Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03740g8.846ON25423712721e-179
Kwal_27.102278.846ON2542377591e-101
SAKL0D01320g8.846ON2602386082e-78
ABL120W8.846ON2492355092e-63
KLLA0D01430g8.846ON2632435083e-63
NCAS0C003808.846ON2762485042e-62
Ecym_46178.846ON2492354987e-62
KNAG0J002408.846ON2862584861e-59
NDAI0K003308.846ON3132844708e-57
KAFR0B039608.846ON2782564521e-54
Smik_13.4948.846ON3042714435e-53
YMR281W (GPI12)8.846ON3042424411e-52
Skud_13.4538.846ON3002684374e-52
TDEL0B005208.846ON2682474302e-51
TPHA0I002808.846ON3012504313e-51
Suva_13.4708.846ON3032454313e-51
ZYRO0G14300g8.846ON2802594285e-51
Kpol_1068.48.846ON2912653991e-46
CAGL0M03047g8.846ON3042733905e-45
TBLA0B033008.846ON3192963821e-43
KAFR0I014104.28ON101692721.3
KLTH0E16456g8.877ON56399674.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03740g
         (254 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   494   e-179
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   296   e-101
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   238   2e-78
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   200   2e-63
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   200   3e-63
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   198   2e-62
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   196   7e-62
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   191   1e-59
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   185   8e-57
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   178   1e-54
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   175   5e-53
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   174   1e-52
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   172   4e-52
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   170   2e-51
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   170   3e-51
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   170   3e-51
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   169   5e-51
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   158   1e-46
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   154   5e-45
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   151   1e-43
KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4....    32   1.3  
KLTH0E16456g Chr5 (1458414..1460105) [1692 bp, 563 aa] {ON} simi...    30   4.4  

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  494 bits (1272), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 237/237 (100%), Positives = 237/237 (100%)

Query: 18  YFASSARIKASNEQAFTTLFSVLNPTSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPVS 77
           YFASSARIKASNEQAFTTLFSVLNPTSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPVS
Sbjct: 18  YFASSARIKASNEQAFTTLFSVLNPTSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPVS 77

Query: 78  VFSLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDGMKVEWDLQKTSEALRKQ 137
           VFSLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDGMKVEWDLQKTSEALRKQ
Sbjct: 78  VFSLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDGMKVEWDLQKTSEALRKQ 137

Query: 138 VVGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTSKRSIFQKYTAFVPS 197
           VVGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTSKRSIFQKYTAFVPS
Sbjct: 138 VVGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTSKRSIFQKYTAFVPS 197

Query: 198 LITVLRGSRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANEVREF 254
           LITVLRGSRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANEVREF
Sbjct: 198 LITVLRGSRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANEVREF 254

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  296 bits (759), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 178/237 (75%)

Query: 18  YFASSARIKASNEQAFTTLFSVLNPTSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPVS 77
           Y   S +I+ SN +A  +LF    PTSINLVIAHPDDEVMFFAPTLLQ+D +    I V+
Sbjct: 18  YILGSVQIERSNRRALGSLFRGSAPTSINLVIAHPDDEVMFFAPTLLQIDEWLPGSIEVN 77

Query: 78  VFSLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDGMKVEWDLQKTSEALRKQ 137
           V SLTDGGADGLG LR +EL+D V LL R+RKA V VL+F DGM VEWDL++  +AL+++
Sbjct: 78  VISLTDGGADGLGDLRTKELQDCVRLLLRKRKASVEVLDFLDGMDVEWDLERAVKALQER 137

Query: 138 VVGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTSKRSIFQKYTAFVPS 197
           ++ + PLFLTFD++G+S H+NHISCY+ V+ +R  + +S  F L SKR +F+KY+ F+P+
Sbjct: 138 ILDESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCFKLVSKRYLFEKYSGFIPA 197

Query: 198 LITVLRGSRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANEVREF 254
           L      S  +  +++F+QYLLALS MMNAH SQMVWFRYGWW FS YV+ANE++ F
Sbjct: 198 LFHSFISSSPSTLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLFSYYVYANELQAF 254

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  238 bits (608), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 118/238 (49%), Positives = 148/238 (62%), Gaps = 4/238 (1%)

