Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03696g8.848ON47447425350.0
Kwal_27.102198.848ON50047517440.0
SAKL0D01276g8.848ON50247814120.0
TDEL0A079708.848ON48947613870.0
Ecym_46238.848ON48047613680.0
KNAG0J002208.848ON49947913350.0
NCAS0C003508.848ON48648213330.0
ZYRO0G14344g8.848ON47247113241e-180
Kpol_1068.28.848ON49148413061e-177
NDAI0K003508.848ON50449412961e-175
YMR283C (RIT1)8.848ON51348412881e-174
Smik_13.4968.848ON49448412821e-173
Skud_13.4558.848ON49448412811e-173
KLLA0D01386g8.848ON48949512801e-173
TPHA0I003008.848ON49349612691e-171
Suva_13.4728.848ON51048412631e-170
KAFR0B039808.848ON48348312531e-169
AFR451C8.848ON40840810721e-143
NDAI0F036802.32ON66370751.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03696g
         (474 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} simila...   981   0.0  
Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283...   676   0.0  
SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar ...   548   0.0  
TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON} Anc_8...   538   0.0  
Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar...   531   0.0  
KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.84...   518   0.0  
NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848...   518   0.0  
ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]...   514   e-180
Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...   507   e-177
NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON...   503   e-175
YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON} ...   500   e-174
Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {...   498   e-173
Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {...   498   e-173
KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} simila...   497   e-173
TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}...   493   e-171
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...   491   e-170
KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {O...   487   e-169
AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}...   417   e-143
NDAI0F03680 Chr6 complement(872773..874764) [1992 bp, 663 aa] {O...    33   1.3  

>KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 474

 Score =  981 bits (2535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/474 (100%), Positives = 474/474 (100%)

Query: 1   MELTSDQTINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWY 60
           MELTSDQTINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWY
Sbjct: 1   MELTSDQTINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWY 60

Query: 61  CDPKDYLQTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALS 120
           CDPKDYLQTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALS
Sbjct: 61  CDPKDYLQTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALS 120

Query: 121 KTVPIWCAVLNSLLLEYQGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGA 180
           KTVPIWCAVLNSLLLEYQGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGA
Sbjct: 121 KTVPIWCAVLNSLLLEYQGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGA 180

Query: 181 DIDRLFKGKILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQ 240
           DIDRLFKGKILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQ
Sbjct: 181 DIDRLFKGKILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQ 240

Query: 241 DGVDKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQE 300
           DGVDKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQE
Sbjct: 241 DGVDKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQE 300

Query: 301 PNSAENGLSLDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSE 360
           PNSAENGLSLDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSE
Sbjct: 301 PNSAENGLSLDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSE 360

Query: 361 DEAAIKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSLPMLVCCNTGKDMSVCVSLAI 420
           DEAAIKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSLPMLVCCNTGKDMSVCVSLAI
Sbjct: 361 DEAAIKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSLPMLVCCNTGKDMSVCVSLAI 420

Query: 421 LCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM 474
           LCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM
Sbjct: 421 LCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM 474

>Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283C
           (RIT1) - Initiator methionine tRNA 2'-O-ribosyl
           phosphate transferase [contig 39] FULL
          Length = 500

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/475 (66%), Positives = 392/475 (82%), Gaps = 2/475 (0%)

Query: 1   MELTSDQTINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWY 60
           M+LT DQT+N LN+EIKKE ++LRNRLQSI+FDH+FL+EQV A+FP+YP+IPNERCG+WY
Sbjct: 27  MDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWY 86

Query: 61  CDPKDYLQTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALS 120
           CDP+ Y QTSYFKSTDGH+NQWDFSLRRLN HLLP +   GGIV+VDSTRRGKRMPDALS
Sbjct: 87  CDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALS 146

Query: 121 KTVPIWCAVLNSLLLEYQGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGA 180
           KTVPIWCAVLNS++LE +  E EVLFCPP TVS  EFERIKSRIP LVA+FK++ + T  
Sbjct: 147 KTVPIWCAVLNSIMLEGRQSEEEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLFTSD 206

Query: 181 DIDRLFKGKILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQ 240
           ++ ++  GKILRP+WV+PGASLL+S RDPFTG++++  W  A+ ENF+PVVLCTVSYQCQ
Sbjct: 207 ELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTWE-AQNENFMPVVLCTVSYQCQ 265

Query: 241 DGVDKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQE 300
           DGVDKRHGFTYVQGAADDHELWA+GLTAELFW+HI I  +  LSDQEL ++V + +   +
Sbjct: 266 DGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVTSGD 325

Query: 301 PNSA-ENGLSLDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLS 359
            N+     L LD +L  + LT ELHLG+++ N+ L ++LV +L+LKYSLV++LS ++++ 
Sbjct: 326 ANNKLTKSLRLDDMLNANELTRELHLGQVAENIELDKNLVDQLKLKYSLVVLLSTSISVY 385

Query: 360 EDEAAIKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSLPMLVCCNTGKDMSVCVSLA 419
           E+   I+IFKLQS  KKSS+ALR  L +ICPL EA L NSLP+L+CCN GKDMSVCV L+
Sbjct: 386 EEAENIRIFKLQSGSKKSSRALRAALTQICPLIEANLQNSLPVLICCNNGKDMSVCVVLS 445

Query: 420 ILCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM 474
           +LCRN+NV SW L  + S+HK  IKKHL+K+ITKL+GRN+NPPR SLNSVN YLM
Sbjct: 446 VLCRNFNVESWQLEQRPSVHKSIIKKHLAKMITKLDGRNLNPPRVSLNSVNDYLM 500

>SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar to
           uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 502

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/478 (56%), Positives = 358/478 (74%), Gaps = 5/478 (1%)

Query: 1   MELTSDQTINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWY 60
           M+  + +++N + +EIKKEY+SLRNRLQSI++DH+FL   V   FPDYP++PNERCG+WY
Sbjct: 26  MDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVPNERCGLWY 85

