Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03674g8.853ON94894850480.0
Kwal_27.102138.853ON93693330670.0
SAKL0D01078g8.853ON93693424680.0
YMR287C (DSS1)8.853ON96995120150.0
Skud_13.4608.853ON96992920050.0
ZYRO0C14938g8.853ON96693319880.0
Suva_13.4778.853ON96991519720.0
Smik_13.5038.853ON96991319600.0
TDEL0B002208.853ON93590819140.0
KNAG0E011408.853ON92990617870.0
KAFR0L019708.853ON93290917130.0
CAGL0M07051g8.853ON92393616320.0
NCAS0C003008.853ON94094016320.0
TBLA0B029208.853ON102998815720.0
NDAI0K003208.853ON96292215400.0
AFR448W8.853ON81782315110.0
TPHA0I003508.853ON94392214860.0
Kpol_237.48.853ON91682014770.0
KLLA0C06314g8.853ON98391114690.0
TBLA0D050701.367ON9974441254e-06
Kpol_1043.421.367ON9884341122e-04
NDAI0C040505.307ON12604141093e-04
ZYRO0G01166g1.367ON9934351068e-04
TDEL0D023801.367ON9974351020.002
NDAI0H035601.367ON10124401020.002
NCAS0D005901.367ON9984421000.004
Skud_15.1371.367ON1030443980.006
KLTH0H13420g1.367ON986441960.012
KAFR0C045301.367ON1000434950.014
CAGL0H04411g1.367ON1007448950.015
TPHA0A023201.367ON1015435940.017
Ecym_27151.367ON988433910.040
KNAG0C019501.367ON996466890.067
SAKL0D10186g1.367ON988445890.071
Kwal_23.57055.307ON122869860.19
NCAS0F025705.307ON124542850.21
Kpol_1023.505.307ON1253298850.22
Smik_15.1451.367ON1001438850.24
Suva_15.1471.367ON1001433840.26
KAFR0E013905.307ON121742820.45
YOL021C (DIS3)1.367ON1001438820.52
TPHA0E013805.307ON121943781.3
Kwal_34.162451.367ON986444771.7
TPHA0D018205.307ON128742762.5
CAGL0H01287g5.307ON132442753.0
KLTH0G06248g5.307ON122568744.8
Skud_5.1637.224ON49357735.2
YDR216W (ADR1)8.425ON132380726.7
KLTH0D14036g4.235ON69364719.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03674g
         (948 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {...  1949   0.0  
Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {...  1186   0.0  
SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar ...   955   0.0  
YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON} ...   780   0.0  
Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {...   776   0.0  
ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]...   770   0.0  
Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {...   764   0.0  
Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {...   759   0.0  
TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}...   741   0.0  
KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {O...   692   0.0  
KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {...   664   0.0  
CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa] ...   633   0.0  
NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853...   633   0.0  
TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {...   610   0.0  
NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.85...   597   0.0  
AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic ...   586   0.0  
TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}...   577   0.0  
Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON} co...   573   0.0  
KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {...   570   0.0  
TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON} Anc_1...    53   4e-06
Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON} (83527....    48   2e-04
NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {...    47   3e-04
ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON...    45   8e-04
TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {O...    44   0.002
NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1....    44   0.002
NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON...    43   0.004
Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa] ...    42   0.006
KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} high...    42   0.012
KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1....    41   0.014
CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa] ...    41   0.015
TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {...    41   0.017
Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {O...    40   0.040
KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.3...    39   0.067
SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly...    39   0.071
Kwal_23.5705 s23 complement(1284606..1288292) [3687 bp, 1228 aa]...    38   0.19 
NCAS0F02570 Chr6 (516508..520245) [3738 bp, 1245 aa] {ON} Anc_5....    37   0.21 
Kpol_1023.50 s1023 (111088..114849) [3762 bp, 1253 aa] {ON} (111...    37   0.22 
Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa] ...    37   0.24 
Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa] ...    37   0.26 
KAFR0E01390 Chr5 (277260..280913) [3654 bp, 1217 aa] {ON} Anc_5....    36   0.45 
YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}...    36   0.52 
TPHA0E01380 Chr5 (278339..281998) [3660 bp, 1219 aa] {ON} Anc_5....    35   1.3  
Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {...    34   1.7  
TPHA0D01820 Chr4 complement(376666..380529) [3864 bp, 1287 aa] {...    34   2.5  
CAGL0H01287g Chr8 complement(123328..127302) [3975 bp, 1324 aa] ...    33   3.0  
KLTH0G06248g Chr7 (494464..498141) [3678 bp, 1225 aa] {ON} simil...    33   4.8  
Skud_5.163 Chr5 (251090..252571) [1482 bp, 493 aa] {ON} YER051W ...    33   5.2  
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    32   6.7  
KLTH0D14036g Chr4 (1144430..1146511) [2082 bp, 693 aa] {ON} weak...    32   9.8  