Query: 18  YFASSARIKASNEQAFTTLFSVLNPTSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPVS 77
           Y   S RI A N Q F  +F    PTS+NL++AHPDDE MFF+PTLLQL   +   +P+ 
Sbjct: 21  YICVSQRIAAHNRQVFRNVFPSRTPTSVNLIVAHPDDETMFFSPTLLQLHVNYPPSVPLR 80

Query: 78  VFSLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDGMKVEWDLQKTSEALRKQ 137
           V  LT+G ADGLG +RE+ELR S+ LL   R   V V  FEDGM VEWD ++    + + 
Sbjct: 81  VICLTNGDADGLGAVREQELRLSMQLLLPARNTSVIVEGFEDGMGVEWDTRQVVATINRH 140

Query: 138 VVGDQPLFLTFDDHGVSSHINHISCYETVRNL--RAAHPESR--SFSLTSKRSIFQKYTA 193
           V    PL LTFD+HGVS H+NH+SC   V  L  +    E R  +  L SKR    KY +
Sbjct: 141 VSDASPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRFTALYLNSKRYFPPKYGS 200

Query: 194 FVPSLITVLRGSRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANEV 251
           F   L  ++ G +  VFMSTF QYLL+L+ M NAH SQMVWFR+GWW  S +VF NE+
Sbjct: 201 FAVDLARIITGRQPPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  200 bits (509), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 112/235 (47%), Positives = 143/235 (60%), Gaps = 7/235 (2%)

Query: 18  YFASSARIKASNEQAFTTLFSVLNP-TSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPV 76
           Y  S  R++  N Q F  L    +  TS+ LVIAHPDDEVMFFAPTLLQLD      +P 
Sbjct: 19  YCWSRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPTLLQLDARLPAWMPF 78

Query: 77  SVFSLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDGMKVEWDLQKTSEALRK 136
            V  LTDGGA+GLG+LR  EL+ ++ LL       + V +F DGMK +WDL +    L +
Sbjct: 79  RVVCLTDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFTDGMKEDWDLAEVRTRLGE 138

Query: 137 QVVGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTSKRSIFQKYTAFVP 196
            V   +PL LTFD+ GVS H NHI C      L AA    ++  L S+R++ +KY+ FV 
Sbjct: 139 LVTDAKPLVLTFDERGVSGHRNHIGC-----ALAAARLGHKTLFLRSERNLLRKYSFFVL 193

Query: 197 SLITVLRGS-RQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANE 250
            +  V+ G+    VF+ST  QYL AL  M+ AH SQMVWFR+GWW  S YV+ANE
Sbjct: 194 DVFRVVFGTPPPTVFVSTLAQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANE 248

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  200 bits (508), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 109/243 (44%), Positives = 138/243 (56%), Gaps = 13/243 (5%)

Query: 18  YFASSARIKASNEQAFTTLFS---VLNPTSINLVIAHPDDEVMFFAPTLLQLDHYFDTDI 74
           Y   +  IK  N   F  L S   V   TS+ LV+AHPDDEVMFF+PTL Q +      I
Sbjct: 21  YGCLTKTIKEHNRWYFHELVSESMVSKLTSVTLVVAHPDDEVMFFSPTLTQFNELLPISI 80

Query: 75  PVSVFSLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDGMKVEWDLQKTSEAL 134
           P++V  +T G ADGLG +R++EL DS+ ++F  R+    VL+FEDGM   WD     + L
Sbjct: 81  PINVVCMTAGDADGLGHIRKQELVDSLRIMFHGRQFGCDVLDFEDGMDAVWDQVLLEKQL 140

Query: 135 RKQVVGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTSKRSIFQKYTAF 194
           R  +    PL LTFD  GVS HINHISC   V  L    P S    L S + I+ KY+AF
Sbjct: 141 RSSIPDSNPLVLTFDQFGVSGHINHISCGRLVEKL----PYSHKLHLRSDQPIYVKYSAF 196

Query: 195 VPSLITVLRGS------RQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFA 248
           +  +  +   +      +   F+ST  QYLLA S M  AHTSQMVWFR GWW FS + F 
Sbjct: 197 IAGIFQLGISTVYPDYGKPRCFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFI 256

Query: 249 NEV 251
           NE+
Sbjct: 257 NEL 259

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  198 bits (504), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 150/248 (60%), Gaps = 19/248 (7%)

Query: 21  SSARIKASNEQAFTTLFSVL--NPTSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPVSV 78
           SS RI+  N   ++ L + +    T++NLVIAHPDDEVMFFAPTLLQLD+     IP++V
Sbjct: 29  SSNRIEQFNTLNYSQLNTKIFHEGTTLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINV 88