Query: 61  CDPKDYLQTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALS 120
           C+P+ + Q SYFKSTDGH NQWDFS RRLNFHLLP++A  GGIV++DSTRRGK++PDALS
Sbjct: 86  CNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRGKKIPDALS 145

Query: 121 KTVPIWCAVLNSLLLEYQGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGA 180
           KT+PIWCAV+N+L+LE      EVLFCPP TV + E++RIK+RIP LV K K + I++G 
Sbjct: 146 KTIPIWCAVINTLILEASNRSEEVLFCPPGTVPQSEYDRIKNRIPSLVEKLKNLGIVSGD 205

Query: 181 DIDRLFKGKILRPLWVFPGASLLSSQRDPFTG-EVLSQKWHTAELENFIPVVLCTVSYQC 239
           ++ + F GKILRPLWV+PG+SL SS  D FTG +  SQKW   E ++F+PV+LCT SYQC
Sbjct: 206 ELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFLPVILCTASYQC 265

Query: 240 QDGVDKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFV-EDKIHP 298
           QDGVDKR+GFTYVQGAADDHELWA+GLT ++FW + + L +   S+QEL  +V + K   
Sbjct: 266 QDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQELIEYVNKQKREA 325

Query: 299 QEPNSAENGLSLDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTL 358
            E     +G  L+Q    D +T+ELHLG +   + L E L+ +L  +Y+L ++LS +V +
Sbjct: 326 TERTKEASGNDLNQCFSVDAITKELHLGTVVDGLELNEKLLSQLDSRYALTVVLSESVKI 385

Query: 359 S--EDEAAIKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSLPMLVCCNTGKDMSVCV 416
           +  ++    KIF L S  KKSSK LR++LI+ICPL +A L + LP+L+CCNTGKDMSV V
Sbjct: 386 ASIQENPNTKIFPLTSGNKKSSKELRSKLIEICPLIQASLNSPLPILICCNTGKDMSVGV 445

Query: 417 SLAILCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM 474
            LA LC+NY+   W +    S +K  I+KHL+++I+ L+GRNVNP RA+LNSVNAYLM
Sbjct: 446 LLATLCQNYD-EDWCIGSPNSFNKTIIRKHLTRLISHLKGRNVNPSRATLNSVNAYLM 502

>TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON}
           Anc_8.848 YMR283C
          Length = 489

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/476 (55%), Positives = 343/476 (72%), Gaps = 16/476 (3%)

Query: 12  LNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYLQTSY 71
           +N++IKKEY+SLRNRLQSI+ D+ FL  +V   FP+YP++PNERCG+WYC+PKD+ QTSY
Sbjct: 17  INKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWYCNPKDFTQTSY 76

Query: 72  FKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWCAVLN 131
           FKSTDGHTNQWDFS RRLNFH++P +A S GI++VDSTRRGK++PDALSKT+PIWCAVLN
Sbjct: 77  FKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALSKTIPIWCAVLN 136

Query: 132 SLLLEYQG--LEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRLFKGK 189
            L+LE QG  ++ E L+ PP+TVSE EF  IKSRIP+LV K K + ++ G ++ +   GK
Sbjct: 137 HLMLESQGGSVKQETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVINGKELHKQLGGK 196

Query: 190 ILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQDGVDKRHGF 249
           +LRP W++PG+S+L S  D FTGEV S KW   +  + IP++LCTVSYQ QDGVDKR GF
Sbjct: 197 LLRPFWIYPGSSILQSTTDIFTGEVTSDKWIPVD-NSIIPIILCTVSYQAQDGVDKRRGF 255

Query: 250 TYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPNSAENGLS 309
           TYVQGAADDHELW+ GL A++FW +I IL N   S++ELE FV          S E   S
Sbjct: 256 TYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQLSLRGCDLSKEIQFS 315

Query: 310 LDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSEDEAA----- 364
            D     D++T EL LG +  N+     L+ E+R  +SLVI+LS +V   +  A      
Sbjct: 316 -DAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQSVNFPQKVAEMENAS 374

Query: 365 --IKIFKLQSECKKSSKALRTELIKICPLAEAYL----PNSLPMLVCCNTGKDMSVCVSL 418
             I I KLQS  K SS+ L+TEL+KI PL E ++        P+L+CCN+G DMS+ + L
Sbjct: 375 EFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVLICCNSGTDMSIGLLL 434

Query: 419 AILCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM 474
            +LCRNYN+  W LN   S+ KI +KKHL+K+I+ L+GRNVNPPRA+LNSVN+YLM
Sbjct: 435 VVLCRNYNM-DWQLNTPTSVSKIVVKKHLAKLISHLKGRNVNPPRATLNSVNSYLM 489

>Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR451C
          Length = 480

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/476 (52%), Positives = 351/476 (73%), Gaps = 13/476 (2%)

Query: 8   TINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYL 67
           T+  + +EI+++  SLRNRLQS+ +D KF+  +V  +FP+YP++PNERCG+WYC+P  Y 
Sbjct: 9   TLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYCNPGKYE 68

Query: 68  QTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWC 127
           QT YFKSTDGHTNQWDFS RRLNFH+L  +A +GGI++VDSTRRGK+MPDALSKT+PIWC
Sbjct: 69  QTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSKTIPIWC 128

Query: 128 AVLNSLLLEYQGLEGEV--LFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRL 185
           AVLN+L+L+Y+G E  +  LFCPP TVS+ EF+ I S++PDLV K KK+NI++G ++  +
Sbjct: 129 AVLNNLMLDYKGKEDSIPSLFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIISGEELYNM 188

Query: 186 FKGKILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQDGVDK 245
           F+GK+LRP WV+PG+ LL + RD FTGEVL   W +   +N IPV+LCT SYQCQDG DK
Sbjct: 189 FQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQSE--QNSIPVILCTASYQCQDGEDK 246

Query: 246 RHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPNSAE 305
            HGFTYVQGAADDHELWA GL  E+FWK+I  L + + S+ ELE FV+ +I   E  +A+
Sbjct: 247 HHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQ-RIGRTEKLTAQ 305