>KLTH0C03674g Chr3 complement(317119..319965) [2847 bp, 948 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 948

 Score = 1949 bits (5048), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 936/948 (98%), Positives = 936/948 (98%)

Query: 1   MIELISGSMDFTQQKTMVRHFHRALRALKKSPETLKSLDNIPGPAKFVYQRPGQLEPGVE 60
           MIELISGSMDFTQQKTMVRHFHRALRALKKSPETLKSLDNIPGPAKFVYQRPGQLEPGVE
Sbjct: 1   MIELISGSMDFTQQKTMVRHFHRALRALKKSPETLKSLDNIPGPAKFVYQRPGQLEPGVE 60

Query: 61  IKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLNMDLTSLSSKQRADMNDSL 120
           IKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLNMDLTSLSSKQRADMNDSL
Sbjct: 61  IKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLNMDLTSLSSKQRADMNDSL 120

Query: 121 KPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVPTEVTNPSYAFATID 180
           KPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVPTEVTNPSYAFATID
Sbjct: 121 KPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVPTEVTNPSYAFATID 180

Query: 181 GHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFLNTRIGAVKDSPEKTFMLSIVARQLYT 240
           GHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFLNTRIGAVKDSPEKTFMLSIVARQLYT
Sbjct: 181 GHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFLNTRIGAVKDSPEKTFMLSIVARQLYT 240

Query: 241 SYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSIFKLCELVALLDIDKCQSSST 300
           SYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSIFKLCELVALLDIDKCQSSST
Sbjct: 241 SYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSIFKLCELVALLDIDKCQSSST 300

Query: 301 GSYIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLATYWSLVQQQEHNLWGQIHSHRA 360
           GSYIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLATYWSLVQQQEHNLWGQIHSHRA
Sbjct: 301 GSYIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLATYWSLVQQQEHNLWGQIHSHRA 360

Query: 361 MLTPISVTVLPLTSHHXXXXXXXXXXXXDNYAALESFAKLINTGERNSAKLQYPQISRLL 420
           MLTPISVTVLPLTSHH            DNYAALESFAKLINTGERNSAKLQYPQISRLL
Sbjct: 361 MLTPISVTVLPLTSHHLYYKEVLKELKKDNYAALESFAKLINTGERNSAKLQYPQISRLL 420

Query: 421 RDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLCHEFLQELTCESIPNPQLLSNEI 480
           RDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLCHEFLQELTCESIPNPQLLSNEI
Sbjct: 421 RDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLCHEFLQELTCESIPNPQLLSNEI 480

Query: 481 RSPSTSERAVLEQKIYDLALPNQNDDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGE 540
           RSPSTSERAVLEQKIYDLALPNQNDDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGE
Sbjct: 481 RSPSTSERAVLEQKIYDLALPNQNDDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGE 540