Query: 79  FSLTDGGADGLGKLREEELRDSVHLLFR-RRKAEVTVLNFEDGMKVEWDLQKTSEALRKQ 137
              ++G A GLG+ R+ EL+ S+H L + +R+  VTVL+F+DG    WD+ + ++ L + 
Sbjct: 89  ICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQ- 147

Query: 138 VVGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTS-KRSIFQKYTAFVP 196
              D   FLTFD HGVS H NHI+C+  V NL+  +      +L S   S+  KYT F+ 
Sbjct: 148 --NDHQAFLTFDSHGVSGHKNHIACHNAVWNLKNTNNNVTILTLDSIHHSLLAKYTFFII 205

Query: 197 SLITVL------------RGSRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSC 244
            L+ +                 +  F + + QY+LA S M+NAH SQ+VWFRYGWW FS 
Sbjct: 206 DLVKLYWNLWKDQQQPQWESHDKITFFNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSR 265

Query: 245 YVFANEVR 252
           +VF+N ++
Sbjct: 266 FVFSNHLK 273

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  196 bits (498), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 107/235 (45%), Positives = 138/235 (58%), Gaps = 7/235 (2%)

Query: 18  YFASSARIKASNEQAFTTLF-SVLNPTSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPV 76
           Y  S   ++  N + +  L  S  N TS+ L+IAHPDDEVMFFAPTLLQLD      +P 
Sbjct: 19  YCGSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPTLLQLDARMAQSVPF 78

Query: 77  SVFSLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDGMKVEWDLQKTSEALRK 136
            V  LTDG ADGLG++R  EL  ++ LL   R  E+ +  F+DGM  EW ++   E L +
Sbjct: 79  RVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFKDGMDEEWKMEVVREELAQ 138

Query: 137 QVVGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTSKRSIFQKYTAFVP 196
            V   +PL LTFD+ GVS H NHI+C        AA     +  L S  ++ +KY+ F  
Sbjct: 139 VVTDRRPLVLTFDERGVSGHRNHIACAHA-----AAKLGHHTLHLDSGHNLIRKYSFFFV 193

Query: 197 SLITVLRG-SRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANE 250
            L  +L G     VF+STF QYL +L  M+ AH SQMVWFR+GWW  S YV+ANE
Sbjct: 194 DLFRLLFGYPMPTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANE 248

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  191 bits (486), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 153/258 (59%), Gaps = 27/258 (10%)

Query: 19  FASSARIKASNEQAFTTLFSVLNPTSINLVIAHPDDEVMFFAPTLLQLDHYF-DTDIPVS 77
           +AS+++I + N     TL    +  S+NLVIAHPDDEVMFFAP+L+ L+    D     +
Sbjct: 26  YASTSKIGSFNYTNLETL-GEHDINSVNLVIAHPDDEVMFFAPSLINLNEQIRDPSTVFN 84

Query: 78  VFSLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDGMKVEWDLQKTSEALRKQ 137
           +   ++GGADGLG +RE+EL DS+ +L   R   + VL+F+DGMK +WD+++    LR  
Sbjct: 85  IICFSNGGADGLGNVREQELSDSIAMLLPTRNTSIVVLDFKDGMKEKWDVKEMIAKLRNI 144

Query: 138 V--VGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTS----KRSIFQKY 191
           V  +G   L LTFD  GVS H+NHI+CY             +  ++ S     ++I +KY
Sbjct: 145 VPKLGHNVL-LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLTVLSLQSYSKNIVKKY 203

Query: 192 TAFVPSLITVL---------------RGS---RQAVFMSTFKQYLLALSVMMNAHTSQMV 233
           ++++  LI +L               RGS   R+    ST+ QY+L+L+ M+NAH +Q+V
Sbjct: 204 SSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITIFSTYPQYVLSLAAMLNAHKTQVV 263

Query: 234 WFRYGWWFFSCYVFANEV 251
           WFRYGWWFFS  VF N++
Sbjct: 264 WFRYGWWFFSRLVFVNDL 281

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  185 bits (470), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 105/284 (36%), Positives = 160/284 (56%), Gaps = 52/284 (18%)

