Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03718g8.847ON55155128760.0
Kwal_27.102248.847ON54655215160.0
SAKL0D01298g8.847ON55155910551e-137
TDEL0B005108.847ON5505647985e-99
ZYRO0G14322g8.847ON5505127333e-89
Kpol_1068.38.847ON5664926095e-71
TPHA0I002908.847ON5694615931e-68
Ecym_46188.847ON5274195272e-59
Skud_13.4548.847ON5804234845e-53
Smik_13.4958.847ON5764534846e-53
Suva_13.4718.847ON5814554452e-47
YMR282C (AEP2)8.847ON5804544223e-44
CAGL0M03069g8.847ON5484564002e-41
KLLA0D01408g8.847ON5184383973e-41
KAFR0B039708.847ON4743983901e-40
TBLA0B033108.847ON6134773845e-39
KNAG0J002308.847ON4744323566e-36
NDAI0K003408.847ON6244393572e-35
NCAS0C003708.847ON4954313443e-34
ABL119C8.847ON5374012081e-16
AGR054C8.276ON248110741.4
KAFR0C054305.536ON27482732.3
TDEL0F017406.177ON100497733.2
SAKL0H25652g4.22ON64370723.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03718g
         (551 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...  1112   0.0  
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   588   0.0  
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   410   e-137
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   311   5e-99
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   286   3e-89
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   239   5e-71
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   233   1e-68
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...   207   2e-59
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   191   5e-53
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   191   6e-53
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   176   2e-47
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   167   3e-44
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...   158   2e-41
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...   157   3e-41
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...   154   1e-40
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...   152   5e-39
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...   141   6e-36
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...   142   2e-35
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...   137   3e-34
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...    85   1e-16
AGR054C Chr7 complement(815104..815789,815922..815982) [747 bp, ...    33   1.4  
KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {...    33   2.3  
TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {...    33   3.2  
SAKL0H25652g Chr8 complement(2246901..2248822,2248938..2248947) ...    32   3.7  

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score = 1112 bits (2876), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/551 (97%), Positives = 539/551 (97%)

Query: 1   MLSRKCGSLSLTLKNFNSTLSVAYSASDAALKIPIADPSENAASKYANKPAKTLNDAXXX 60
           MLSRKCGSLSLTLKNFNSTLSVAYSASDAALKIPIADPSENAASKYANKPAKTLNDA   
Sbjct: 1   MLSRKCGSLSLTLKNFNSTLSVAYSASDAALKIPIADPSENAASKYANKPAKTLNDAVRE 60

Query: 61  XXXXXXXXXYTAKIPKLHEEQVSSGFSSPCNKLRSFLHSRDYMAFLVELTLQSRMDENFG 120
                    YTAKIPKLHEEQVSSGFSSPCNKLRSFLHSRDYMAFLVELTLQSRMDENFG
Sbjct: 61  RSERFRSRVYTAKIPKLHEEQVSSGFSSPCNKLRSFLHSRDYMAFLVELTLQSRMDENFG 120

Query: 121 AKMFQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVTPGPL 180
           AKMFQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVTPGPL
Sbjct: 121 AKMFQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVTPGPL 180

Query: 181 SPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSNNNQLPCDSATATHYLQLRCGALPRN 240
           SPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSNNNQLPCDSATATHYLQLRCGALPRN
Sbjct: 181 SPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSNNNQLPCDSATATHYLQLRCGALPRN 240

Query: 241 WKVLDENLGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWFHRKSAALES 300
           WKVLDENLGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWFHRKSAALES
Sbjct: 241 WKVLDENLGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWFHRKSAALES 300

Query: 301 AVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPSSEVLVAVLTSYASNKNIS 360
           AVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPSSEVLVAVLTSYASNKNIS
Sbjct: 301 AVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPSSEVLVAVLTSYASNKNIS 360

Query: 361 SALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHAARN 420
           SALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHAARN
Sbjct: 361 SALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHAARN 420

Query: 421 RQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRHEAVLFQKFAKLILK 480
           RQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRHEAVLFQKFAKLILK
Sbjct: 421 RQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRHEAVLFQKFAKLILK 480

Query: 481 NMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAAQKAQKRFDDE 540
           NMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAAQKAQKRFDDE
Sbjct: 481 NMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAAQKAQKRFDDE 540

Query: 541 EEDSMLLGRLW 551
           EEDSMLLGRLW
Sbjct: 541 EEDSMLLGRLW 551

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/552 (50%), Positives = 381/552 (69%), Gaps = 7/552 (1%)

Query: 1   MLSRKCGSLSLTLKNFNSTLSVAYSASDAALKIPIADPSENAASKYANKPAKTLNDAXXX 60
           ML ++  ++ L  K+F+STLSV YSA D +    + + + +     A    +T+ DA   
Sbjct: 1   MLPKRHTAVRLAFKSFSSTLSVNYSARDESYNYRVIEQAHSQGRGNAIDLKRTMADAFQD 60

Query: 61  XXXXXXXXXYTAKIPKLHE-EQVSSGFSSPCNKLRSFLHSRDYMAFLVELTLQSRMDENF 119
                           +H+ E  SS  +   N+LRS L+++DY+ F++ELT+QS+++ NF
Sbjct: 61  KTKGLICAT------NIHQAESPSSDTTQGMNRLRSLLNTKDYIKFMIELTIQSKLNSNF 114

Query: 120 GAKMFQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVTPGP 179
             K+F++N L+  EFS  + GLL+  NL  KL   LP+V  TEM+F LYQ YL T+  G 
Sbjct: 115 SHKIFEDNLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTYLMTIPAGS 174

Query: 180 LSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSNNNQLPCDSATATHYLQLRCGALPR 239
           L+PLQLHD N F+++FI +AQL KAQ VLD IL SNN+QLPCD+ T  HYLQLRCGALPR
Sbjct: 175 LNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILASNNDQLPCDTTTGIHYLQLRCGALPR 234

Query: 240 NWKVLDENLGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWFHRKSAALE 299
           NWKV D  +G S RLG+ +N+ Q VSH+YKALD  SVL F+++L+D  S WFH+KS  LE
Sbjct: 235 NWKVFDSRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFHKKSPTLE 294

Query: 300 SAVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPSSEVLVAVLTSYASNKNI 359
           +AV+YSLGFMGQL LL+EH+   WGI+    +  T+ +   PS EVL+A+ TS+AS++ +
Sbjct: 295 AAVIYSLGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAIFTSFASHQEV 354

Query: 360 SSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHAAR 419
           +  L L+D F+ KY  + LD VFWRRLFQW+  VW  KTDPRG+LSRGCWRVM EWH   
Sbjct: 355 TLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHEKG 414

Query: 420 NRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRHEAVLFQKFAKLIL 479
           +++L  D  LLNER+ VL++TNNY++A+ V+ Q +   ++K  LS  E  + QK++KL+L
Sbjct: 415 SKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLYEKPTLSSKEMAIVQKYSKLVL 474

Query: 480 KNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAAQKAQKRFDD 539
           K+MA LGYYHKPL FI EWSPNK +E +LR YF+KHR+ ++ RK+R  E +++ Q  +DD
Sbjct: 475 KSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTKRKERLREESRRKQNTYDD 534

Query: 540 EEEDSMLLGRLW 551
           EEED+MLLGRLW
Sbjct: 535 EEEDNMLLGRLW 546

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  410 bits (1055), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 221/559 (39%), Positives = 331/559 (59%), Gaps = 16/559 (2%)

Query: 1   MLSRKCGSLSLTLKNFNSTL-----SVAYSASDAALKIPIADPSENAASKYANKPAKTLN 55
           MLS+K  +  L LK  +STL      ++ SAS       +AD +    +    K  ++L 
Sbjct: 1   MLSKKHCTHQLLLKGCSSTLLTSISHISTSASPQQAIGTLADTTATKTTLPTEKTPRSLK 60

Query: 56  DAXXXXXXXXXXXXYTAKIPKLHEEQVSSGFSSPCNKLRSFLHSRDYMAFLVELTLQSRM 115
                         Y+ ++ K          S P N LR  L   ++  FLVEL L+ + 
Sbjct: 61  -----IKLLLKEEKYSKQLHKWGTTAEQIKPSLPRNNLRQHLQDNEHAKFLVELLLECKS 115

Query: 116 DENFGAKMFQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTV 175
           DE F  +MF    ++  E+S F+  LLS  NL  +L+  +P    TE++F LY++Y  +V
Sbjct: 116 DEGFANRMFSEKLITKLEYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYRDSV 175

Query: 176 TP-GPLSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSNNNQLPCDSATATHYLQLRC 234
                L+P+QL+D N+FI+ F   AQL KAQ VL  +L+ N   +P D  T  +YL+L+C
Sbjct: 176 VGNATLTPVQLYDLNQFIKRFTGDAQLAKAQQVLGFVLE-NYGSIPRDPQTLINYLELKC 234

Query: 235 GALPRNWKVLDENLGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWFHRK 294
           GA+PRNW +          LG++     L +HSYK L+ +++L  +  +   ++ W +++
Sbjct: 235 GAMPRNWSIPLSRPELGKTLGSQSFMSNL-AHSYKVLETEALLPLIDEMMKDRA-WHYKR 292

Query: 295 SAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEHN--QVTDASFTSPSSEVLVAVLTS 352
           +  LE+AV+YSLG+MGQ  LLE ++   WG+S+  +   +V       P+S +L+++++ 
Sbjct: 293 NCDLEAAVIYSLGYMGQFALLERYIKHTWGVSVSSNTSTEVEVPKNLYPTSNLLISIVSC 352

Query: 353 YASNKNISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVM 412
           YA   N+  AL +ID F++K+P +EL+ +FWRRLFQWSTR+W++KTDP+GELS GCW+VM
Sbjct: 353 YAMKGNLHQALQIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVM 412

Query: 413 REWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRHEAVLFQ 472
           ++WH  + R LP D  +LNER+ VL RTNN+ +A+ + ++  +  + K NL   E  + +
Sbjct: 413 KQWHNKQKRSLPIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMKRNLIDPEVDVIK 472

Query: 473 KFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAAQK 532
           KF KLILK MA  GYYHKPLK+I EW  NK  E  +R YF++HR AY  R ++R +  + 
Sbjct: 473 KFQKLILKKMAGRGYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIEQRKQKQET 532

Query: 533 AQKRFDDEEEDSMLLGRLW 551
           AQ  FD EEED MLLGRLW
Sbjct: 533 AQVTFDAEEEDDMLLGRLW 551

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  311 bits (798), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 196/564 (34%), Positives = 306/564 (54%), Gaps = 32/564 (5%)

Query: 4   RKCGSLSLTLKNFNSTLSVAYSASDAALKIPIADPSENAASKYANKPAKTLNDAXXXXXX 63
           R+  S+    K FNSTLSV Y+A+ A++          A  K+  +  +TL  +      
Sbjct: 3   RRNHSIQQVFKAFNSTLSVDYAAAQASIV--------GAPVKHEERHTQTLTSSSINACR 54

Query: 64  XXXXXXYTAK-------IPKLHEEQVSSGFSSPCNKLRSFLHSRDYMAFLVELTLQSRMD 116
                  T +       +P + E   S+  +   N+LR +L  ++Y+ FL+ + +Q+ ++
Sbjct: 55  SISNVRDTLRGLESLYALPGV-EYGRSTRDTVSTNQLREYLRRKEYVDFLIHVMVQNHLN 113

Query: 117 ENFGAKMFQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTV- 175
            N+   +F+  +LS +EFS FI  LL   +L  KLS  +P+   TE++F+LYQ+Y   V 
Sbjct: 114 RNYIKSLFETKELSTSEFSTFINRLLLEKDLDLKLSNIIPDTVHTEIIFNLYQIYCTYVI 173

Query: 176 --TPGPLSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKS---NNNQLPCDSATATHYL 230
             +   L+PLQ+HD N+FI+ FI  AQL+KAQ  L  ++     +N     D  T T +L
Sbjct: 174 KDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFL 233

Query: 231 QLRCGALPRNWKVLDENLGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVW 290
           QLRCGAL + W+V D N   ST++    +++     SY  L  +  L  ++ L   KS W
Sbjct: 234 QLRCGALQKFWRV-DSN---STKVLGEDSKHFKSPKSYNLLKEQPFLEIVNFLLKDKS-W 288

Query: 291 FHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPSSEVLVAVL 350
             R S  ++SA+VYSL  +GQ KL+++++   WGIS   H  V + +   P  EVL+ ++
Sbjct: 289 RLRSSPIIDSAIVYSLSNLGQTKLIDQYIQLKWGISEDGHVAVKNEAV--PGHEVLINIV 346

Query: 351 TSYA-SNKNISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCW 409
           ++Y   N +    L ++D FM KYP  EL+ +FWRRL Q S   W ++ D +  +  GCW
Sbjct: 347 SAYCLKNGDTGKGLRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCW 406

Query: 410 RVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKA--NLSRHE 467
            +M++WH  +   +  D+  L   + +   T N R A EVV  C+SS + K    +S+ E
Sbjct: 407 NIMKQWHEQKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDE 466

Query: 468 AVLFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQRRT 527
             L   F KL LK MA  G Y++PL+ IKEW+ +K+ +H L  YF +HR  Y   + +  
Sbjct: 467 MDLLLMFQKLALKTMALKGRYNEPLQLIKEWNVDKINQHYLLDYFMRHRRKYDLTRDKAR 526

Query: 528 EAAQKAQKRFDDEEEDSMLLGRLW 551
              Q+ Q ++D+ EE+ MLLGRLW
Sbjct: 527 AKQQQQQAQYDNMEEEDMLLGRLW 550

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  286 bits (733), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 181/512 (35%), Positives = 289/512 (56%), Gaps = 26/512 (5%)

Query: 50  PAKTLNDAXXXXXXXXXXXXYTAKIPKLHEEQVSSGFSSPCNKLRSFLHSRDYMAFLVEL 109
           P +TLND                  P  +  + SS  + P +K+R +L +  Y   L+ L
Sbjct: 55  PLRTLNDELHNAERKYIK-------PLTNAPEWSSTRTGPNSKIREYLKNGQYTKLLIRL 107

Query: 110 TLQSRMDENFGAKMFQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQ 169
           ++ + ++  + + +F    L+ +E+S FI  LLS   L  KLS  +P+   TE+++ LY+
Sbjct: 108 SVDNHLNNEYISGLFTTGGLTKSEYSLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYE 167