Query: 541 NAYTLHIHIADPVSLFSNSQEGSFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLG 600
           NAYTLHIHIADPVSLFSNSQEGSFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLG
Sbjct: 541 NAYTLHIHIADPVSLFSNSQEGSFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLG 600

Query: 601 KDGIASKTLSFSVDIRCRKNNVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQ 660
           KDGIASKTLSFSVDIRCRKNNVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQ
Sbjct: 601 KDGIASKTLSFSVDIRCRKNNVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQ 660

Query: 661 TQELRTLHKIALLLRSKRVKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETAST 720
           TQELRTLHKIALLLRSKRVKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETAST
Sbjct: 661 TQELRTLHKIALLLRSKRVKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETAST 720

Query: 721 VLVSEIMILANTMAGKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKD 780
           VLVSEIMILANTMAGKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKD
Sbjct: 721 VLVSEIMILANTMAGKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKD 780

Query: 781 IAKLSSLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSE 840
           IAKLSSLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSE
Sbjct: 781 IAKLSSLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSE 840

Query: 841 DQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRC 900
           DQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRC
Sbjct: 841 DQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRC 900

Query: 901 VLPELSTARGILKLKPEASSTVAIGDVVHNCRITRLDCLDSIMELEMQ 948
           VLPELSTARGILKLKPEASSTVAIGDVVHNCRITRLDCLDSIMELEMQ
Sbjct: 901 VLPELSTARGILKLKPEASSTVAIGDVVHNCRITRLDCLDSIMELEMQ 948

>Kwal_27.10213 s27 complement(243200..246010) [2811 bp, 936 aa] {ON}
           YMR287C (MSU1) - component of 3'-5'exonuclease complex
           [contig 39] FULL
          Length = 936

 Score = 1186 bits (3067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 554/933 (59%), Positives = 712/933 (76%), Gaps = 2/933 (0%)

Query: 17  MVRHFHRALRALKKSPETLKSLDNIPGPAKFVYQRPGQLEPGVEIKQLSHIQKGLDERFY 76
           M R FH   +AL++ P  ++S+ N+P  AK +Y+R GQLEPGVEIKQLS IQ GL++R+Y
Sbjct: 3   MYRSFHSGCKALRRGPGPVRSVQNVPDSAKIIYKRAGQLEPGVEIKQLSEIQSGLNDRYY 62

Query: 77  NQHFLPSKNWCRDNAVNWANMKDYLNMDLTSLSSKQRADMNDSLKPEVFDSESGTFRMHP 136
            Q+ +PSK WCRDN   W  MK+YLNMDL SLS KQ+ADM+ SL+P+V+D  S TFR+ P
Sbjct: 63  EQYLIPSKEWCRDNGTKWGGMKNYLNMDLMSLSEKQQADMDASLEPKVYDKTSETFRLVP 122

Query: 137 SHLLDSSLKIGDLVLLRSDPSQLCMCVEVPTEVTNPSYAFATIDGHIRFGERNMILLRIP 196
             LL S LKIGDLVLLRS+P+QLC CVEVPT+V NPSYAFATIDG I++  R+MILLRIP
Sbjct: 123 KELLKSPLKIGDLVLLRSNPTQLCTCVEVPTDVMNPSYAFATIDGQIKYAMRSMILLRIP 182

Query: 197 SFHKAAAKYLIKEEVPFLNTRIGAVKDSPEKTFMLSIVARQLYTSYVPFEITKAAWNRMG 256
           SFH+ +A +LI+EE P+L+ RIG VKDSPEKTF+L I+ARQLYTSY PF+ITK AW+RM 
Sbjct: 183 SFHRRSAHHLIREEKPYLDARIGTVKDSPEKTFILPILARQLYTSYAPFKITKQAWSRMA 242