Query: 306 NGLSLDQ-----ILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSE 360
           +    D+      +  D +T+ L+LG ++  + L E++ KEL+ KYSL II S +VT   
Sbjct: 306 SNKQSDRESSSSFIKVDEITKNLYLGTVAEGIALTENIEKELKSKYSLCIICSQSVTAKA 365

Query: 361 DEAA--IKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSLPMLVCCNTGKDMSVCVSL 418
           D     IK++ + +  KKSS+ LR  LI+I  L + ++ + LP+L+CCNTGKD+S+ + L
Sbjct: 366 DCNCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQLPILICCNTGKDISIGIML 425

Query: 419 AILCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM 474
             LC++Y++  W L  Q++++K  +KKHL++IITKL G N+NP R++L +VNA+L+
Sbjct: 426 TALCQHYDL-QWHLEEQETVNKTIVKKHLARIITKLSGININPSRSTLKNVNAFLL 480

>KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.848
           YMR283C
          Length = 499

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/479 (54%), Positives = 341/479 (71%), Gaps = 18/479 (3%)

Query: 12  LNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYLQTSY 71
           +++E+K++ RSLRNR+QSI+ D++FL+ +V   FPD+P+IPNERCG+WYC+P  + QTSY
Sbjct: 23  ISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWYCNPSHFAQTSY 82

Query: 72  FKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWCAVLN 131
           FKSTDGH NQWDFS RRLNFHLLP L  +GG+V+VDSTRRGK++PDALSKTVP+WCAVLN
Sbjct: 83  FKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALSKTVPLWCAVLN 142

Query: 132 SLLLEYQGLE---GEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRLFKG 188
           SL+LE  G +    +VLF PP+TV E E +++  ++PDLV K K +N+  G    R+  G
Sbjct: 143 SLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVFDGTKTSRMLDG 202

Query: 189 KILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQDGVDKRHG 248
           K+LRP WVFPG+SLL S  D FTGE +  KW  +  EN +P++LCTVSYQ QDG+DKR+G
Sbjct: 203 KLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTVSYQAQDGIDKRNG 262

Query: 249 FTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPN---SAE 305
           FTYVQGAADDHELW+ GL A +FW +I    N++  D EL   V+  +  Q  N   SA+
Sbjct: 263 FTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMVTQQNNNMQRSAQ 322

Query: 306 NGLSLDQILY-TDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTL----SE 360
            G SLD+I+   D +T  L LG+I  NV L    + +L   YS VI+LS TV L    S+
Sbjct: 323 AG-SLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLSETVHLDKDASQ 381

Query: 361 DEAAIKIFKLQSECKKSSKALRTELIKIC-PLAEAYLPNSL-PMLVCCNTGKDMSVCVSL 418
           D   +KIF+L S  KKSSK LR  L  I   +  A +   + P+L+CCNTGKDMS+ V L
Sbjct: 382 DNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQPIKPLLICCNTGKDMSIGVLL 441

Query: 419 AILCRNYNVGSWDL---NVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM 474
           A+LC+NY+   WDL   +V+ S+ KI I++HL+K+I  L GRNVNP RA+LNS+N++LM
Sbjct: 442 AVLCQNYD-EVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRNVNPSRATLNSINSFLM 499

>NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848
           YMR283C
          Length = 486

 Score =  518 bits (1333), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/482 (52%), Positives = 350/482 (72%), Gaps = 16/482 (3%)

Query: 7   QTINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDY 66
           +++  +N++I+KE +S+RNRLQSI+ D+KFL+++V   FPD+PIIPNERCG+WY  P+D+
Sbjct: 7   ESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWYVPPEDF 66

Query: 67  LQTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIW 126
            QTSYFKSTDGHTNQWDFS RRLNFHL P L +SGGI++VDSTRRGK++PDALSKT+PIW
Sbjct: 67  KQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALSKTIPIW 126

Query: 127 CAVLNS-LLLEYQGLEG----EVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGAD 181
           CAVLN  +LL  +G +     +VLF PP+T+S+ E++ I  RIPDLV K  K++I+ G +
Sbjct: 127 CAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLDIVDGNE 186

Query: 182 IDRLFKGKILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQD 241
           +  L +GK+LRP WV+PG+SLL S RD FTGE+    W+  +  N IP++LCT+SY+ QD
Sbjct: 187 LFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTISYRAQD 246

Query: 242 GVDKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEP 301
           G DKRHGFTYVQGAADDHELW++GLT  LFW HI+   N+N +++++  FVE  +  Q+ 
Sbjct: 247 GHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETLVQEQDD 306

Query: 302 NSAENGLSLDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSED 361
              ++ ++ D   Y D +T +L LGKI  NV +G+ L ++L  +++L IILS  V L   
Sbjct: 307 AGEQSDIN-DAFDYIDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIILSENVELDPV 365

Query: 362 E-----AAIKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSL--PMLVCCNTGKDMSV 414
           +      +  IFKLQS  KKSSK LR ++ +I  L E+ + N+L  P+L+CCNTG DMS+
Sbjct: 366 DNENLPISTHIFKLQSGSKKSSKLLRNKIEEIIGLVESQMNNALNKPILICCNTGTDMSI 425

Query: 415 CVSLAILCRNYNVGSWDLNVQQS--IHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAY 472
            + LA+LCRNY+   W L   ++  + KI I+K L+++I+ LEGR +N  RA+LNSVN Y
Sbjct: 426 GILLALLCRNYS-ERWVLGEVEAKRLDKIMIRKQLTRLISHLEGRTINTSRATLNSVNNY 484

Query: 473 LM 474
           LM
Sbjct: 485 LM 486

>ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]
           {ON} similar to uniprot|P23796 Saccharomyces cerevisiae
           YMR283C RIT1 Modifies initiator methionine tRNA to
           distinguish it from elongator methionine tRNA Initiator
           methionine tRNA 2'-O-ribosyl phosphate transferase
          Length = 472

 Score =  514 bits (1324), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 254/471 (53%), Positives = 338/471 (71%), Gaps = 10/471 (2%)

Query: 8   TINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYL 67
           ++N +NR+IKKEY SLRNR+QSI+FD+ F+ ++V   FP+YP+IPNERCG+WYCDPKD+ 
Sbjct: 8   SLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWYCDPKDFD 67