Query: 18  YFASSARIKASNEQAFTTLFSVLNP---------------TSINLVIAHPDDEVMFFAPT 62
           Y  S+ +I + N+++F    SVLN                T ++LVIAHPDDE+MFFAPT
Sbjct: 23  YMISTQKISSYNKKSFDN--SVLNQILRQDHSHADISEPITQLSLVIAHPDDELMFFAPT 80

Query: 63  LLQLDHYFDTDIPVSVFSLTDGGADGLGKLREEELRDSVHLLF---RRRKAEVTVLNFED 119
           LLQL+ +  T IP ++   +DG A+GLG LR +EL DS++LL      RK  +++L+F D
Sbjct: 81  LLQLNRFLPTSIPFNIICFSDGDAEGLGYLRRKELHDSINLLLSSSNNRKINISILDFID 140

Query: 120 GMKVEWDLQKTSEALRKQVVGDQP------LFLTFDDHGVSSHINHISCYETVRNL---- 169
           GM   WD ++   +L+ +++ + P      + LTFD +G+S+H NHI+C + V +L    
Sbjct: 141 GMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGISNHPNHIACNKAVHDLISYD 200

Query: 170 --RAAHPESRSFSLTSKR-------SIFQKYTAFVPSLITVL-------------RGSRQ 207
             +          L+SK        ++  KYT FV  L+ V                S +
Sbjct: 201 GGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVKVYWNLATGTFNTIPNSASLE 260

Query: 208 AVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANEV 251
             F++T+ QY+L+ + M+N H SQMVWFRYGWW+FS +VF+N++
Sbjct: 261 LSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWFSRFVFSNDL 304

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  178 bits (452), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 96/256 (37%), Positives = 141/256 (55%), Gaps = 20/256 (7%)

Query: 18  YFASSARIKASNEQAFTTLFSVL-----NPTSINLVIAHPDDEVMFFAPTLLQLDHYFDT 72
           Y   S +I+ SN+Q   T    L     N  S+ LV+AHPDDEVMFF+PTLLQLD +   
Sbjct: 22  YIVLSPKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDDEVMFFSPTLLQLDSHLPP 81

Query: 73  DIPVSVFSLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFEDGMKVEWDLQKTSE 132
           +   ++ S +DG A+GLG LR  EL  S+ +L  RR  E+ + N  DGM   WD +    
Sbjct: 82  NCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKEIFIFNHTDGMNEVWDNKLMLH 141

Query: 133 ALRKQVVGDQP-LFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSL---TSKRSIF 188
            L   +   Q  + LTFD  GVS+HINH +C++ V +   +H ++ +F+L   +   ++ 
Sbjct: 142 QLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQSHAKN-NFALLLDSYSSNLL 200

Query: 189 QKYTAFVPSLI----------TVLRGSRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYG 238
           +KYT F   L+            L         + +  Y+ A + M+ AH SQMVWFRYG
Sbjct: 201 KKYTGFAWQLVFLAKNYWIHGKTLPNLDHLALFNPYSDYITAYATMLKAHKSQMVWFRYG 260

Query: 239 WWFFSCYVFANEVREF 254
           WWFFS +V+ N+++ +
Sbjct: 261 WWFFSRFVYVNDLKLY 276

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  175 bits (443), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 101/271 (37%), Positives = 144/271 (53%), Gaps = 39/271 (14%)

Query: 18  YFASSARIKASNEQAFTTLF-SVLNPTSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPV 76
           Y   + +I + N ++   +F +  +   INL+IAHPDDEVMFF+P + QL  YF   +P 
Sbjct: 29  YIYFTPKIISRNNESLQHVFPNKYSDYQINLIIAHPDDEVMFFSPMISQLHSYFPNTVPF 88

Query: 77  SVFSLTDGGADGLGKLREEELRDSVHLLFRRRKA-EVTVLNFEDGMKVEWDLQKTSEALR 135
           ++  L+ G A+GLG+ R  EL DS  LL    +A  V V++F+DGM   WD+   +  L 
Sbjct: 89  NIICLSKGNAEGLGQTRVRELNDSAALLLHNERAVSVQVMDFQDGMNEVWDIDSITSTL- 147

Query: 136 KQVVGD-----QPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRS------------ 178
            Q +G        + +TFD +GVS HINH SC+  VR L A +  S              
Sbjct: 148 SQTIGINNNELNQIIVTFDSYGVSGHINHKSCHTAVRKLIADYTRSNVRKEVKTPLITAL 207