Query: 170 LYLK-TVTPGPLSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCIL--KSNNNQLP-CDSAT 225
            Y    V    L+PLQL+D N F++ FI  AQL KA  VLD IL  +  N+ L   D   
Sbjct: 168 FYCDHIVDQHNLTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEI 227

Query: 226 ATHYLQLRCGALPRNWKVLDENLGRST--RLGARKNRYQLVSHSYKALDHKSVLTFM-SL 282
              +L+L+CGAL + WK+   +   ST   LG + +   L + SYK  + K +L  + S+
Sbjct: 228 LIQFLRLKCGALSKFWKIQPASQRNSTAITLGEKASDCHL-AKSYKFQNEKVLLQIINSV 286

Query: 283 LSDPKSVWFHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPS 342
           L +    W +R+S  L++A++YSLG++GQ  L+E++V R W  S  E  +      T+P+
Sbjct: 287 LGEHN--WKNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPSKDEGVK------TNPN 338

Query: 343 SEVLVAVLTSYASNK-NISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPR 401
           S++LVAVLTSY   + N+   L ++D F+  YP +ELD +FWRRL Q S+ +W +K D +
Sbjct: 339 SDLLVAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPLFWRRLLQLSSLLWDKKRDRK 398

Query: 402 GELSRGCWRVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQC-YSSFFQ- 459
             LS GCW +M++WHA R R++P D  ++ E + +  RT N   A+EV+ +  + +F Q 
Sbjct: 399 ATLSHGCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQP 458

Query: 460 KANLSRHEAVLFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAY 519
           +  +  +E  L  K+ + ILK +A  G YHK  +F +EWS +   +  L++YF K R  +
Sbjct: 459 EFTIRPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSSTNKFELQSYFMKWRGIH 518

Query: 520 SARKQRRTEAAQKAQKRFDDEEEDSMLLGRLW 551
             R+  +++     Q+++D+ EED MLLGRLW
Sbjct: 519 EQRRTSQSKQKAALQEKYDEMEEDDMLLGRLW 550

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  239 bits (609), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 150/492 (30%), Positives = 257/492 (52%), Gaps = 34/492 (6%)

Query: 89  PCNKLRSFLHSRDYMAFLVELTLQSRMDENFGAKMFQNNDLSIAEFSAFIEGLLSVNNLL 148
           P N  R++L + +   F + L    R D++F   +F++ DL+  E S FI  +   N   
Sbjct: 80  PENIWRNYLKNNEIDKFTLHLLASLRGDDDFVKNLFKSGDLTYNELSIFINRIYKSNG-- 137

Query: 149 HKLSATLPN---VSGTEMVFSLYQLYLKTVTPG----PLSPLQLHDFNKFIRFFIRSAQL 201
           H +   + N   +S TE+++ +++LY  T+        L+ L L D N FI  FI+ AQL
Sbjct: 138 HDIKRVIQNHHSLSYTELIYEIFELYTSTIPKESGIIKLNALHLKDLNLFITIFIKEAQL 197

Query: 202 RKAQTVLDCILKSNNN-QLPCDSATATHYLQLRCGALPRNWKV------LDENLGRSTRL 254
            KAQ VL  I+ +  + +   D  T  ++L+LRCG LP+ W V      + +   +++RL
Sbjct: 198 SKAQNVLQYIIDAEGSIEKITDHDTMVNFLRLRCGGLPKFWLVPQASYAVTKQTKKNSRL 257

Query: 255 GARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWFHRKSAALESAVVYSLGFMGQLKL 314
            +     +  S SYK+    +VL  +  +   K VW  + S  L+S +VYSL    Q ++
Sbjct: 258 SSNSPNTRFPS-SYKSTVPNTVLFEVINMILNKKVWKSKHSGILDSTIVYSLAHTFQKQM 316

Query: 315 LEEHVWRNWGISLQEHNQVTDASF------TSPSSEVLVAVLTSYA-SNKNISSALHLID 367
           ++  +  +WGIS   H    D         ++PS+E+L+A+++SY   ++NI  A+ ++D
Sbjct: 317 MDGFIKEHWGIS--SHGDPLDLFIKKKKVASAPSNEILIAIMSSYIYKDRNIDGAMKILD 374

Query: 368 GFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHAA---RNRQLP 424
            F+  YP + LD++FWRRL QW  R+W  K D +G    GCW +M+ W+ A   ++  LP
Sbjct: 375 KFIRMYPDISLDNMFWRRLIQWCNRLWDPKIDRQGTFGYGCWNMMKNWNGAGTGKDVVLP 434

Query: 425 ADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLS--RHEAVLFQKFAKLILKNM 482
            D  +  E + +  RTNN + A E+V         + N++  + E  L  K+  L +  +
Sbjct: 435 YDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWL 494

Query: 483 AHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSAR---KQRRTEAAQKAQKRFDD 539
                + K   FI+EWS ++     LR  F+K +     +   + +++++ +K Q R+D+
Sbjct: 495 IERRQFKKAAFFIEEWSIDRNNRIQLREAFKKRKQLMLRKLSTRDKKSQSQKKRQDRYDE 554

Query: 540 EEEDSMLLGRLW 551
            EE+ M++GRLW
Sbjct: 555 MEEEDMIIGRLW 566

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  233 bits (593), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 160/461 (34%), Positives = 237/461 (51%), Gaps = 32/461 (6%)

Query: 119 FGAKMFQNNDLSIAEFSAFIEGLLSVNNLLHK--LSATLPNVSGTEMVFSLYQLYLKTVT 176
           F  ++ ++  L+  EFS F+  L+     ++   +    PN   +EMVF L+QLY   + 
Sbjct: 113 FLRELLESKQLTFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNAIG 172

Query: 177 PGPLSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSNNNQLPC-DSATATHYLQLRCG 235
              LS L L D N FI FFI    L +A+ VL  +L    + L   D  T THYLQLRCG
Sbjct: 173 SDKLSLLSLRDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLYDVDTVTHYLQLRCG 232

Query: 236 ALPRNWKVLD--------ENLGR-----STRLGARKNRYQLVSHSYKALDHKSVLTFMS- 281
           ALPR W   +        +  G       TRLG RKN    +++ YK LD   VL   + 
Sbjct: 233 ALPRYWMFQNKSAELAYKDKFGNRLSKYKTRLG-RKNFAVKLTNRYKILDPLGVLKIANK 291

Query: 282 LLSDPKSVWFHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWG--ISLQEHN-----QVT 334
           +++D K  W    SA L++ VVYSL + GQL  +  ++   W   IS+ + N     Q++
Sbjct: 292 IITDDK--WKSNHSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQIS 349

Query: 335 DASFTSPSSEVLVAVLTSYA-SNKNISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRV 393
           + +     SEV+ A+L+SY+  +K+I  A+++ID  M  YP LEL+  FWRRL QWS   
Sbjct: 350 NEASKPLPSEVMEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLC 409

Query: 394 WSEKTDPRGELSRGCWRVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQC 453
           W  K D +G L  GC++ ++++H  R+ ++  D  LL E + ++  T N R A EVV + 
Sbjct: 410 WDHKLDRKGSLVYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEF 469

