON} YAL051W (REAL)
          Length = 1000

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRG 115
           R++  C  CR  KT+CD ++P+C +C      C + D ++R+A PR 
Sbjct: 20  RLSFVCQACRKAKTKCDQEKPRCGRCTKQNLFC-IYD-VARQAAPRN 64

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCDGK--RPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + ++ACD+CR KK +CD K  R  CS C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDERGVCSNCQRNGDRCSFERVPLKRGPSKGY 91

>ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]
           {ON} weakly similar to uniprot|P39961 Saccharomyces
           cerevisiae YER184C Hypothetical ORF
          Length = 724

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 105
           +V +AC  CR +K RCDG  P CS C ++  EC   D
Sbjct: 8   KVKRACQICRRRKIRCDGYLP-CSSCVSLKKECNYHD 43

>KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON} 
          Length = 1476

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          R+  +C  CR +K +CD  RP C+QC   G
Sbjct: 47 RIPLSCTICRKRKVKCDKTRPHCNQCTKTG 76

>TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON} 
          Length = 810

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 21/46 (45%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPR 114
           R  Q CDRCR  K +C G   QC+ C      C     L RR  P+
Sbjct: 38  RRDQVCDRCRKLKKKCYGLGRQCNNCQLSNNPCTTMATLKRRRKPK 83

>TBLA0D00630 Chr4 complement(164651..167884) [3234 bp, 1077 aa] {ON}
           Anc_7.389 YBL066C
          Length = 1077

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 3/40 (7%)

Query: 67  NYRVAQACDRCRSKKTRCDG--KRPQ-CSQCAAVGFECKV 103
           N+R   +C  CR +K RC+   K+PQ C++CA +  +C +
Sbjct: 24  NHRPVTSCTHCRQQKIRCNALQKQPQPCTRCAKLNLKCNI 63

>Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} similar
          to Ashbya gossypii AFR117C
          Length = 1198

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          R+  +C  CR +K RCD  +P C+QC   G
Sbjct: 14 RIPLSCTICRKRKVRCDKTKPHCTQCVKTG 43

>YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}
           MAL13MAL-activator protein, part of complex locus MAL1;
           nonfunctional in genomic reference strain S288C
          Length = 473

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           QACD CR ++ +CDGKRP CS C     +C
Sbjct: 11  QACDCCRIRRVKCDGKRP-CSSCLQNSLDC 39

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQ---CSQCAAVGFEC 101
           RV++ACD CR +K RCD   PQ   CS C      C
Sbjct: 131 RVSKACDHCRKRKIRCDEVDPQTDKCSNCVKFQSVC 166

>NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]
           {ON} Anc_7.17
          Length = 1022

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR  KT+CD ++P C++C      C
Sbjct: 41  RISFVCQECRKAKTKCDKEKPACTRCVKQNLAC 73

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
           {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
           YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
           fungal- type binuclear cluster domain DNA-binding
           transcriptional activator or CHA1 and some similarities
           to YOR337W uniprot|P47988 Saccharomyces cerevisiae
           YOR337W TEA1 Mutants are defective in Ty1
           Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 3/40 (7%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKV--SDKLSRR 110
           AC  CR K+ +CD +RP CS C   G EC    +DK ++R
Sbjct: 16  ACQNCRIKRRKCDMERP-CSNCLKYGIECITVNNDKRTKR 54

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
           274] FULL
          Length = 628

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  CD CR +K +C+ ++P CS+C     +C
Sbjct: 10  RISHVCDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene
           extends into a gap in the genome sequence
          Length = 729

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGF-EC 101
           + C  CR +K RCD  RP CS C A GF EC
Sbjct: 23  RTCTFCRQRKVRCDQGRPLCSSCKARGFSEC 53

>NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON}
          Anc_1.380 YLR256W
          Length = 1581

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV  +C  CR +K +CD  RP C QC   G
Sbjct: 61 RVPLSCTICRKRKVKCDKIRPHCQQCTKTG 90

>TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.59
           YHR178W
          Length = 877

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 23/39 (58%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           +C RCR  K +C  + P+CS C A  + C+   +L RR+
Sbjct: 97  SCSRCRRLKKKCLRQMPKCSNCVASHYACEYIGRLPRRS 135

>NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423
          Length = 775