Query: 179 FSLTSKRSIFQKYTAFV-------PSLITVLRGSRQA------------VFMSTFKQYLL 219
           +  + K +I  KY +F+         LI+  R + QA            + M+T  QY+L
Sbjct: 208 YLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQALPSDVVAEKNSLLLMNTHAQYIL 267

Query: 220 ALSVMMNAHTSQMVWFRYGWWFFSCYVFANE 250
           A + M+NAH SQ+VWFRYGWW  S +VF NE
Sbjct: 268 AFAAMLNAHKSQVVWFRYGWWILSRFVFVNE 298

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  174 bits (441), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 96/242 (39%), Positives = 140/242 (57%), Gaps = 36/242 (14%)

Query: 45  INLVIAHPDDEVMFFAPTLLQLDHYFDTDIPVSVFSLTDGGADGLGKLREEELRDSVHLL 104
           INLVIAHPDDEVMFF+P + QL+ YF   +P ++  L+ G A+GLG+ R  EL +S  LL
Sbjct: 57  INLVIAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGETRVRELNESAALL 116

Query: 105 FRRRKA-EVTVLNFEDGMKVEWDLQKTSEALRKQV-VGDQPL---FLTFDDHGVSSHINH 159
               +A  V V++F+DGM   WD+   + +L +++ + +  L    +TFD +GVS+HINH
Sbjct: 117 LHNERAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINH 176

Query: 160 ISCYETVRNL--RAAHPESRS----------FSLTSKRSIFQKYTAFVPSLITVL----- 202
            SCY  V+ L    A P+++           +  + K +I  KY +F+  ++ +L     
Sbjct: 177 KSCYAAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLIS 236

Query: 203 --RGSRQAV------------FMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFA 248
             R   QA+             M+T  QY+LA + M+NAH SQ+VWFRYGWW FS +VF 
Sbjct: 237 PFRRIIQALPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFV 296

Query: 249 NE 250
           NE
Sbjct: 297 NE 298

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  172 bits (437), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 98/268 (36%), Positives = 145/268 (54%), Gaps = 35/268 (13%)

Query: 18  YFASSARIKASNEQAFTTLFSVLNPTS-INLVIAHPDDEVMFFAPTLLQLDHYFDTDIPV 76
           Y   + +I + N++    +F   N  S INLVIAHPDDEVMFF+P + QL  YF   +P 
Sbjct: 27  YIFFTPKIISRNDELLQHVFPHKNRDSQINLVIAHPDDEVMFFSPVISQLHSYFPITVPF 86

Query: 77  SVFSLTDGGADGLGKLREEELRDSVHLLFR-RRKAEVTVLNFEDGMKVEWDLQKTSEALR 135
           ++  L+ G ADGLG+ R +EL  S  LL +  R   V V++FEDGM   WD+      + 
Sbjct: 87  NIICLSKGNADGLGESRVKELNGSAALLLQNERPVSVQVMDFEDGMDEVWDINSIVSTIS 146

Query: 136 KQV-VGDQPL---FLTFDDHGVSSHINHISCYETVRNLRAAHPESRS------------F 179
           + + + ++ L    +TFD +GVS HINH SC+  V+ L   + ES++            +
Sbjct: 147 QTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVKRLIDRYAESKAETNEETPHITALY 206

Query: 180 SLTSKRSIFQKYTAFVPSLITVLRG-----------------SRQAVFMSTFKQYLLALS 222
             + K +I  KY +F+  ++ +L                     + + M+T  QY+LA +
Sbjct: 207 LKSYKNNIVLKYNSFIWEILKILYSVIVPFPKTIQPPTTTTQRSKLLLMNTHAQYVLAYA 266

Query: 223 VMMNAHTSQMVWFRYGWWFFSCYVFANE 250
            M+NAH SQ+VWFRYGWW  S +VF NE
Sbjct: 267 AMLNAHKSQVVWFRYGWWILSRFVFVNE 294

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  170 bits (430), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 98/247 (39%), Positives = 146/247 (59%), Gaps = 16/247 (6%)

Query: 18  YFASSARIKASNEQAFTTLFSVLN-PTSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPV 76
           Y A +ARI   NE  +    + +  P S+ L+IAHPDDEVMFF+P+LLQLD      +  
Sbjct: 21  YVALTARINGRNEVQWQQHAAAIGTPESLTLLIAHPDDEVMFFSPSLLQLDRLLPQSVRF 80