Query: 454 YSSFFQKAN--LSRHEAVLFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAY 511
              FF K +  ++  E  L   F K  +  M     Y     FI++WS +   +  L  Y
Sbjct: 470 MPQFFYKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNKEELFKY 529

Query: 512 FEKHRNAYSARKQRRTEAAQKAQKRFDD-EEEDSMLLGRLW 551
           + K   A   +K RR    QK +++ +D  +ED  LLGRLW
Sbjct: 530 Y-KDSIAKKLQKVRRNSLQQKIKEKLEDHSDEDDTLLGRLW 569

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score =  207 bits (527), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 123/419 (29%), Positives = 219/419 (52%), Gaps = 18/419 (4%)

Query: 128 DLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTV---TPGPLSPLQ 184
           ++S  EFS F   LL  +     L   +P      +   LYQ Y+  +        +P++
Sbjct: 96  EMSSEEFSIFFNRLLPTSGSSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPME 155

Query: 185 LHDFNKFIRFFIRSAQLRKAQTVLDCILK-SNNNQLPCDSATATHYLQLRCGALPRNW-- 241
           LHD NKF  +F+   +L+ A+ VL  IL+ + + QLP D  T   Y QL  G+L   W  
Sbjct: 156 LHDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVTYFQLYLGSLASLWPT 215

Query: 242 -KVLDENLGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWFHRKSAALES 300
            KV      +  R G+R+ +Y +    Y +L    +   +  L +    W H +S+ L++
Sbjct: 216 PKVQSACYDKLVR-GSRRPKYVV----YNSLPEGIMYDVLQKLLENDD-WKHLRSSELDA 269

Query: 301 AVVYSLGFMGQLKLLEEHVWRNWGI-----SLQEHNQVTDASFTSPSSEVLVAVLTSYAS 355
            ++YSL    ++ L E  + R WGI      +++   V  +S T P SEVL+A++TS++ 
Sbjct: 270 KILYSLCHYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSFSY 329

Query: 356 NKNISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREW 415
             ++  A+ L+D F+ KYP ++L   FW +LF W+  ++  K DP G L + CW  M  W
Sbjct: 330 RNDLEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSW 389

Query: 416 HAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRHEAVLFQKFA 475
           + +R   +P  + L + R+ +L +T+NY+DA+ +     S+ + K+  ++H   + +K+ 
Sbjct: 390 YKSRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSAAAKHNLTVVRKYQ 449

Query: 476 KLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAAQKAQ 534
           K +++ ++  G      +FI++W  N+  E  L+  F++H N Y+ R+++R  +A+  Q
Sbjct: 450 KFVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQRHWNKYTIRQEKRRSSARNKQ 508

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  191 bits (484), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 132/423 (31%), Positives = 206/423 (48%), Gaps = 33/423 (7%)

Query: 157 NVSGTEMVFSLYQLYLKTVTP---------GPLSPLQLHDFNKFIRFFIRSAQLRKAQTV 207
           NV  +E  F L+ LY + V             L   ++ D N  I+ FI   QL KAQ +
Sbjct: 163 NVKYSEFWFKLFSLYAEKVDTRRDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKI 222

Query: 208 LDCILKSNNNQL----PCDSATATHYLQLRCGALPRNWKVLDEN------LGRSTRLGAR 257
           L  IL  N + L      D  T  H+LQLRCGAL   WK+ D +      L R  RLGA+
Sbjct: 223 LSFILDRNPDILLSPRNADIGTIVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAK 282

Query: 258 KNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWFHRKSAALESAVVYSLGFMGQLKLLEE 317
               +L S +YKA+DH+++L    L+   K       S  L S ++ S G +GQ ++LE 
Sbjct: 283 NTSIRL-SSTYKAMDHQTLLKIADLVLQDKRFL---NSEDLLSTLIQSFGHLGQTQILER 338

Query: 318 HVWRNWGISLQE--HNQVTDASFTSPSSEVLVAVLTSYASN-KNISSALHLIDGFMAKYP 374
            +   W IS QE   +         PSS++L+++L S+  N K++   L ++D F+  YP
Sbjct: 339 CIEHIWQISSQEFPSHVAIKPRGCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYP 398

Query: 375 TLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHAARNRQLPADAVLLNERF 434
            ++LD +FWRRL Q S   W+   D R      CW +M+ W+ ++      D   L + +
Sbjct: 399 EVKLDALFWRRLLQLSHFAWTPVNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLY 458

Query: 435 VVLSRTNNYRDAIEVVEQCYSSF--FQKANLSRHEAVLFQKFAKLILKNMAHLGYYHKPL 492
            V+ +T N+   I+V++   S     + AN  + EA+L  K+ K I+K + + G      
Sbjct: 459 EVMKKTGNFSLGIDVLKSFKSGIEKMRTANPEKLEAILI-KYQKCIIKQLVNRGKISAAR 517

Query: 493 KFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAAQK----AQKRFDDEEEDSMLLG 548
           KFI ++  N+     L  +      + S + +   E  +K    A   +DD+E+D M++G
Sbjct: 518 KFIGDFGFNRRAAKDLNIFCSNRIFSRSKKIKNDIENKKKRDGLAPGNYDDDEDDGMIIG 577

Query: 549 RLW 551
            LW
Sbjct: 578 SLW 580

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  191 bits (484), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 131/453 (28%), Positives = 218/453 (48%), Gaps = 34/453 (7%)

Query: 127 NDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVTP--------- 177
           N LS+AE S  +  L S+   +  +   +  V  +E  F ++ LY + V           
Sbjct: 130 NSLSLAELSFLLNKLYSLRFQIRGICRDI-KVKYSEFWFKIFSLYAEKVDAKRNHINLRN 188

Query: 178 GPLSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSNNNQL----PCDSATATHYLQLR 233
             L   ++ D N  IR FI   QL KAQ +L  I+  N + L      D  T  H+L+LR
Sbjct: 189 TTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDRNPDILLSPNNADIGTMVHFLKLR 248

Query: 234 CGALPRNWKVLD------ENLGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPK 287
           CGAL   WK+ D      + L +  RLGA+    +L S +YK +DH+++L    L+   K
Sbjct: 249 CGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIRL-SSTYKVMDHQTLLKIADLVLHEK 307

Query: 288 SVWFHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEH--NQVTDASFTSPSSEV 345
                  S  L S ++ S G +GQ ++LE  +   W I+ QE   +         PSS++
Sbjct: 308 RFL---NSEDLLSTLIQSFGHLGQTQILERCIEHIWHITTQEFPSHVAIKPRGCYPSSKI 364

Query: 346 LVAVLTSYASNKN-ISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGEL 404
           L+++L S+  N N +   L ++D F+  YP ++LD +FWRRLFQ S   W+   D +   
Sbjct: 365 LISILVSFHYNDNDLHRGLSILDSFIKHYPEVKLDALFWRRLFQLSNFAWTPAKDKKATS 424

Query: 405 SRGCWRVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSF--FQKAN 462
              CW +M++WH ++   L  D   L + + ++ +T N+   I+V++   S     ++ N
Sbjct: 425 VIRCWHLMKQWHVSKGLSLSVDYETLRQLYDIMKKTGNFPLGIDVLKSFKSGIERLRETN 484