Query: 68  QTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWC 127
           QTSYFKSTDGHTNQWDFS RRLN HLLP L    GI++VDSTRRGK MPDALSKT+PIWC
Sbjct: 68  QTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALSKTIPIWC 127

Query: 128 AVLNSLLLEYQGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRLFK 187
           AVLNSL+   Q  + EVLF PP+ VS+ E + IK+RIP LV + +K++IL   D+   F+
Sbjct: 128 AVLNSLM---QPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDILDAQDLRNKFQ 184

Query: 188 GKILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQDGVDKRH 247
           GKILRP WV+PG+ +L S  DPFTGE++  +W     E  IP++LCT SY+ QDGVDKRH
Sbjct: 185 GKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASYRAQDGVDKRH 244

Query: 248 GFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPNSAENG 307
           GFTYVQGAADDHELW+ GL  +L W +     +++ +D+ELES V+  I   E     N 
Sbjct: 245 GFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIELAETTDHRNH 304

Query: 308 LSLDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSEDEAAIKI 367
           L+   I+  D +T+EL LGK+  +  +  ++ +EL  ++SLVIILS +VTLS+    IK 
Sbjct: 305 LA--DIVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQSVTLSKPFDFIKT 362

Query: 368 FKLQSECKKSSKALRTELIKICPLAEAYLPNSL----PMLVCCNTGKDMSVCVSLAILCR 423
           + LQS  K+SSK LR  LI+I  +  A+L   +    P++VCCN+G D+SV V L ILC+
Sbjct: 363 YNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKRKPIMVCCNSGTDISVGVILMILCK 422

Query: 424 NYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM 474
            Y+   W L    S++K  I++HL +II K++ RNVNP RA+LNS+N++LM
Sbjct: 423 YYS-QDWLLGKPDSVNKFVIRRHLVQIINKIKRRNVNPSRATLNSINSFLM 472

>Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..3818)
           [1476 nt, 492 aa]
          Length = 491

 Score =  507 bits (1306), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 248/484 (51%), Positives = 349/484 (72%), Gaps = 17/484 (3%)

Query: 6   DQTINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKD 65
           D +IN ++++IKKEY+SL+NR+QSI+ D +FL++ V   FP++P+IPNERCG+WYC+PK 
Sbjct: 8   DYSINQIHKDIKKEYKSLKNRIQSILLDARFLEDTVIPFFPEFPVIPNERCGLWYCNPKL 67

Query: 66  YLQTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPI 125
           + QTSYFKSTDGH NQWDFS RRLNFHLLP LA +GGIV+VDSTRRGK++PDALSKTVPI
Sbjct: 68  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPI 127

Query: 126 WCAVLNSLLLE----YQGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGAD 181
           WCAVLNSL+LE          +VLF PP TV   E++RI  ++P L+ +  K+ I+ G+D
Sbjct: 128 WCAVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSD 187

Query: 182 IDRLFKGKILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQD 241
           + + F GK+LRP+W+ PG+SLL S  D FTGE  +  W T E E  IP++LCTVSY+ QD
Sbjct: 188 LYKQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWETPEDEEIIPIILCTVSYRAQD 247

Query: 242 GVDKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEP 301
           GVDKRHGFTYVQGAADDHELW+ GL  ++FW +I   ++++ S+  L+S VED +  ++ 
Sbjct: 248 GVDKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAKQK 307

Query: 302 NSAENGLSLDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNT--VTLS 359
             +E   +L+     D++T ++ LGKI+  + +G+ L  EL  K+S+VI+ S +  +++S
Sbjct: 308 EVSETE-TLEAFNPLDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLSVS 366

Query: 360 EDEAAIK----IFKLQSECKKSSKALRTELIKICPLAEAYLP-----NSLPMLVCCNTGK 410
           ++E  I     I +LQS  KKSSKALR  L ++    E +       + LP+L+CCN+G 
Sbjct: 367 KNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNSGT 426

Query: 411 DMSVCVSLAILCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVN 470
           DMS+ + L +LC++Y++  W+ +    ++KI I+KHL+K+I+ L+GRNVNP RA+LNSVN
Sbjct: 427 DMSIALVLMLLCKHYDL-DWNTSKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATLNSVN 485

Query: 471 AYLM 474
            YLM
Sbjct: 486 EYLM 489

>NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON}
           Anc_8.848 YMR283C
          Length = 504

 Score =  503 bits (1296), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 261/494 (52%), Positives = 341/494 (69%), Gaps = 33/494 (6%)

Query: 12  LNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYLQTSY 71
           +N++IKKEY+SLRNRLQSI+ D++FL++++ A FP+YPIIPNERCG+WY  P  Y QTSY
Sbjct: 13  INKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLWYVSPSQYNQTSY 72

Query: 72  FKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWCAVLN 131
           FKSTDGHTNQWDFS RRLNFHLL  +A S GI ++DSTRRGK++PDALSKT+PIWCAVLN
Sbjct: 73  FKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDALSKTIPIWCAVLN 132

Query: 132 SLLL-EYQGLEG-----EVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRL 185
            ++L E +G        + LF PP TV + E++ I  +IP LV K  K+ I+   ++   
Sbjct: 133 YIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDKLEIINANELIST 192

Query: 186 FKGKILRPLWVFPGASLLSSQRDPFTGE-VLSQKWHTAELENFIPVVLCTVSYQCQDGVD 244
           F GK+LRPLW++PG+S+L S RD FTGE   +  W     EN IP+VLCT+SYQ QDGVD
Sbjct: 193 FHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAP--ENIIPIVLCTISYQAQDGVD 250

Query: 245 KRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPNSA 304
           KR+GFTYVQGAADDHELW+ GLT ELFW HI+ L N   SD EL  +V   I  +  +SA
Sbjct: 251 KRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYVRHMIEMKIKDSA 310

Query: 305 ENG--LSLDQIL--YTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSE 360
                L++D I     D +T E+ LGKI +N+ + + ++ E +  +SLV+ILS TVTL+ 
Sbjct: 311 AKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSLVVILSETVTLNS 370