Query: 77  SVFSLTDGGADGLGKLREEELRDSVHLLF--RRRKAEVTVLNFEDGMKVEWDLQKTSEAL 134
           +   L+ G AD LG+ RE EL+ S++LL    +RK ++   ++ DG   +W+++     +
Sbjct: 81  NFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQLYQFDYPDGFDEKWEIESVVSIV 140

Query: 135 RKQV-VGDQ-PLFLTFDDHGVSSHINHISCYETV-RNLRAAHPESRSFSLTS-KRSIFQK 190
             +V +G    L LTFD HGVS+H NH++C+  V R +   H   ++  L S  R++  K
Sbjct: 141 ESKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARLIEKGH---KALYLNSHSRNLPLK 197

Query: 191 YTAFVPSLITVLRGSRQAV------FMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSC 244
           Y+ F+  LI +L  S   +      FM++F QY+LA + M NAH SQ+VWFRYGWW  S 
Sbjct: 198 YSGFIWELIRMLSDSVMKLERTGLTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSR 257

Query: 245 YVFANEV 251
           +VF N++
Sbjct: 258 FVFVNDL 264

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  170 bits (431), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 99/250 (39%), Positives = 137/250 (54%), Gaps = 41/250 (16%)

Query: 44  SINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPVSVFSLTDG-GADG--LGKLREEELRDS 100
           S+NL+IAHPDDEVMFF PTLLQLD    T +P +V  L+ G   DG  +G LR  E+ DS
Sbjct: 48  SVNLIIAHPDDEVMFFTPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDS 107

Query: 101 VHLLFRRRKA----EVTVLNFE--DGMKVEWDLQK------TSEALRKQVVGDQPLFLTF 148
           + +L   R+A    EV +  FE  DGM  +WD+ K       + ++   V G +   LTF
Sbjct: 108 LTMLLGHRRAGLNREVKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTF 167

Query: 149 DDHGVSSHINHISCYETVRNLRAAHPESRSFSLTSKRS----IFQKYTAFVPSLITVL-- 202
           D  GVS H NHI+CY+ +  L+        + L +  S    I  KY++F+P +  +L  
Sbjct: 168 DAQGVSEHPNHIACYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLIN 227

Query: 203 --------------------RGSRQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFF 242
                               +   Q  F++TF  Y++ALS M+N+HTSQMVWFRYGWW F
Sbjct: 228 IINDKFRIFELKQVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSF 287

Query: 243 SCYVFANEVR 252
           S +VF N++ 
Sbjct: 288 SRFVFVNDLH 297

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  170 bits (431), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 135/245 (55%), Gaps = 37/245 (15%)

Query: 43  TSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPVSVFSLTDGGADGLGKLREEELRDSVH 102
           + INLVIAHPDDEVMFF+P + QL  YF   +P ++  L+ G A+GLG+ R +EL DS  
Sbjct: 53  SQINLVIAHPDDEVMFFSPVISQLHAYFPDTVPFNILCLSKGDAEGLGETRAKELNDSAV 112

Query: 103 LLFR-RRKAEVTVLNFEDGMKVEWDLQKTSEALRKQV-VGDQP---LFLTFDDHGVSSHI 157
           LL R  R   V V++FEDGM   WD+   +  L + + V ++    + +TFD +GVS+HI
Sbjct: 113 LLLRNERPVSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHI 172

Query: 158 NHISCYETVRNL-----------RAAHPESRSFSLTS-KRSIFQKYTAFVPSLITVLRGS 205
           NH SC+  V              +A +    +  L S K +IF KY +F+  ++ +L  +
Sbjct: 173 NHKSCHIAVEKFIDDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRT 232

Query: 206 --------------------RQAVFMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCY 245
                                  + M+T  QY+LA + M+NAH SQ+VWFRYGWW  S +
Sbjct: 233 VSPFGRSIQPLAAPSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRF 292

Query: 246 VFANE 250
           VF NE
Sbjct: 293 VFVNE 297

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  169 bits (428), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 93/259 (35%), Positives = 146/259 (56%), Gaps = 24/259 (9%)

Query: 18  YFASSARIKASNEQAFTTLFSVLNPT-SINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPV 76
           + A S RIK+ N   F      L+   S++LV+AHPDDEVMFFAPT+L+LD     ++  
Sbjct: 18  FIAFSVRIKSRNGSVFNDNLKFLDEIDSLSLVVAHPDDEVMFFAPTILELDSRLPPNVEF 77