Query: 463 LSRHEAVLFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSAR 522
             +   VL  K+ K I+K +   G      +FI ++  ++ +   L  +        S +
Sbjct: 485 SDKLNIVLI-KYQKYIIKQLVDRGRISAVREFINDFGFDRTITKNLNIFCTNRLLLRSKK 543

Query: 523 KQRRTEAAQKAQK----RFDDEEEDSMLLGRLW 551
            + + E  ++  K     FDD+E+D M++G LW
Sbjct: 544 NKSKIENKKERNKLEPSGFDDDEDDGMIIGSLW 576

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  176 bits (445), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 137/455 (30%), Positives = 223/455 (49%), Gaps = 42/455 (9%)

Query: 129 LSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVTP---------GP 179
           LS+ + S  +  L S    + K+   + NV  +E  F L+ LY + V             
Sbjct: 137 LSLEDLSFLLNNLYSQRFEIKKICKDI-NVRYSEFWFKLFSLYAEKVDVKRNQINLRNTA 195

Query: 180 LSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSNNNQL----PCDSATATHYLQLRCG 235
           L   ++ D N  I+ FI   QL KAQ VL  IL  N++ L      D  T  H+LQLRCG
Sbjct: 196 LDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKNADIGTIIHFLQLRCG 255

Query: 236 ALPRNWKVLDENLGRSTR----LGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWF 291
           AL   WK+ D +  + +R    LGA+    ++ S SYKA+DH+++L    L+   + +  
Sbjct: 256 ALAAYWKMPDNSEQKYSRKMVRLGAKNTSIRITS-SYKAMDHQTLLKIADLVLQKERLL- 313

Query: 292 HRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQE---HNQVTDAS-FTSPSSEVLV 347
              S  L S ++ S G +GQ ++LE  +   W ISLQE   H  +   +    PSS++L+
Sbjct: 314 --NSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTRGCCPSSKILI 371

Query: 348 AVLTSYASNKN-ISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSR 406
           ++L S+  N N +   L ++D F+  YP +++D +FWRRLFQ S   W+   D R     
Sbjct: 372 SILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHFAWTPTHDKRATSIV 431

Query: 407 GCWRVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRH 466
            CW +M++WH ++   L  D   L + + +  +T NY   I+V+ Q +     + +  + 
Sbjct: 432 RCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVL-QNFKPGITRTSAMKT 490

Query: 467 EAV--LFQKFAKLILKNMAHLGYYHKPLKFIKEWS--------PNKLLEHTLRAYFEKHR 516
           E +  +  K  K I+K + + G      +FI ++S         N    + +    +K +
Sbjct: 491 EKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVFCTNRILLRSKKLK 550

Query: 517 NAYSARKQRRTEAAQKAQKRFDDEEEDSMLLGRLW 551
           N    RK+R     +  Q  FDD+++D M++G LW
Sbjct: 551 NKTENRKERN----RSGQGNFDDDDDDGMVIGSLW 581

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  167 bits (422), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 131/454 (28%), Positives = 221/454 (48%), Gaps = 40/454 (8%)

Query: 129 LSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVTP---------GP 179
           LS+ + S  +  L +    + ++   + N   +E  F L+ LY + V             
Sbjct: 136 LSLEDLSFLLSKLYTQRFQIRRICRDI-NAKYSEFWFKLFSLYAEKVDAKRNQVNLRNTK 194

Query: 180 LSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSNNNQL----PCDSATATHYLQLRCG 235
           L   ++ D N  I+ FI   QL KAQ +L  IL  N + L      D +T  H+LQLRCG
Sbjct: 195 LDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNADISTIVHFLQLRCG 254

Query: 236 ALPRNWKVLDEN------LGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSV 289
           AL   WK+ D +      L +  RLGA+    +L S +YKA+DH+++L    L    K +
Sbjct: 255 ALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRL-SSTYKAMDHQTLLKIADLALQEKKL 313

Query: 290 WFHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEH--NQVTDASFTSPSSEVLV 347
                S  L S ++ S G +GQ ++LE  +   W IS QE   + V       PSS++LV
Sbjct: 314 L---NSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPSHVVIKHRGCYPSSKILV 370

Query: 348 AVLTS-YASNKNISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSR 406
           ++L S Y ++ ++   L ++D F+  YP ++LD +FWRRLFQ S   W+   D +     
Sbjct: 371 SILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFAWTPANDKKATSVV 430

Query: 407 GCWRVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRH 466
            CW +M++W+A++  +   D   L + + ++ +T N+   I+V+     SF      +R 
Sbjct: 431 RCWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLR----SFKPGIERTRA 486

Query: 467 EAV-----LFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSA 521
           E       +  K+ K I+K + + G +    +FI  +  ++ +   L  +        S 
Sbjct: 487 ENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFCANRMFLRSK 546

Query: 522 RKQRRTEAAQKAQK----RFDDEEEDSMLLGRLW 551
           + + + E  ++ +K     FDD+E+D M++G LW
Sbjct: 547 KMKNKIENKKEREKVRLDSFDDDEDDGMIIGSLW 580

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score =  158 bits (400), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 127/456 (27%), Positives = 219/456 (48%), Gaps = 42/456 (9%)

Query: 122 KMFQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYL---KTVTPG 178
           ++ Q++++SI EFS+ I+ +L+  NL+ K             +  L Q+Y+   +T   G
Sbjct: 109 QLLQDSNVSIQEFSSMIQPVLNRTNLVGKYHMG--------YLSKLMQIYISLTRTHNGG 160

Query: 179 PLSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCIL---KSNNNQLPC---DSATATHYLQL 232
            +  L   D NKFI+ FI  +QL++AQT L  +L   K     L     D  T  H+L L
Sbjct: 161 SVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLML 220

Query: 233 RCGALPRNWKVLDENLGRSTRLGARK--NRYQLVSHSYKALDH-------KSVLTFMSLL 283
           R GAL   WK+ D + G + +    K    ++ V  +Y  LD        + +L +    
Sbjct: 221 RSGALQDLWKI-DVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKD 279

Query: 284 SDPKSVWFHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPSS 343
           +  + V+F      +   V+  LG++GQ  L+E+ + + W +   +   V      + +S
Sbjct: 280 NHSQPVYF---DEGILKNVILCLGYVGQTTLIEDIINKIWEL---DSVSVPPKYNITVTS 333

Query: 344 EVLVAVLTSYAS-NKNISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRG 402
           ++L A++++Y+   K+I   L + D F  K P + +   FW  L +W+  +   K     
Sbjct: 334 DLLTAIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNI-ILPNKWRSTI 392

Query: 403 ELSRGCWRVMREWHAARNRQ--LPADAVLLNERFVVLS----RTNNYRDAIEVVEQCYSS 456
           +LS+  W +M+ W  + N    + A+   LN  + VLS    +  +     ++ +    +
Sbjct: 393 DLSKRTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVT 452

Query: 457 FFQKANLSRHEAVLFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHR 516
            + K +L+  E  L +KF    +K M + G+Y K L+FIKEWS +   +  L   F   R
Sbjct: 453 LYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLFVVLR 512

Query: 517 NAY-SARKQRRTEAAQKAQKRFDDEEEDSMLLGRLW 551
           N Y   R   + +   K QK++D+EE++ MLLG LW
Sbjct: 513 NRYLQKRGYNQEKEMTKVQKKYDEEEQEDMLLGGLW 548