Query: 257 VTTKKLELLHRFLQRSTGPWQMSIFKLCELVALLDIDKCQSSSTGSYIEGILKEAGMFRD 316
           + T+KLELLHRFLQRS+GPWQ+SIFKLC++  +LD++K +SS   SYI+ + ++ G+   
Sbjct: 243 ILTQKLELLHRFLQRSSGPWQVSIFKLCQMAVMLDLEKFRSSHAESYIKELFQKLGLNGS 302

Query: 317 AHPIESFSG--RSLKSIDASDFLATYWSLVQQQEHNLWGQIHSHRAMLTPISVTVLPLTS 374
            +  +  SG    ++S+DA+D+LAT+W+L QQQE+NLWGQ  +H+AML P+SVTVLPL S
Sbjct: 303 PNSFQKQSGNLHYIESVDAADYLATFWALEQQQENNLWGQFQTHQAMLAPLSVTVLPLAS 362

Query: 375 HHXXXXXXXXXXXXDNYAALESFAKLINTGERNSAKLQYPQISRLLRDYAAGNFHNNGPI 434
            H            DN+  +  FA L+N+G    A  + PQ  ++L+DYAAGNFHNNG +
Sbjct: 363 RHLYYETVLKDLKKDNHRLITKFAGLVNSGNFTGADSEVPQFKQILKDYAAGNFHNNGAM 422

Query: 435 ITIVSKLFRKLDKYQNNDITRDLCHEFLQELTCESIPNPQLLSNEIRSPSTSERAVLEQK 494
            T+VSKLFR +D ++  DITRDLCHE +++L+  +  NP LLS+++  PS+S    LE+K
Sbjct: 423 ATVVSKLFRSIDVFKGRDITRDLCHELMEKLSHRNTLNPLLLSDDLALPSSSANTALEEK 482

Query: 495 IYDLALPNQNDDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVS 554
           IY++A P+  +DI  R DF  MNVYCIDSE+AHEIDDGISIE  G NA+TLHIHIADPVS
Sbjct: 483 IYEMAQPSTKEDIPARFDFSSMNVYCIDSESAHEIDDGISIEPLGRNAFTLHIHIADPVS 542

Query: 555 LFSNSQEGSFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVD 614
           LF+      F+ E+WNIA +RGFT+YLPD V PMLP+S+  AG LG +   SKT+SFSV+
Sbjct: 543 LFTEDGGTKFNDEVWNIAYRRGFTTYLPDLVLPMLPQSFCLAGSLGINNGKSKTVSFSVN 602

Query: 615 IRCRKNNVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLL 674
           I+     + I EE+F V+LG  ++FP+VTY  VDRIL    D +Q+ +ELRTL++I+LLL
Sbjct: 603 IKMHDGGLRIDEESFKVRLGYATKFPKVTYDSVDRILQQNNDKTQEAKELRTLYQISLLL 662

Query: 675 RSKRVKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILANTMA 734
           +SKR+ EQ AIIFGEGFNRGLVKL   ++     + FEDQ +T STVLVSE+MILANT+A
Sbjct: 663 QSKRINEQRAIIFGEGFNRGLVKLNEGESGRLDKIGFEDQSQTPSTVLVSEMMILANTLA 722

Query: 735 GKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYS 794
           G++F+   IPGVFRCYK L LK  AR+ Y SLR M  S   P+ +DIAKLSSLLNSSFY+
Sbjct: 723 GRYFQVNKIPGVFRCYKELLLKSGARESYESLRAMTQSTSLPAVEDIAKLSSLLNSSFYT 782

Query: 795 ARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRD 854
              ++H MIGAPAYL VTSPLRRF DL+NH Q+  +L   PL FS+  + ++ WH+QSRD
Sbjct: 783 GTPDRHSMIGAPAYLTVTSPLRRFPDLINHLQIRQHLTQNPLPFSKLDIDEMIWHLQSRD 842

Query: 855 VVLRKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKL 914
           +V+RKAARDSASFWTL HLKS Q+ +P R++SVMVTS+PR+G VRCVLP+LS ARGILKL
Sbjct: 843 LVIRKAARDSASFWTLKHLKSLQDSSPDRKISVMVTSIPRMGFVRCVLPDLSAARGILKL 902