Query: 361 DEA------AIKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSLPMLVCCNTGKDMSV 414
           D+       ++KI+KL S  KKSSK LRTE+ KI  +    L N  P+L+CCNTG D+S+
Sbjct: 371 DDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMRENLTNGKPILICCNTGTDISI 430

Query: 415 CVSLAILCRNY-----NVGSW--------DLNVQ-QSIHKIDIKKHLSKIITKLEGRNVN 460
            + L ILC+NY     N  +W        D NV  + + K  I+K+L+ +I+ LEGRNVN
Sbjct: 431 GIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKNLTTLISHLEGRNVN 490

Query: 461 PPRASLNSVNAYLM 474
           P RA+LNSVN YLM
Sbjct: 491 PSRATLNSVNDYLM 504

>YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON}
           RIT12'-O-ribosyl phosphate transferase, modifies the
           initiator methionine tRNA at position 64 to distinguish
           it from elongator methionine tRNA
          Length = 513

 Score =  500 bits (1288), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 251/484 (51%), Positives = 343/484 (70%), Gaps = 22/484 (4%)

Query: 12  LNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYLQTSY 71
           +N++I+KE +S+RNRLQSI+ D+KFL ++V  +FP YP+IPNERCG+WYC+P  + QTSY
Sbjct: 31  INKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGLWYCNPSSFKQTSY 90

Query: 72  FKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWCAVLN 131
           FKSTDGH NQWDFS RRLNFHLL  +  + GI++VDSTRRGK++PDALSKTVPIWCAVLN
Sbjct: 91  FKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWCAVLN 150

Query: 132 SLLL---EYQGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRLFKG 188
           +L+L   E      +VL+ PP+TV + E++ IK +IP+LVAK +K+NI+    ++ LF G
Sbjct: 151 TLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLNIIDSKKLNELFMG 210

Query: 189 KILRPLWVFPGASLLSSQRDPFTGEVLS-QKWHTAELENFIPVVLCTVSYQCQDGVDKRH 247
           K+LRP+WV PG+SLL    D FTGEV   + W T E +N IP++LCTVSYQ QDG+DKR+
Sbjct: 211 KLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCTVSYQAQDGMDKRY 270

Query: 248 GFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPNSA--E 305
           GFTYVQGAADDHELW+ GL + +FW HI  L + + SD +L  ++ D    +  N    +
Sbjct: 271 GFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMDLAAAKLRNQCYIQ 330

Query: 306 NGLSLDQILYT-DILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSED--- 361
           +  SLD++    D +T E+ LGK+SS + + ++L ++L+ +Y  VII SN+VT++ED   
Sbjct: 331 DKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVIIFSNSVTVAEDTDD 390

Query: 362 ------EAAIKIFKLQSECKKSSKALRTELIKICPLAEAYLPNS----LPMLVCCNTGKD 411
                 +  I I+KLQS  KKSSKALR+   +I    ++   N      PML+CCNTG D
Sbjct: 391 EEESGTDPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEKIKPMLICCNTGTD 450

Query: 412 MSVCVSLAILCRNYNVGSWDLNVQ-QSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVN 470
           MS+ V L+ILC  Y    W L  +   I K+ ++KHL+K+I+ L+GRNVNP RA+LNSVN
Sbjct: 451 MSIGVILSILCTKY-TEEWMLTSELPDISKLIVRKHLTKLISHLKGRNVNPSRATLNSVN 509

Query: 471 AYLM 474
           ++LM
Sbjct: 510 SFLM 513

>Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  498 bits (1282), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 249/484 (51%), Positives = 341/484 (70%), Gaps = 22/484 (4%)

Query: 12  LNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYLQTSY 71
           +NR+++KE +S+RNRLQSI+ D+KFL ++V  VFP +P++PNERCG+WYC P  Y QTSY
Sbjct: 12  INRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWYCKPSTYKQTSY 71

Query: 72  FKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWCAVLN 131
           FKSTDGH NQWDFS RRLNFHLL  +  + GI++VDSTRRGK++PDALSKTVPIWCAVLN
Sbjct: 72  FKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALSKTVPIWCAVLN 131

Query: 132 SLLLEYQGLEGEV---LFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRLFKG 188
           +++L+      ++   L+ PP+TV + E++ IK +IP+LV K +K+NI+    ++ LF G
Sbjct: 132 TIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNIIDSKKLNELFMG 191

Query: 189 KILRPLWVFPGASLLSSQRDPFTGEVLS-QKWHTAELENFIPVVLCTVSYQCQDGVDKRH 247
           KILRP+WV PG+SLL+   D FTGE+   + W T E +N IP++LCTVSYQ QDG+DKR+
Sbjct: 192 KILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVSYQAQDGMDKRY 251

Query: 248 GFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPNSA--E 305
           GFTYVQGAADDHELW+ GL +++FW H+  L + N SD +L  ++ D +  +  +    +
Sbjct: 252 GFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLVAKKLKSQMYIQ 311

Query: 306 NGLSLDQIL-YTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSEDEAA 364
           +   LD+I    D +T+E+ LGK+   + + E L +EL+ +Y  V+ILS++VT++ED   
Sbjct: 312 DKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILSDSVTVAEDAGV 371

Query: 365 ---------IKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSL----PMLVCCNTGKD 411
                    I ++KLQS  KKSSKALR+ L KI    E    N      PMLVCCNTG D
Sbjct: 372 VEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMRPMLVCCNTGTD 431

Query: 412 MSVCVSLAILCRNYNVGSWDLNVQ-QSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVN 470
           MS+ V L+ILC  Y    W L  +   ++KI I+KHL+K+I+ L GRNVNP RA+LNSVN
Sbjct: 432 MSIGVILSILCTKY-TEEWMLTQELPEVNKIIIRKHLTKLISHLHGRNVNPSRATLNSVN 490

Query: 471 AYLM 474
           ++LM
Sbjct: 491 SFLM 494

>Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  498 bits (1281), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 242/484 (50%), Positives = 346/484 (71%), Gaps = 22/484 (4%)