Query: 77  SVFSLTDGGADGLGKLREEELRDSVHLLF--RRRKAEVTVLNFEDGMKVEWDLQKTSEAL 134
           +V  L+ GGAD LG  R +EL++SV+LL    +R+ ++   ++ DG +  WD +     +
Sbjct: 78  NVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPDGHEETWDQESVQSTI 137

Query: 135 RKQVVGDQ--PLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRS--FSLTSKRSIFQK 190
           +  V+  +   + LTFDD GVS H+NHI+C+E V NL       ++  +  +   +I  K
Sbjct: 138 KDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQDESNVKAALYLDSYGDNIVLK 197

Query: 191 YTAFVPSLITVLRG-----------------SRQAVFMSTFKQYLLALSVMMNAHTSQMV 233
           Y+AF   +  + R                  + +   MS +  Y+L+ + M+++H SQMV
Sbjct: 198 YSAFFWEIWKLTRDWFLHRVLPTSSYNENKPATEITLMSDYSSYILSFASMLHSHKSQMV 257

Query: 234 WFRYGWWFFSCYVFANEVR 252
           WFRYGWW FS +VF N+++
Sbjct: 258 WFRYGWWTFSRFVFVNDLK 276

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  158 bits (399), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 94/265 (35%), Positives = 142/265 (53%), Gaps = 30/265 (11%)

Query: 18  YFASSARIKASNEQAFTTLFSVLNPTSINLVIAHPDDEVMFFAPTLLQLDHYFDTDIPVS 77
           +FA + R + + +      FS    +S+NLVIAHPDDEVMFF+PTL+QLD++   D+ ++
Sbjct: 23  WFAGAIRGENARQVRGPGYFS--GSSSVNLVIAHPDDEVMFFSPTLMQLDNWLPNDVAIN 80

Query: 78  VFSLTDG-GADG--LGKLREEELRDSVHLLFRR-RKAEVTVLNFEDGMKVEWDLQKTSEA 133
           V   + G   DG   G+ R  EL+ SV +L    R   V  L+++DG    WDL      
Sbjct: 81  VICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVHQLDYKDGKDQIWDLDSMVWD 140

Query: 134 LRKQV-----VGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTSKRS-I 187
           L+  +        + L +TFD+HGVS H NHI+C+  V  L    P   ++ L S  + +
Sbjct: 141 LKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAVHRLIEEEPLFMAYQLESHSTNV 200

Query: 188 FQKYTAFVPSLITV--------LRGSR----------QAVFMSTFKQYLLALSVMMNAHT 229
             KY+ F   ++          ++G            + V  +T  +Y++A + M+NAH 
Sbjct: 201 ILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAHE 260

Query: 230 SQMVWFRYGWWFFSCYVFANEVREF 254
           SQ+VWFRYGWWFFS   +ANE++ F
Sbjct: 261 SQVVWFRYGWWFFSRLTYANELKLF 285

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  154 bits (390), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 104/273 (38%), Positives = 147/273 (53%), Gaps = 48/273 (17%)

Query: 18  YFASSARIKASNEQAFTTLFSVL-NPTSINLVIAHPDDEVMFFAPTLLQL-DHYFDTDIP 75
           Y   + +++  N++  T L     N   +NLVIAHPDDE+MFF+PT+LQL DH  +    
Sbjct: 36  YIYFTPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDEIMFFSPTILQLIDHVQE---- 91

Query: 76  VSVFSLTDGGADGLGKLREEELRDSV-HLLFRR--RKAEVTVLNFEDGMKVEW-----DL 127
           ++V  L++G ADGLG+LR +EL+D++ +L   R  R   + +L++ DG    W     DL
Sbjct: 92  LNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVSLNILDYTDGQNEVWSGVATDL 151

Query: 128 QK---TSEALRKQVVGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTSK 184
           +K   TSE   KQ    + + LTFD  G+S H NHI+C E V +      +S SF     
Sbjct: 152 KKYILTSEPGVKQ----KDIILTFDREGISGHRNHIACNEGVISYLKT-IKSNSFVFLEL 206

Query: 185 RS-----IFQKYTAFVPSLITVL----RGSRQ-----------------AVFMSTFKQYL 218
           +S     I  KY+  VP L+ ++    R S +                   F+STF QY 
Sbjct: 207 KSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNRDSIATDSNVCFISTFDQYA 266