Query: 915 KPEASSTVAIGDVVHNCRITRLDCLDSIMELEM 947
           KPE S+ VAIGD++HNC IT+LDCLD++MEL+M
Sbjct: 903 KPEVSADVAIGDLMHNCVITKLDCLDAVMELKM 935

>SAKL0D01078g Chr4 (78360..81170) [2811 bp, 936 aa] {ON} similar to
           uniprot|P39112 Saccharomyces cerevisiae YMR287C MSU1
           RNase component of the mitochondrial degradosome along
           with the ATP-dependent RNA helicase Suv3p the
           degradosome associates with the ribosome and mediates
           turnover of aberrant or unprocessed RNAs
          Length = 936

 Score =  955 bits (2468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/934 (50%), Positives = 639/934 (68%), Gaps = 14/934 (1%)

Query: 20  HFHRALRALKKSPETLKSLDNIPGPAKFVYQRPGQLEPGVEIKQLSHIQKGLDERFYNQH 79
           H  R LR  +K     +S DN+    K  +     LEP VEIKQLS +++  D R+Y+++
Sbjct: 8   HTTRLLR--RKVASGDRSKDNL---EKIFFSHAKDLEPEVEIKQLSQVRQDSDNRYYHRY 62

Query: 80  FLPSKNWCRDNAVNWANMKDYLNMDLTSLSSKQRADMNDSLKPEVFDSESGTFRMHPSHL 139
           F PSK W   N     + K + N+D    S K    +  +L   ++D  S TF + PS L
Sbjct: 63  FTPSKIWFTQNVSRTQSFKHFFNLDPQRSSDKY---ILPTLNERLYDKGSHTFYLSPSDL 119

Query: 140 LDSSLKIGDLVLLRSDPSQLCMCVEVPTEVTNPSYAFATIDGHIRFGERNMILLRIPSFH 199
           +++ LKIGDLVLLRS+P+QL MCV++PT++ +P Y FA++DG ++F  R MI+LRIPS H
Sbjct: 120 MNTPLKIGDLVLLRSNPTQLSMCVDLPTDIMDPRYTFASMDGGLQFAARTMIMLRIPSCH 179

Query: 200 KAAAKYLIKEEVPFLNTRIGAVKDSPEKTFMLSIVARQLYTSYVPFEITKAAWNRMGVTT 259
           K     L++ E       IG VK+SP  T++L I+ARQL TSYVPFEITK AWN++ + +
Sbjct: 180 KQELDGLVQLERKHSYEPIGVVKNSPTHTYVLPILARQLITSYVPFEITKKAWNQVPIVS 239

Query: 260 KKLELLHRFLQRSTGPWQMSIFKLCELVALLDIDKCQSSSTGS---YIEGILKEAGMFRD 316
           KKLELLHRFLQRSTGPWQ+SIF LCELV  LD+ +  S   GS   Y+  + ++ G+  +
Sbjct: 240 KKLELLHRFLQRSTGPWQISIFTLCELVQNLDLQRALSKQDGSLQDYMSSLFQKVGLDSN 299

Query: 317 AHPI--ESFSGRSLKSIDASDFLATYWSLVQQQEHNLWGQIHSHRAMLTPISVTVLPLTS 374
            + +  ++        IDAS FL+TYWSLV+QQE  +WG I +HR +LTPISVTVLPL S
Sbjct: 300 LYCLGEQNLHVNPPNKIDASYFLSTYWSLVKQQELQIWGGIQTHRGILTPISVTVLPLNS 359

Query: 375 HHXXXXXXXXXXXXDNYAALESFAKLINTGERNSAKLQYPQISRLLRDYAAGNFHNNGPI 434
            H            DNY  L+ FA+L+N       + ++PQ+ ++L++YAAGNF+NNG +
Sbjct: 360 EHLYYENVVSTLKQDNYRMLDEFAELVNKKNYKPIQNRFPQLIQILKNYAAGNFNNNGAM 419