Query: 12  LNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYLQTSY 71
           +N+++++E +S+RNRLQSI+ D+KFL E+V ++FP +PI+PNERCG+WYC+P  + +TSY
Sbjct: 12  INKDVRRENKSVRNRLQSILLDNKFLQERVVSIFPHFPIVPNERCGLWYCEPSTFKRTSY 71

Query: 72  FKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWCAVLN 131
           FKSTDGH NQWDFS RRLNFHLL  +    GI+++DSTRRGK++PD+LSKTVPIWCAVLN
Sbjct: 72  FKSTDGHVNQWDFSTRRLNFHLLETIRDKKGIIIIDSTRRGKKIPDSLSKTVPIWCAVLN 131

Query: 132 SLLLEYQGLE---GEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRLFKG 188
           +++L+ +  +    +VL+ PP+TV + E++ IK +IP+LVAK KK+N++    ++ LF G
Sbjct: 132 TIMLQKEKEDVDIDKVLYVPPETVPKSEYDMIKRKIPELVAKLKKLNVVDSEKLNDLFMG 191

Query: 189 KILRPLWVFPGASLLSSQRDPFTGEVLSQK-WHTAELENFIPVVLCTVSYQCQDGVDKRH 247
           KILRP+WV PG+SLL+   D FTGE+  Q+ W   + +N IP++LCTVSYQ QDG+DKR+
Sbjct: 192 KILRPIWVHPGSSLLNHSVDYFTGELKEQETWEAPKDQNIIPIILCTVSYQAQDGMDKRY 251

Query: 248 GFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPN--SAE 305
           GFTYVQGAADDHELW+ GL +E+FW H+  L + + SD +L  ++ D +  +  N  S +
Sbjct: 252 GFTYVQGAADDHELWSFGLDSEMFWSHVDYLGDTDKSDDQLHDYITDLVAKKLENQLSIK 311

Query: 306 NGLSLDQILYT-DILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSED--- 361
           +  SLD+I    DI+T E+ LGK+   + +   L +EL+L+Y  VI+ S++V ++ED   
Sbjct: 312 DKGSLDEIFGNIDIITNEISLGKVIQGLTISVKLKQELKLRYDKVIVFSDSVAITEDTDH 371

Query: 362 ------EAAIKIFKLQSECKKSSKALRTELIKICPLAEAYLPN----SLPMLVCCNTGKD 411
                  + I +FKLQS  KKSSK LRT   +I    ++   N    + P+L+CCNTG D
Sbjct: 372 EEESSPNSFISVFKLQSGDKKSSKTLRTIFPRIHEELQSAFANRDGGTKPILICCNTGTD 431

Query: 412 MSVCVSLAILCRNYNVGSWDLNVQ-QSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVN 470
           MS+ V L+ILC  Y    W L  +   ++KI I++HL+K+I+ L GRNVNP RA+LNSVN
Sbjct: 432 MSIGVILSILCTKY-TEDWKLTPELPEVNKIIIRRHLTKLISHLRGRNVNPSRATLNSVN 490

Query: 471 AYLM 474
           ++LM
Sbjct: 491 SFLM 494

>KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 489

 Score =  497 bits (1280), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 261/495 (52%), Positives = 347/495 (70%), Gaps = 27/495 (5%)

Query: 1   MELTSDQTINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWY 60
           M+  + + I  +++E++KE +SL+NRLQSI+FD+ FL EQV   F  YP++PNERCG+WY
Sbjct: 1   MDKETLREIKEISKELRKEDKSLKNRLQSIIFDNNFLKEQVFPTF-QYPVVPNERCGLWY 59

Query: 61  CDPKDYLQTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALS 120
           CDPK Y  TSYFKSTDGH NQWDFS RRLNFHLLP L  +GG+V++DSTRRGK++PDALS
Sbjct: 60  CDPKIYDTTSYFKSTDGHMNQWDFSTRRLNFHLLPLLGENGGLVILDSTRRGKKIPDALS 119

Query: 121 KTVPIWCAVLNSLLLEYQG----LEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNI 176
           KTVPIWCAVLN L+LE  G     E E+LF PP TV E EF+R+ +++P+LV K KK++I
Sbjct: 120 KTVPIWCAVLNYLMLEADGKQWPFEEEILFVPPSTVPESEFDRMFAKLPELVQKLKKLDI 179

Query: 177 LTGADIDRLFKG--------KILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFI 228
           +   D+ +L K         K+LRP+WV+PG+SLL  + D F+GEV+    H     N I
Sbjct: 180 I---DVKKLRKSLQIEEGHDKLLRPIWVYPGSSLLQLKHDLFSGEVIENT-HWEPPSNII 235

Query: 229 PVVLCTVSYQCQDGVDKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQEL 288
           PV+LCTVSYQCQDG DKR+GFTYVQGAADDHELWA+ LT +LFW++I  L +I+ SD EL
Sbjct: 236 PVILCTVSYQCQDGTDKRYGFTYVQGAADDHELWAENLTPQLFWENIDELGDISKSDAEL 295

Query: 289 -ESFVEDKIHPQEPNSAENGLSLDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYS 347
            +S+    +  +  NS +    + ++L  D +T  LHLGKI+S   +    VK L  KYS
Sbjct: 296 KDSYNAVILRAKVQNSLDISGDISKMLEIDTITARLHLGKITSQFRITPKTVKYLNQKYS 355

Query: 348 LVIILSNTVTLSEDEA---AIKIFKLQSECKKSSKALRTELIKICPLAEAYL--PNS--- 399
            V++    ++++E      +I IF L S  KKSS+ LR+ LIKI  L E  L  P++   
Sbjct: 356 AVVLCHEAISVTEITELPRSIHIFPLPSGSKKSSRELRSHLIKINALIEEQLSRPDTAAN 415

Query: 400 LPMLVCCNTGKDMSVCVSLAILCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNV 459
           LP+L+ C++GKD+SV + L  LC+ YN+  W+L  Q S++K  IKKHL+KII  L+GRNV
Sbjct: 416 LPILIACDSGKDISVSILLVALCKYYNL-DWELQPQDSVNKTIIKKHLAKIIESLQGRNV 474