Query: 219 LALSVMMNAHTSQMVWFRYGWWFFSCYVFANEV 251
           L+ + M  AH SQMVWFRY WW FS YVF N++
Sbjct: 267 LSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDL 299

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  151 bits (382), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 101/296 (34%), Positives = 150/296 (50%), Gaps = 63/296 (21%)

Query: 18  YFASSARIKASNEQAFT------TLFSVLNPTSIN---LVIAHPDDEVMFFAPTLLQLDH 68
           Y  +S  IK  N+Q+F        L S      IN   L+IAHPDDE+MFF+PTLLQL++
Sbjct: 21  YIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDEIMFFSPTLLQLNN 80

Query: 69  YFDTDIPVSVFSLTDGGADGLGKLRE----EELRDSVHLLFRR-------RKAEVTVLNF 117
           Y + DI  +V  L+  G D  G  ++     EL DS++LLF R       R  ++  L++
Sbjct: 81  YLEKDIMFNVVCLSQ-GLDSTGSFKDPQRVHELNDSLNLLFNRGSNNEHNRNFKLIQLDY 139

Query: 118 EDGMKVEWDLQKTSEALRKQVV---GDQPLFLTFDDHGVSSHINHISCYETV-RNLRAAH 173
            DGMK  W++    + L + +        L LTFD  GVS+H NH++C E V + L+ ++
Sbjct: 140 TDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVSNHKNHLACNEAVTKLLKYSN 199

Query: 174 PESRSFSL---TSKRSIFQKYTAFVPSLITVLR---------------------GSRQAV 209
           P+S    +   +  ++ F KY+ FV  L T+++                      S Q +
Sbjct: 200 PDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFCFPNSDFLQSYQII 259

Query: 210 --------------FMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANEV 251
                         F + F +Y+L+ S M+NAH SQMVWFRY WW FS + F N++
Sbjct: 260 SHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIFSRFAFINDL 315

>KAFR0I01410 Chr9 (294241..297291) [3051 bp, 1016 aa] {ON} Anc_4.28
           YLL031C
          Length = 1016

 Score = 32.3 bits (72), Expect = 1.3,   Method: Composition-based stats.
 Identities = 28/92 (30%), Positives = 42/92 (45%), Gaps = 12/92 (13%)

Query: 139 VGDQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRSFSLTSKRSIFQKYTAFVPSL 198
           + +  L +   DHG+    NH    +++  L     ES  F  T K++IF+K+  F P  
Sbjct: 279 IDNNTLLVVMGDHGMDHTGNHGG--DSIDEL-----ESTLFLYTKKKNIFRKHDDFTPYN 331

Query: 199 ITVL----RGSRQAVFMSTFKQYLLALSVMMN 226
           IT L    R   Q   +ST   YLL + +  N
Sbjct: 332 ITDLGKNYRAVNQIDLVSTL-SYLLGIPIPFN 362

>KLTH0E16456g Chr5 (1458414..1460105) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q03103 Saccharomyces cerevisiae YML130C ERO1
           Glycoprotein required for oxidative protein folding in
           the endoplasmic reticulum
          Length = 563

 Score = 30.4 bits (67), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 42/99 (42%), Gaps = 8/99 (8%)

Query: 97  LRDSVHLLFRRRKAEVTVLNFEDGMKVEWDLQKTSEALRKQVVGDQ------PLFLTFDD 150
           + D VH    R   +V    +  G+K+ +++    EA R+ VV          LF TFD 
Sbjct: 340 IMDCVHCDRCRLWGKVQTTGYATGLKILFEIDSEDEAARQNVVDKLTKYELIALFNTFD- 398

Query: 151 HGVSSHINHISCYETVRNLRAAHPESRSFSLTSKRSIFQ 189
             +S  I  I+ +E + N +      R  SL    + F+
Sbjct: 399 -RLSKSIESINNFEKMYNEKVQSTGGRILSLFKSNNFFK 436

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.135    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,809,492
Number of extensions: 977997
Number of successful extensions: 3346
Number of sequences better than 10.0: 24
Number of HSP's gapped: 3382
Number of HSP's successfully gapped: 25
Length of query: 254
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 147
Effective length of database: 41,212,137
Effective search space: 6058184139
Effective search space used: 6058184139
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 64 (29.3 bits)