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 21/39 (53%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
            CD C+ ++ +CD  +P C +C  +  EC  S    R+A
Sbjct: 57  GCDNCKRRRVKCDELKPTCQKCINMNLECVYSMPKPRKA 95

>NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON}
          Anc_1.380
          Length = 1478

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 17/30 (56%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV  +C  CR +K +CD  RP C QC   G
Sbjct: 38 RVPLSCTICRKRKVKCDKIRPHCQQCTKTG 67

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
           YJL206C (REAL)
          Length = 833

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 90/206 (43%), Gaps = 18/206 (8%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
             + + Y   G  +  A +  LHR  S V    G T  + E   R  LFW +Y LD++  
Sbjct: 291 ANLKACYSFIGIALRAALKEGLHRKSSIV----GPTPIQDETKKR--LFWSVYKLDLYMN 344

Query: 552 LQLGVPRLLKDHEIECALPISENGH----PGVSLAD-QVIRLEGQVSEFSLSLLRFSKIL 606
             LG P  + + +I+   P+  +       G+   D + I   G  ++ +  +L  S+I 
Sbjct: 345 CILGFPSGIDESDIDQEFPLDVDDENISTMGIKFQDWRTISSCGMNNKHTKLILIMSRIY 404

Query: 607 GNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLPKNLTFELDVNGTINMEELNSGSHW 666
             ++ S+ ++ +      Q+  +++  L++W   LP  L  +     TI   +    ++ 
Sbjct: 405 -KLMYSLRRKPLEEDSRSQIVSLNDQ-LENWYTQLPDILKVD-----TIRYRQPQPPANV 457

Query: 667 KKDYSTAPSCDNRTLMVLYFLVKCLV 692
             D S++P    + L+ L FL+  +V
Sbjct: 458 CADESSSPYTKPKKLLYLDFLLSKIV 483

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECK 102
           R  +AC  CR +K RC G+ P C  C    FECK
Sbjct: 29  RAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 61

>Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 810
           aa] {ON} ANNOTATED BY YGOB - Artificial frameshift
           joining KLLA0C03223g and KLLA0C03234g
          Length = 810

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 18/37 (48%)

Query: 71  AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 107
           AQ CDRCR  K +C G  P C  C      C V+  L
Sbjct: 49  AQVCDRCRKLKKKCYGTGPSCVNCVVTNNPCTVTTTL 85

>Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W
           (REAL)
          Length = 831

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK--LSRRAFPRGY 116
           R+   C +C+  K +CD  RP CS+C     ECK  D   LS +    G+
Sbjct: 10  RLRLVCLQCKRIKRKCDKLRPVCSRCQQHSLECKYEDSADLSSKVIASGF 59

>SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1244

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11 RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 21/37 (56%), Gaps = 1/37 (2%)

Query: 70  VAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSD 105
           + + C  CR KK +CD +RP CS C A  F EC   D
Sbjct: 78  IIKTCLFCREKKLKCDKRRPLCSSCIARNFTECVYVD 114

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1148

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 3/36 (8%)

Query: 69  RVAQACDRCRSKKTRCDGKRP---QCSQCAAVGFEC 101
           RV++ACDRCR +K +CD   P   +CS C      C
Sbjct: 29  RVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPC 64

>Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723
          bp, 1240 aa] {ON} ANNOTATED BY YGOB -
          Length = 1240

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11 RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {ON}
           Anc_4.113
          Length = 1118

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
           +V +ACD CR +K +C GK P C+ C A    C  S +  R+
Sbjct: 58  KVTKACDNCRRRKIKCTGKTP-CATCEAYQCLCIYSTQRGRK 98

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2.547
           YKL038W
          Length = 1088

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCDG--KRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + ++ACD+CR KK +CD    R  C+ C   G +C       +R   +GY
Sbjct: 58  KASRACDQCRKKKVKCDNGDDRSVCTNCQRNGEKCTFERVPLKRGPSKGY 107

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {ON}
           Anc_8.423 YLR228C
          Length = 730

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRR 110
            CD C+ ++ +CD  +P C +CA +  EC  +    RR
Sbjct: 33  GCDNCKRRRVKCDEGKPFCQKCANMRLECVFTPPQPRR 70

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
           YML099C
          Length = 835

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 22/41 (53%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFP 113
            C  CRS+K +CD +RP C +C   G +C   D   R + P
Sbjct: 27  GCWTCRSRKVKCDLQRPNCGRCEKSGLDCGGYDIKLRWSNP 67

>KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly
           similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 880

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 21/34 (61%)

Query: 68  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           Y+++  C  CR  KT+CD K+P C++C  +   C
Sbjct: 15  YKLSFVCQLCRKSKTKCDRKKPSCARCQRLNKPC 48

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSDKLS 108
           ++C  CR +K +CD  +P CS C A  F EC  SD ++
Sbjct: 33  KSCSFCRRRKLKCDKSKPLCSTCRARNFTECIYSDAIN 70

>Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON}
           YER184C (REAL)
          Length = 793

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 67  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           N RV++AC+RC  KK +CD K+P C  CA    +C
Sbjct: 11  NSRVSKACERCHRKKIKCDSKKP-CFGCAGSRSKC 44

>Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON}
           complement(3488..5758) [2271 nt, 757 aa]
          Length = 756

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%)

Query: 71  AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           A +C RCR  K +C  +RP C+ C   G  C    +  RR+
Sbjct: 40  AYSCSRCRKLKRKCQKQRPSCANCMNAGATCNYPGRAPRRS 80

>AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR256W
          (HAP1)
          Length = 1152

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV  +C  CR +K +CD  RP C+QC   G
Sbjct: 14 RVPLSCTICRKRKVKCDKTRPHCNQCTKTG 43

 Score = 38.9 bits (89), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 9/74 (12%)

Query: 500 LRGTIVSMAQQLRLHRCP-------SAVLGTEGSTMSKSEQGDR--RLLFWGIYYLDVFS 550
           L  +IV MA    LHR P       S +L T   T++ +E+     R +++ I  LD+  
Sbjct: 467 LLSSIVQMAFSCGLHRDPDNFPQLSSTLLKTTKDTITNTERLKHTWRKMWYFILSLDIQQ 526

Query: 551 ALQLGVPRLLKDHE 564
           +L LG PRLL++H+
Sbjct: 527 SLSLGSPRLLRNHK 540

>KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa]
          {ON} similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1237

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11 RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
           {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + ++ACD+CR KK +CD    R  C+ C  +G  C       +R   +GY
Sbjct: 50  KASRACDQCRRKKIKCDYNDMRNICTNCQRIGERCSFERVPLKRGPTKGY 99

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL038W
           (REAL)
          Length = 1169

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCDGK--RPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + ++ACD+CR KK +CD K  R  C+ C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDERGVCTNCQRNGDRCSFERVPLKRGPSKGY 91

>SAKL0H00616g Chr8 (73754..75934) [2181 bp, 726 aa] {ON} some
           similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 726

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 40/179 (22%), Positives = 79/179 (44%), Gaps = 34/179 (18%)

Query: 492 GEVSSVYELRGTIVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSA 551
           G   + + +  + + +AQ L LH    + +  EG  +SK E   RR ++W   + D   A
Sbjct: 317 GAFHNSFMMVSSAIRLAQDLGLH----SEVTFEG--LSKEEAQKRRKVWWLCLFFDQRLA 370

Query: 552 LQLGVPRLLKDHEIECALPISENGHPGVSLADQ-----------------------VIRL 588
           + LG P ++ ++++    P     +  + L DQ                       V+R 
Sbjct: 371 VVLGRPPVVAEYDMTTRFP---EANKKLKLLDQVTLSSSTTAKDYDEDFAQKMFDIVLRS 427

Query: 589 EGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHE--NALDSWRRGLPKNL 645
           EG V+  +  + + SK+ G I   ++   + +   +QV +I++  N L +++  +PK L
Sbjct: 428 EGFVTLSAHYINKLSKMTGRIYIELYSASIINGSVEQVKIINKLLNDLSTFKLSIPKTL 486

>TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1.380
           YLR256W
          Length = 1429

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFE 100
           R+  +C  CR +K +CD   P C+QC   G +
Sbjct: 40  RIPLSCTICRKRKVKCDKTHPHCNQCVKTGVQ 71

>YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc
          finger transcription factor involved in the complex
          regulation of gene expression in response to levels of
          heme and oxygen; the S288C sequence differs from other
          strain backgrounds due to a Ty1 insertion in the
          carboxy terminus
          Length = 1502

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          R+  +C  CR +K +CD  RP C QC   G
Sbjct: 59 RIPLSCTICRKRKVKCDKLRPHCQQCTKTG 88

>Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {ON}
           YGL013C (REAL)
          Length = 1000

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106
           +V++ACD CR +K +C+GK P C+ C     EC  + +
Sbjct: 38  KVSKACDNCRKRKIKCNGKFP-CASCEIYLCECTFTTR 74

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 536 RRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALP 570
           RR L+W  YY +   A +LG P  + D +I C LP
Sbjct: 519 RRSLWWKAYYFEKTLASKLGYPSNIDDSKINCLLP 553

>Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052W
           (REAL)
          Length = 473

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 72  QACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           QACD CR ++ +CDGK+P C++C     +C     L +R 
Sbjct: 11  QACDCCRVRRVKCDGKKP-CNRCLQHDLKCTYLQPLRKRG 49

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
           similar to uniprot|P36023 Saccharomyces cerevisiae
           YKR064W
          Length = 657

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 22/44 (50%)

Query: 68  YRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRA 111
           +R    C  CR +KT+CD  +P CS C  +G  C  S+     A
Sbjct: 15  HRPTLVCLNCRRRKTKCDRGKPSCSNCLKLGETCVYSEDTDENA 58

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
           RGT1Glucose-responsive transcription factor that
           regulates expression of several glucose transporter
           (HXT) genes in response to glucose; binds to promoters
           and acts both as a transcriptional activator and
           repressor
          Length = 1170

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQ--CSQCAAVGFECKVSDKLSRRAFPRGY 116
           + ++ACD+CR KK +CD K  +  CS C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRCSFDRVPLKRGPSKGY 91

>KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} similar
           to uniprot|Q758X5 Ashbya gossypii ADR403C ADR403Cp and
           weakly similar to YAL051W uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 975

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R++  C  CR  KT+CD ++P+C +C     +C
Sbjct: 30  RISFVCQACRKNKTKCDREKPRCGRCVKYHLKC 62

>ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YAL051W
           (OAF1) and YOR363C (PIP2); Tandem gene triplication in
           this genome
          Length = 875

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           +++  C  CR  KT+CD  +P CS+CA +G  C
Sbjct: 19  KLSYVCIPCRKCKTKCDKLKPTCSRCAELGLYC 51

>NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON}
           Anc_8.423
          Length = 948

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRG 115
            CD C+ ++ +CD  +P C +C  +   C V   L  R  P+G
Sbjct: 62  GCDNCKKRRVKCDEVKPSCKKCTNMQLTC-VYSPLQPRKRPKG 103

>ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]
           {ON} similar to gnl|GLV|KLLA0D10153g Kluyveromyces
           lactis KLLA0D10153g and weakly similar to uniprot|P35995
           Saccharomyces cerevisiae YKL222C Hypothetical ORF
          Length = 648

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%)

Query: 71  AQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKL 107
           ++ C  C+ KK RCD K P C+ C+  G+ C  + K+
Sbjct: 8   SKTCTNCQRKKVRCDRKVPACTACSERGYNCIYNVKI 44

>NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {ON} 
          Length = 909

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 20/38 (52%), Gaps = 3/38 (7%)

Query: 67  NYRVAQ---ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           NYR A+    C  CRSKK +CD  RP C +C      C
Sbjct: 5   NYRKARPSFVCLVCRSKKVKCDKARPSCGRCRKTNKLC 42

>CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {ON}
           similar to uniprot|Q12151 Saccharomyces cerevisiae
           YDR213w UPC2
          Length = 844

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
            CD C+ ++ +CD  +P C +C  +  EC
Sbjct: 53  GCDHCKRRRVKCDEGKPMCDKCVKMKLEC 81

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCD--GKRPQCSQCAAVGFECKVSDKLSRRAFPRGY 116
           + ++ACD+CR KK +CD   ++  CS C   G +C       +R   +GY
Sbjct: 70  KASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFERVPLKRGPSKGY 119

>KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON} 
          Length = 791

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 67  NYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           ++RV++AC+ CR +K +C+G +P CS+C      C
Sbjct: 17  SHRVSRACNSCRKRKVKCNGVQP-CSKCITSNLRC 50

>TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON} 
          Length = 722

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF-ECKVSDKLSRRA 111
           +  ++C  CR +K RCD K+P+CS C A    EC  S  L   A
Sbjct: 8   KAIKSCAFCRRRKLRCDQKKPRCSTCVARNLAECVYSQGLQHNA 51

>ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]
           {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
           AFR171Wp and some similarites with YDR034C
           uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 653

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 21/29 (72%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
            C+ C+ +K +CD ++P+C QC+ +G +C
Sbjct: 20  GCNECKKRKVKCDEQKPECWQCSHLGKKC 48

>NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {ON}
           Anc_4.113
          Length = 1043

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVS 104
           +V++ACD CR +K +C GK+P C+ C A    C  S
Sbjct: 43  KVSKACDNCRKRKIKCTGKQP-CATCEAYQCPCIYS 77

>Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON}
           (126243..128966) [2724 nt, 908 aa]
          Length = 907

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 73  ACDRCRSKKTRCDGKRPQCSQCAAVGFECK 102
            C  CRS+K +CD  RP+C +C  +G  C+
Sbjct: 16  GCWTCRSRKVKCDLNRPKCQRCDRLGIICE 45

>Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}
           YER184C (REAL)
          Length = 170

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK 106
           RV++AC+RCR KK +CD K+P C  C     +C+  ++
Sbjct: 13  RVSKACERCRRKKVKCDSKKP-CFGCIGSQSKCRYKNQ 49

>Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF}
          YLR256W (HAP1) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          78] PARTIAL
          Length = 629

 Score = 40.4 bits (93), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          RV  +C  CR +K +CD  RP C QC+  G
Sbjct: 11 RVPLSCTICRKRKVKCDKTRPHCQQCSKTG 40

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON} 
          Length = 881

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFEC 101
           R    C  C+S+K RC+  RP CS+C  +G  C
Sbjct: 30  RTVSVCIPCKSQKLRCNKARPICSRCQRLGKHC 62

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2.654
           YKL015W
          Length = 1037

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 61/128 (47%), Gaps = 5/128 (3%)

Query: 524 EGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISEN-GHPGVSLA 582
           +  T+S+ E   RR L+W +Y  +   + + G+P    D+ I   LP + N       LA
Sbjct: 627 QSDTLSRCEVEHRRRLWWTVYMFERMLSSKAGLPLSFTDNTISTELPSNINCAQDNDILA 686

Query: 583 DQVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRRGLP 642
                +E      S+ +++   I G IL  +++R  +S+I   +  I +  L+ W+  +P
Sbjct: 687 KYYYYVEAAYIGESVKIVQ---INGQILSKLYQRQPSSNILPILKDILKQLLN-WKSNVP 742

Query: 643 KNLTFELD 650
           ++L  + +
Sbjct: 743 ESLQVDFN 750

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 1/37 (2%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSD 105
           ++ +AC RCR +  +C G  P C +C      CK S+
Sbjct: 54  KITRACIRCRERHIKCPGNDP-CQKCLEANHICKFSE 89

>ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON}
          similar to uniprot|P12351 Saccharomyces cerevisiae
          YLR256W HAP1
          Length = 1244

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          R+  +C  CR +K +CD  RP C QC+  G
Sbjct: 30 RIPLSCTICRKRKVKCDKTRPNCEQCSKTG 59

>Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQ--CSQCAAVGFECKVSDKLSRRAFPRGY 116
           + ++ACD+CR KK +CD K  +  CS C   G  C       +R   +GY
Sbjct: 42  KASRACDQCRKKKIKCDYKDEKGLCSNCQRNGDRCSFERVPLKRGPSKGY 91

>KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.565
           YMR019W
          Length = 707

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 25/47 (53%), Gaps = 2/47 (4%)

Query: 69  RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDK-LSRRAFPR 114
           RV +ACD C+ +K +CDG  P CS C     +C    +  + R  PR
Sbjct: 11  RVQKACDICKRRKVKCDGLSP-CSNCIRHNVDCTYDYRTFASRKKPR 56

>Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON}
          YLR256W (REAL)
          Length = 1503

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 69 RVAQACDRCRSKKTRCDGKRPQCSQCAAVG 98
          R+  +C  CR +K +CD  RP C QC   G
Sbjct: 58 RIPLSCTICRKRKVKCDKFRPHCQQCTKTG 87

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 111,273,024
Number of extensions: 4421001
Number of successful extensions: 13552
Number of sequences better than 10.0: 625
Number of HSP's gapped: 13771
Number of HSP's successfully gapped: 717
Length of query: 1206
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1085
Effective length of database: 39,606,813
Effective search space: 42973392105
Effective search space used: 42973392105
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)