Query: 460 NPPRASLNSVNAYLM 474
           NP RASLNSVN++LM
Sbjct: 475 NPSRASLNSVNSFLM 489

>TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}
           Anc_8.848 YMR283C
          Length = 493

 Score =  493 bits (1269), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 252/496 (50%), Positives = 344/496 (69%), Gaps = 27/496 (5%)

Query: 3   LTSDQTINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCD 62
           +  D ++N + ++I+KE +SL+NR+ SI+ D KFLDE+V   FP YP++PNERCG+WYC 
Sbjct: 1   MVDDASVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCK 59

Query: 63  PKDYLQTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKT 122
             ++  TSYFKSTDGH NQWDFS RRLNFHL+P +    GI+++DSTRRGK++PDALSKT
Sbjct: 60  RANFTTTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKT 119

Query: 123 VPIWCAVLNSLLLEY----QGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILT 178
           VPIWCAVLN+++L++    +    EVLF PP TVS+ E+ERIK++IP+LV K  K++++ 
Sbjct: 120 VPIWCAVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVID 179

Query: 179 GADIDRLFKGKILRPLWVFPGASLLSSQRDPFTGEVLSQ-KWHT-AELENFIPVVLCTVS 236
           G  +   F+G +LRP+W+ PG+S+L SQ DPFTGE++S   W   ++ E  IP+VLCTVS
Sbjct: 180 GKKLYEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNSSWEEPSKEEKIIPIVLCTVS 239

Query: 237 YQCQDGVDKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKI 296
           YQ QDGVD R GFTYVQGAADDHELW+ GL+ +LFW +I +L+N+ LS++ LE +VE+ I
Sbjct: 240 YQVQDGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIELLNNLELSEEMLEDYVEE-I 298

Query: 297 HPQEPNSAENGLSLDQILYT-DILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNT 355
              E     N L +D +  + D +TEEL+LG I   + + ++L++     YSLVIILSN+
Sbjct: 299 LLSESMKITN-LEVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNS 357

Query: 356 VTLSEDEA-------------AIKIFKLQSECKKSSKALRTELIKICPLAEAYLPNS--- 399
           + L+ DE               IK+F+LQS  KKSSK LR+ L +IC L    L +S   
Sbjct: 358 IKLASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGST 417

Query: 400 -LPMLVCCNTGKDMSVCVSLAILCRNYNVGSWDLNVQQSIHKIDIKKHLSKIITKLEGRN 458
             P+LVCCN G DMS+ V L  L + Y       +    I+KI I+KHL+K+I+ L GRN
Sbjct: 418 KKPILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTEINKITIRKHLTKVISHLGGRN 477

Query: 459 VNPPRASLNSVNAYLM 474
           VNP RA+LNSVN +LM
Sbjct: 478 VNPSRATLNSVNDFLM 493

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score =  491 bits (1263), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 247/484 (51%), Positives = 341/484 (70%), Gaps = 22/484 (4%)

Query: 12  LNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYLQTSY 71
           +N++++KE +S+RNRLQSI+ D++FL ++V  +FP +PI+PNERCG+WYC+P  + QTSY
Sbjct: 28  INKDVRKENKSVRNRLQSILLDNRFLRDRVLPIFPRFPIVPNERCGLWYCEPSSFEQTSY 87

Query: 72  FKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWCAVLN 131
           FKSTDGH NQWDFS RRLNFHLL  +  + GI++VDSTRRGK++PDALSKTVPIWCAVLN
Sbjct: 88  FKSTDGHVNQWDFSTRRLNFHLLEIIQENKGIIIVDSTRRGKKIPDALSKTVPIWCAVLN 147

Query: 132 SLLLEYQGLE---GEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRLFKG 188
           +++L+         +VL+ PP+TV + E++ IK +IP+LV K +K+N +    +++LFKG
Sbjct: 148 TIMLQETEENVDIDKVLYVPPETVPKSEYDMIKRKIPELVDKLQKLNAIDSKTLNKLFKG 207

Query: 189 KILRPLWVFPGASLLSSQRDPFTGEVLSQK-WHTAELENFIPVVLCTVSYQCQDGVDKRH 247
           KILRP+WV PG+SLL+   D FTGE+  Q+ W + E +N IP++LCTVSYQ QDG+DKR+
Sbjct: 208 KILRPIWVHPGSSLLNHSVDCFTGEIEEQEIWESPEDQNIIPIILCTVSYQAQDGMDKRY 267

Query: 248 GFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPN--SAE 305
           GFTYVQGAADDHELW+ GL +++FW HI  L + N SD +L +++ D I  +     S +
Sbjct: 268 GFTYVQGAADDHELWSFGLDSKMFWSHIDYLGDTNNSDDQLCAYITDLIGKKLEYQLSIQ 327

Query: 306 NGLSLDQILYT-DILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTL------ 358
           +  +LD I    D +T E+ LGK+   + + E L KEL++ Y  VII SN+V +      
Sbjct: 328 DKGNLDDIFENIDKITNEISLGKVIQGLTINEKLEKELKVHYEKVIIFSNSVAIAAHADS 387

Query: 359 ---SEDEAAIKIFKLQSECKKSSKALRTELIKICPLAEAYLPNSL----PMLVCCNTGKD 411
              S  ++ I ++KLQS  KKSSKALR+    I    +    N      P+LVCCNTG D
Sbjct: 388 VEESRTDSFISVYKLQSGDKKSSKALRSTFPMIHQEVQPVFANPAKGMKPILVCCNTGTD 447

Query: 412 MSVCVSLAILCRNYNVGSWDLNVQ-QSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVN 470
           MS+ V L+ILC  YN   W L  +   ++KI I+KHL+K+I+ L GRNVNP RA+LNSVN
Sbjct: 448 MSIGVILSILCAKYN-EEWILTSELPVVNKIIIRKHLTKLISHLHGRNVNPSRATLNSVN 506

Query: 471 AYLM 474
           ++LM
Sbjct: 507 SFLM 510

>KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {ON}
           Anc_8.848 YMR283C
          Length = 483