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score =  157 bits (397), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 119/438 (27%), Positives = 209/438 (47%), Gaps = 40/438 (9%)

Query: 124 FQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLY----LKTVTPGP 179
           + N  L+  ++S F      VN L+   S  +  ++ TE+  SLY +Y    +  V  G 
Sbjct: 92  YSNEKLTPEDYSVF------VNQLMDVYSKDIELLNKTEVWKSLYHIYRVFVVNAVDDG- 144

Query: 180 LSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILK-SNNNQLPCDSATATHYLQLRCGALP 238
            + + L+D N+F+R FI    L  A+ V   ILK S N ++P D  T   YL+L CGAL 
Sbjct: 145 -NAMVLYDLNQFVRMFINLNDLPLARNVFQLILKNSKNGEIPKDVQTICMYLRLYCGALS 203

Query: 239 RNWKV-----LDENLGRSTRLGARKNRYQLVSH-SYKALDHKSV-LTFMSLLSDPKSVWF 291
             W         ++L  S   G+  +  ++ SH +Y  +      L    L+ DP+  + 
Sbjct: 204 ELWTTQTSRNFYQDLIGSLS-GSNASSIRIPSHIAYPTIGVPQFQLLLRKLVEDPE--YS 260

Query: 292 HRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDA----SFTSPSSEVLV 347
             ++  ++S ++ +LG   ++  L++++   +GI   E+  +T+        +P S++L 
Sbjct: 261 KLRNTEMDSLIIQALGHYKEVPFLKQYISIFYGID--ENVTITETHPGIKKLTPDSQLLK 318

Query: 348 AVLTSYASNKNISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRG 407
           +V+++Y  N NI+S + +I  FM KYP + LD  FWR    WS R W++  D +G   + 
Sbjct: 319 SVISAYGHNNNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKGSQPKK 378

Query: 408 CWRVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKA--NLSR 465
            W +M  W+A   + +P D  ++  R   L    ++  AI  V+Q +   F K   N   
Sbjct: 379 AWNLMLNWYATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFI 438

Query: 466 HEAVLFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQR 525
            E ++   + + I+KN+ +     K + FI EW     ++     Y E++    +  K  
Sbjct: 439 VERLVLYAYQRFIIKNLVNQNENAKCVDFINEWR----IDFENGRYLERYFKELTHPKNE 494

Query: 526 RTEAAQKAQKRFDDEEED 543
             E     QK+ +DE++D
Sbjct: 495 SDE-----QKKLNDEDDD 507

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score =  154 bits (390), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 110/398 (27%), Positives = 192/398 (48%), Gaps = 45/398 (11%)

Query: 162 EMVFSLYQLYLKTVTP-GPLSPLQLHDFNKFIRFFIRSAQLRKAQTVLD-CILKSNNNQL 219
           E++F L++ Y+K ++    L+ LQ+ D NKFI +F+   QL+KAQ V+   ILKS     
Sbjct: 114 EIIFQLFETYVKLISSHEELTILQVEDMNKFINYFVEFKQLKKAQLVMKYLILKSPRVLE 173

Query: 220 PCDSATATHYLQLRCGALPR----NWKVLDENLGRSTRLGARKNRYQLVSHSYKALDHKS 275
             D +T  +YL+L CGA       N+K+ D N   +T L       +LV +S   LD+K 
Sbjct: 174 KYDVSTTRNYLKLNCGACHELWYTNYKIFDFN---NTTLD------KLVKYS---LDNKI 221

Query: 276 VLTFMSLLSDPKSVWFHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTD 335
                         W        +  +++SLG+ G+++ LE+++ + WGISL +  QV  
Sbjct: 222 ------------GYW--------DVEIIHSLGYSGRIRSLEDYILKKWGISLCDRAQVNT 261

Query: 336 ASFTSPSSEVLVAVLTS-YASNKNISSALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVW 394
            +  +P SEVL A++   +  +K +  A+ +++ F+  YP L L   FW+       + W
Sbjct: 262 TN-EAPESEVLEAIINGFFYRDKRMFRAIKILNEFVNVYPDLNLKITFWKTFMNNCIKEW 320

Query: 395 SEKTDPRGELSRGCWRVMREWHAARNRQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCY 454
            EK D +G +    W  M+ W+   NR++P +   L        + NN   A ++ + C+
Sbjct: 321 DEKVDQKGVVIVEYWETMKRWYTVHNRRIPFNINFLKVMRTCFKKNNNLVLATDIFQNCF 380

Query: 455 SSF-FQKANLSRHEAVLFQKFAKLILKNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFE 513
            +F F    ++  E  + +++   IL  +     +   L FI +   +   +  L  Y+ 
Sbjct: 381 HNFYFCATRMNDSELNVIKEYQNFILSRLIEKKGFSNALTFINDHCFSLENKRQLMNYYH 440

Query: 514 KHRNAYSARKQRRTEAAQKAQKRFDDEEEDSMLLGRLW 551
             R  +  +K  R E  +K    +DD  E+  ++G+LW
Sbjct: 441 -GRKEHKLKKMTRNENLEKT---YDDMVEEDFIIGKLW 474

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score =  152 bits (384), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 135/477 (28%), Positives = 233/477 (48%), Gaps = 67/477 (14%)

Query: 99  SRDYMAFLVELTLQSRMDENFGAKMFQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNV 158
           S +Y  F+ EL     +D     K+  N  L+    S  I  L+  N+   K S  L   
Sbjct: 122 SINYKKFVDELIQWHYLDAKALNKLV-NKHLNDMNLSIVINLLVKYNHFQPKDSDRLSFK 180

Query: 159 SGTEMVFSLYQLYLKTV-------------------TPGPLSPLQLHDFNKFIRFFIRSA 199
           S +E++F +YQ+Y++ +                   +  PL+P+QL+D NK I +FI++ 
Sbjct: 181 SHSELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAG 240

Query: 200 QLRKAQTVLDCILKSNNN---QLPCDSATATHYLQLRCGALPRNWKV------LDENLG- 249
           QL+KA T L  ILK  N    Q+P DS T  ++L+L CG LP NW++        +N G 
Sbjct: 241 QLKKATTALMYILKRYNAEIFQIP-DSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGK 299

Query: 250 RSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLL----SDPK--SVWFH-RKSAALESAV 302
           RS +LG   + Y+L S SYKA+  K  +  +  +    +D K     FH  ++   +S +
Sbjct: 300 RSFKLGNNSSYYRLPS-SYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTL 358

Query: 303 VYSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPSSEVLVAVLTSYASN--KNIS 360
           +YSL  +G+  L E++   NW       +   D   T   S++++A+ +SY  N   NI 
Sbjct: 359 IYSLTSLGRFDLAEQYFKDNWL-----SDSCDDVELT---SDIVIAIFSSYVYNNSNNIE 410

Query: 361 SALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHA--- 417
            A  LI   + +YP L L+   W R+ +W+ ++W   TD  GE+    +  M  +++   
Sbjct: 411 KANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYC 470

Query: 418 ARNR-----QLPADAVLLNERFVVLSRTNNYRDAIEVVEQCY--SSFFQKANLSRHEAVL 470
           +RN       +P + +LL + + + +   +    + +++ C+  S F   + ++  +  +
Sbjct: 471 SRNSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQI 530