 Score =  487 bits (1253), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 256/483 (53%), Positives = 337/483 (69%), Gaps = 18/483 (3%)

Query: 8   TINFLNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYL 67
           +++ + ++IK EYRSL+NRLQSI+ D+ FL+ +V   FP+YPIIPNERCG+WYCDPK + 
Sbjct: 3   SLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKHFE 62

Query: 68  QTSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWC 127
           QTSYFKSTDGH NQWDFS RRLNFHLLP LA S GI++VDSTRRGK++PDALSKT+PIWC
Sbjct: 63  QTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPIWC 122

Query: 128 AVLNSLLLEYQGLEG----EVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADID 183
           AVLN L+LE+   E     +VLF PP TVS  E+ RI  +I +LV K K + +L   ++ 
Sbjct: 123 AVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKELY 182

Query: 184 RLFKGKILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQDGV 243
            +  GK++RP WV+PG+SLL +  DPFTGE   ++W   E EN IP++LCTVSYQ QDGV
Sbjct: 183 NMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQDGV 242

Query: 244 DKRHGFTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPNS 303
           DKR GF YVQGAADDHELW+ GL  + FW++I  L++I  +D  L+ FV D +  +E + 
Sbjct: 243 DKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFV-DTLTLEENHE 301

Query: 304 AENGLSLDQILYT-DILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLSEDE 362
            +   S+  I  + + +T E+ LGKI  N  +   L  EL  K+SLVIILS T+ +++ E
Sbjct: 302 KKASSSIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEITKLE 361

Query: 363 AA----IKIFKLQSECKKSSKALRTELIKICPLAEAYLPNS-----LPMLVCCNTGKDMS 413
            A    IK+FKLQS  KKSSK+LR +L +I      Y  ++      P+L+CCN+G DMS
Sbjct: 362 EATTKIIKLFKLQSGSKKSSKSLRLQLPEIFDTINPYFQDASNLAKKPILICCNSGNDMS 421

Query: 414 VCVSLAILCRNYNVGSWDLNVQQS--IHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNA 471
           V V L IL + Y+ G W L       I K  I+KHL+K+I+ L+GRNVNP RA+LNS+N+
Sbjct: 422 VAVILTILSKKYSEG-WQLETSDDLLISKTVIRKHLAKLISSLQGRNVNPSRATLNSINS 480

Query: 472 YLM 474
           YLM
Sbjct: 481 YLM 483

>AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR283C
           (RIT1)
          Length = 408

 Score =  417 bits (1072), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 202/408 (49%), Positives = 281/408 (68%), Gaps = 6/408 (1%)

Query: 69  TSYFKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWCA 128
           T YFKSTDGH N WDFS+RRLNFHLLP LA   G ++VDSTRRGK++PDALSKT+PIWCA
Sbjct: 5   TCYFKSTDGHVNGWDFSVRRLNFHLLPLLAERSGAIIVDSTRRGKKIPDALSKTIPIWCA 64

Query: 129 VLNSLLLEYQGLEGEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRLFKG 188
           VLN+L+LE+    GEVLFCPP TVS+ E+ RI++++P+LV K K+++ ++GA++  L  G
Sbjct: 65  VLNTLILEHTEGSGEVLFCPPGTVSQLEYNRIQAKLPELVQKLKRVDAISGAELCSLLGG 124

Query: 189 KILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQDGVDKRHG 248
           ++LRP WV+PGA++L + RD FTGE L + W        IP++LCT S QCQDGVDK  G
Sbjct: 125 RLLRPFWVYPGAAMLGTTRDLFTGESLQEPWQPP--PGVIPLILCTASRQCQDGVDKSQG 182

Query: 249 FTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPNSAENGL 308
           + YVQGAADDHELWA GLT  LFW ++ +L++ ++ +Q L+  VE  +   +    E   
Sbjct: 183 YAYVQGAADDHELWANGLTPSLFWANVQLLADDSMPEQLLQGHVERIVELHKSTHTEAVA 242

Query: 309 SLDQILYTDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTLS--EDEAAIK 366
                  TD++TE L LG ++    + +   + L  +YSLV++  +++ LS       I+
Sbjct: 243 HELPCRETDVVTEHLRLGSVAP-CQISDKQAELLEQQYSLVVLCGSSIELSAAAPHPRIR 301

Query: 367 IFKLQSECKKSSKALRTELIKICPLAEAYLPNSLPMLVCCNTGKDMSVCVSLAILCRNYN 426
           I+ L S CKKSS+ALR  LI+I PL    L  +LP+L+CC++G D+SV + LA LC+NY+
Sbjct: 302 IYPLNSGCKKSSRALRPALIEIIPLISTALCEALPVLICCSSGSDISVGIVLAALCKNYD 361

Query: 427 VGSWDLNVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM 474
           +  W    Q+ + K  IKKHL K+ +K+ GR +NP R +LNSVNA+LM
Sbjct: 362 L-EWRHEDQKDMTKTIIKKHLIKLTSKIHGRIINPSRTTLNSVNAFLM 408

>NDAI0F03680 Chr6 complement(872773..874764) [1992 bp, 663 aa] {ON}
           Anc_2.32 YDL233W
          Length = 663

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 32/70 (45%), Gaps = 12/70 (17%)

Query: 213 EVLSQKWHTAELEN---FIPVVLCTVSYQCQDGVDKRHGFTYVQGAADDHELWAQGLTAE 269
           EV++QK HT  L N   +     CT +Y  QDG    H FT ++G  D         T  
Sbjct: 388 EVIAQKLHTQTLSNGTVYFGSPCCTFAYHYQDGSYVTH-FTQIKGVLD--------RTLR 438

Query: 270 LFWKHISILS 279
           L W  +++ S
Sbjct: 439 LAWIDLTVFS 448

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,177,338
Number of extensions: 2170718
Number of successful extensions: 6145
Number of sequences better than 10.0: 27
Number of HSP's gapped: 6229
Number of HSP's successfully gapped: 27
Length of query: 474
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 361
Effective length of database: 40,524,141
Effective search space: 14629214901
Effective search space used: 14629214901
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)