Query: 471 FQKFAKLILKNMAHLGYY--HKPLKFIKEWSPN-----KLLEHTL-RAYFEKHRNAY 519
             K+ K+ILK + +      +KPL FI+++S +     +LLE+ L R  + K R  Y
Sbjct: 531 LLKYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNKEQLLEYRLERLEYRKSRKEY 587

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score =  141 bits (356), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 111/432 (25%), Positives = 203/432 (46%), Gaps = 59/432 (13%)

Query: 133 EFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVT--PGPLSPLQLHDFNK 190
           +FS  +  +L+  N  H     L +    E  F+++  Y   +      L+ +QLHDFN 
Sbjct: 89  QFSVLLNRVLASQNYRH-----LDSKENVEKFFAIFMRYKGAIALQSNKLTQIQLHDFNL 143

Query: 191 FIRFFIRSAQLRKAQTVLDCILKSNNNQLPCDSATATHYLQLRCGALPRNWKVLDENLGR 250
              +FI   QL+KAQ ++D +L+ +   +  D     +Y +LRCG+          + G+
Sbjct: 144 MCDYFIACNQLKKAQLIMDFLLQQD---VKFDVFMIKNYTKLRCGS----------SFGK 190

Query: 251 STRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWFHRKSAALESAVVYSLGFMG 310
            T          L + +YK  D  +V   +        V   RK A   + +V SLG+  
Sbjct: 191 QT----------LNNKAYKVFDQNTVFQLIG------KVEADRKFAFWNNEIVSSLGYTN 234

Query: 311 QLKLLEEHVWRNWGISLQEHN---------QVTDASFTSPSSEVLVAVLTSYAS-NKNIS 360
            + L+E ++W  W IS+ +H+         Q  DA +  PSS+VL  +++SYA  ++ + 
Sbjct: 235 NITLMEIYIWDLWRISIHDHSTENIKIDHLQQGDAMY--PSSKVLATIVSSYARHDQTMK 292

Query: 361 SALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHAARN 420
            A+ +++ F   YP L L+  FW  L   + +    K DP   L+  CW +M++WH  R+
Sbjct: 293 RAVDIVERFAKSYPKLLLNVHFWSTLLNCAIKCGGSK-DPSQFLA--CWNLMKKWHTQRS 349

Query: 421 RQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSS-FFQKANLSRHEAVLFQKFAKLIL 479
           + +P  + LL      + +T+N    +++++      + ++ N+   E  +  K+ K IL
Sbjct: 350 KLMPFQSALLVTILRYMRQTSNLHGTVDILQYWLGPLYLKRGNIPEFERDVLIKYQKQIL 409

Query: 480 KNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAAQKAQKRFDD 539
           + +     Y+    FI +WS +   +  L A++E   +   + K RR +A          
Sbjct: 410 RKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFYESRVDVRES-KTRREKAYDDM------ 462

Query: 540 EEEDSMLLGRLW 551
           ++++ M++GRLW
Sbjct: 463 DDDEDMIIGRLW 474

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score =  142 bits (357), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 113/439 (25%), Positives = 204/439 (46%), Gaps = 57/439 (12%)

Query: 162 EMVFSLYQLYLKTV--TPGPLSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILK--SNNN 217
           E++FSL+ +           L+PL ++D N+FI++F+R  QL+KAQ VLD I+       
Sbjct: 194 EVIFSLFNICKDEYCNNTNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIE 253

Query: 218 QL--PCDSATATHYLQLRCGALPRNWKVL---DENLGRSTRLGARKNRYQLVS-HSYKAL 271
           QL    D  T  ++L+L+ GA+ +NWK L   + N     RL      +      +YK L
Sbjct: 254 QLIKSKDLTTLDNHLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFL 313

Query: 272 DHKSVLTFMSLLSDPKSVWFHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGI----SL 327
           D  S+L  + ++   K+   +     L  +++YSLG + Q++ +E  + + W +    ++
Sbjct: 314 DGWSLLKIIDMVLTDKTHCLN----ILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAV 369

Query: 328 QEHNQVTDASFTSPSSEVLVAVLTSYASN-KNISSALHLIDGFMAKYP----TLELDHVF 382
           +E N   D     P +  L+A+LTSY    K++  A  L+D  + KYP    +   D+ F
Sbjct: 370 EERNHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKF 429

Query: 383 WRRLFQWSTRVWSEK-TDPRGELSRGCWRVMREWHAARNRQLPAD---------AVLLNE 432
           W ++ QW  ++  +   +  G     C  +M EW     ++   +         ++L+N 
Sbjct: 430 WIKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINL 489

Query: 433 RFVVLSRTNNYRDAIEVVEQCYSSFFQKANLS-------RHEAVLFQKFAKLILKNMAHL 485
              ++    N    ++ +E    +F QK  L        R+   +     K I + +A  
Sbjct: 490 LHNIMKERKNVDIGLKAIE----NFVQKLKLGSVNKYYERNLTHVLYGLQKCIFRKIAES 545

Query: 486 GYYHKPLKFIKE--WSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAA-----------QK 532
           G Y+K L  I    ++ N  +E  LR Y+        +++ RR +A            +K
Sbjct: 546 GSYNKGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKAQSNIQDREQDEFEK 605

Query: 533 AQKRFDDEEEDSMLLGRLW 551
            Q+++D+ EE+ M++G+LW
Sbjct: 606 LQQKYDEIEEEGMIIGKLW 624

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score =  137 bits (344), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 111/431 (25%), Positives = 214/431 (49%), Gaps = 45/431 (10%)

Query: 130 SIAEFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKT-VTPGPLSPLQLHDF 188
           ++ E+S F+  +LS+ +     S    NV     VF L+++Y +     G L+ LQ++D 
Sbjct: 101 TLEEYSLFLGKVLSMKD-----SDVNVNV-----VFQLFEIYARMYCGEGSLNALQIYDL 150

Query: 189 NKFIRFFIRSAQLRKAQTVLDCILKS----NNNQLPCDSATATHYLQLRCGALPRNWKVL 244
           NK I++FI+  QL++ Q VLD I+       N     D  +  ++L+L+ G+L ++WK  
Sbjct: 151 NKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLKLKNGSLVKDWKFE 210

Query: 245 DENLGRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSL-LSDPKSVWFHRKSAALESAVV 303
            +NL     L +R+ R      +YK LD  S+L    L L+DP      +    L ++++
Sbjct: 211 GKNL---RYLQSRQGRL-----NYKFLDGWSLLKIADLVLNDP-----MKCQNVLTNSII 257

Query: 304 YSLGFMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPSSEVLVAVLTSYASN-KNISSA 362
           YSLG + Q++LL+  + + W    +  N         P +  ++A++TSY  N  N+  +
Sbjct: 258 YSLGHLRQVELLDHFIDQMWMQETRPRN-----GLLYPDTNNIIAIITSYCYNYGNMDKS 312

Query: 363 LHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHAARNRQ 422
             ++D  + KY  L+ D  FWRRLFQW   + +E    +G +   CW +M      +  +
Sbjct: 313 FDVLDRILEKYSGLKFDKFFWRRLFQWC--ILTEPNANKGFILGQCWSLME-----KQEK 365

Query: 423 LPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRHEAVLFQKFAKLILKNM 482
           +  D VLL      + +  +   A+ V++       +   ++  +  L  K+ K +   +
Sbjct: 366 VEFDGVLLELLREKIVKVRDVPLALRVLKMIVIELKKVNFINELDMELLLKYQKFVFSKL 425

Query: 483 AHLGYYHKPLKFI--KEWSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAAQKAQKRFDDE 540
             +    K ++ +   +++ NK  +  +RAY+ +++     +K +R+      Q+++D+ 
Sbjct: 426 GEINKTVKAMELLSCDDYTINKENKAFMRAYYFENKRE-KRKKNKRSNQYDDLQRKYDEM 484

Query: 541 EEDSMLLGRLW 551
           +E+ M++G+LW
Sbjct: 485 DEEDMIIGKLW 495

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 94/401 (23%), Positives = 172/401 (42%), Gaps = 22/401 (5%)

Query: 134 FSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVTPGPL---SPLQLHDFNK 190
           FS FI  LL        L   +       ++  LY  Y +     P+   SP +LHD N 
Sbjct: 133 FSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQKLYGFYREQFADAPIGRPSPGRLHDANS 192

Query: 191 FIRFFIRSAQLRKAQTVLDCILKSNNN--QLPCDSATATHYLQLRCGALPRNWKVLDENL 248
           F R+F+  ++LR A+TV   ++ +     +LP D+ T    LQL  GA    W+    ++
Sbjct: 193 FARWFMAESKLRLARTVFAELVGNPTELAKLPRDTETIITLLQLHLGAKHIFWRDPGNSV 252

Query: 249 GRSTRLGARKNRYQLVSHSYKALDHKSVLTFMSLL-SDPKSVWFHRKSAALESAVVYSLG 307
           GR  +L      +  V  +Y +L  +++L  + LL SDP+  W    S  L+  ++ +L 
Sbjct: 253 GRGGQLFTPA--HMAVVTAYNSLGEETLLRLLRLLQSDPQ--WKSVCSPDLDRNIILALA 308

Query: 308 FMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPSSEVLVAVLTSYASNKNISSALHLID 367
           F  +L L+     R +  +   H   +      P   ++ AV+T++A    ++  L +  
Sbjct: 309 FHNRLDLVHAQAARYYAPAAPGHGLPSTPLL--PDGALVGAVVTAFAFKHQLAQGLAIAY 366

Query: 368 GFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRG-ELSRGCWRVMREWHAARNRQLPAD 426
            F+ ++  L  +H  W+ +F W  R     T  +G  L    W  MR  +A   +  P D
Sbjct: 367 QFLDRFTHLPNEHELWKIIFTWLAR--RHPTGSQGAALYDEAWSKMRTRYAEHGQPTPYD 424

Query: 427 AVLLNERFVVLSRTNNYRDAIEVVEQCYSSFFQKANLSRHEAVLFQKFAKLILKNMAHLG 486
             +    + ++ R ++ R    ++    S  +Q+  ++  + +L  K    I+  +    
Sbjct: 425 YSIARASYRIVRRDSSLRRVRALLNDYMSPLYQQPAVAPRDRLLLLKCQAHIVGRLVRAR 484

Query: 487 YYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQRRT 527
                  F+ +W+    L+   R++  +H    +AR   RT
Sbjct: 485 RNSAAADFVDQWA----LDSEARSHLLEH---IAARASSRT 518

>AGR054C Chr7 complement(815104..815789,815922..815982) [747 bp, 248
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR093C (NYV1); 1-intron; nonconsensus splice site
          Length = 248

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 25/110 (22%)

Query: 277 LTFMSLLSDPKSV----WFHRKSAALESAVVYSLGFMGQLKLLEEHVWRNWGISLQEHNQ 332
           LTF+ +++  KS     W+H  +A        S G+                +S + H  
Sbjct: 21  LTFVEIVNRDKSTTRCQWYHDATAG-------SAGYGA--------------VSNRAHKD 59

Query: 333 VTDASFTSPSSEVLVAVLTSYASNKNISSALHLIDGFMAKYPTLELDHVF 382
           VT  SF +   EV++  +     NK I + +  IDG+   Y T +   V 
Sbjct: 60  VTQESFHNLVHEVVIPKVVRLTGNKVIKTTMTFIDGYDCYYTTNDAGQVL 109

>KAFR0C05430 Chr3 complement(1088709..1089533) [825 bp, 274 aa] {ON}
           Anc_5.536 YDR429C
          Length = 274

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 7/82 (8%)

Query: 212 LKSNNNQLPCDSATA-THYLQLRCGALPRNWKVLDENLGRSTRLGARKN---RYQLVSHS 267
           L+ N+   P DS T     +++R   L RNWK ++E   +  ++ A K    RY    H 
Sbjct: 60  LEKNSPPGPNDSTTQLGEEVEVR---LSRNWKQVEEERLQKAKVAAAKTVVCRYCGNDHY 116

Query: 268 YKALDHKSVLTFMSLLSDPKSV 289
                 KS+L  +S L DP S+
Sbjct: 117 TMNCPFKSILNELSALEDPASI 138

>TDEL0F01740 Chr6 complement(322088..325102) [3015 bp, 1004 aa] {ON}
           Anc_6.177 YPL183C
          Length = 1004

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/97 (23%), Positives = 43/97 (44%), Gaps = 9/97 (9%)

Query: 157 NVSGTEMVFSLYQLYLKTVTPGPLSPLQLHDFNKFIRFFIRSAQLRKAQTVLDCILKSN- 215
           +V+  +  ++  ++YLK  + G     ++   NK +R F+  AQ       +    KS+ 
Sbjct: 530 SVTNRDGYYTFIKIYLKGASRGDGKDYEIIQSNKIVRGFLEGAQFNAHGDYITHGFKSSL 589

Query: 216 ---NNQLPCDSATATHYLQLRCGALPRNWKVLDENLG 249
               N+  C   T+ H     CG   R WK+ +++ G
Sbjct: 590 FYIYNETSCYEITS-HI----CGGAHRQWKLCEDDKG 621

>SAKL0H25652g Chr8 complement(2246901..2248822,2248938..2248947)
           [1932 bp, 643 aa] {ON} similar to uniprot|Q9P4W6
           Saccharomyces cerevisiae YLL035W GRC3 Protein of unknown
           function required for cell growth and possibly involved
           in rRNA processing mRNA is cell cycle regulated
          Length = 643

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 14/70 (20%)

Query: 129 LSIAEFSAFI------EGLLSVNNLLHKLSA-------TLPNVSGTEMVFSLYQLYLKTV 175
           LS+ EF   I      EGLL +N L    S+       TLP V  +++ F+L  LY  T+
Sbjct: 162 LSLDEFECVIKISNGAEGLLDINKLHPTFSSVWLPQNYTLPRVDTSKITFALLSLYTTTI 221

Query: 176 TPGPLSPLQL 185
            P  L+ L++
Sbjct: 222 -PKDLTTLKI 230

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.131    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,317,159
Number of extensions: 2317904
Number of successful extensions: 7101
Number of sequences better than 10.0: 32
Number of HSP's gapped: 7220
Number of HSP's successfully gapped: 33
Length of query: 551
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 436
Effective length of database: 40,294,809
Effective search space: 17568536724
Effective search space used: 17568536724
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 68 (30.8 bits)