Query: 435 ITIVSKLFRKLDKYQNNDITRDLCHEFLQELTCESIPNPQLLSNEIRSPSTSERAVLEQK 494
           IT+VSK+FRKL  Y+  D TRD+CHE L +++ + + NP LL+ ++  P  S+R+ LEQ 
Sbjct: 420 ITLVSKIFRKLHTYKERDTTRDMCHELLTQISPDKLINPLLLNKDLGLPMASQRSALEQV 479

Query: 495 IYDLALPN-QNDDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPV 553
           +YD++ P    DD   RHDFG M VYCIDSETAHEIDDGISIE   E  Y LHIHIADP 
Sbjct: 480 VYDISKPPLTEDDSYVRHDFGDMPVYCIDSETAHEIDDGISIETLSEKKYRLHIHIADPA 539

Query: 554 SLFSNSQEGSFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSV 613
           S F+ S +     ++ +IA QR FT+YLPD V PMLP+SY +A DLGKDG  +KTLSFS+
Sbjct: 540 SSFAKSTDPEARDDVLDIAFQRSFTTYLPDMVLPMLPESYCRAADLGKDGNKTKTLSFSI 599

Query: 614 DIRCRKNNVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALL 673
           DI   +  + +L++TF ++LGLVS+FPRVTY+ VD +L   +   ++  +L+ ++++A  
Sbjct: 600 DIYFHQGTLRLLDDTFKMRLGLVSRFPRVTYEKVDILLQYPEKQPKEASDLKLMYEVAKS 659

Query: 674 LRSKRVKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILANTM 733
           LR+KRVK Q+AIIFGEGFN+GLVKL P +T   T +SFEDQ E+ STVLVSE+MILANT+
Sbjct: 660 LRAKRVKNQDAIIFGEGFNKGLVKLSPDETGELTKISFEDQVESKSTVLVSEMMILANTL 719

Query: 734 AGKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFY 793
            G +F+   IPGVFRCY  LQLKD A + Y  +++M  S +FP+ +DI  +SSLLNSSFY
Sbjct: 720 TGGYFKKNKIPGVFRCYNELQLKDRALKEYTKMKEMTKSGQFPTIRDINTISSLLNSSFY 779

Query: 794 SARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSR 853
           + + +KHEMIGA  YL VTSPLRRF D++NH Q+H +L G PL FS+ +V  + WHIQSR
Sbjct: 780 TGKPKKHEMIGASEYLTVTSPLRRFPDMINHLQIHRHLRGLPLCFSQQEVDGITWHIQSR 839

Query: 854 DVVLRKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILK 913
           DVVL+ AAR SA++WTL  LK++ E     R +VMVTSVP +G V C  P L+ ARG L 
Sbjct: 840 DVVLKNAARMSATYWTLKFLKNELEKKKDIRFTVMVTSVPHMGTVSCAFPNLNAARGTLN 899

Query: 914 LKPEASSTVAIGDVVHNCRITRLDCLDSIMELEM 947
           L P+ +   AIGD++H C++T+LDCLD ++ELE+
Sbjct: 900 LDPKHTPYPAIGDLIHKCKLTKLDCLDGVIELEI 933

>YMR287C Chr13 complement(842436..845345) [2910 bp, 969 aa] {ON}
           DSS13'-5' exoribonuclease, component of the
           mitochondrial degradosome along with the ATP-dependent
           RNA helicase Suv3p; the degradosome associates with the
           ribosome and mediates turnover of aberrant or
           unprocessed RNAs
          Length = 969

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/951 (43%), Positives = 585/951 (61%), Gaps = 61/951 (6%)

Query: 26  RALKKSPETLKSLDNIPGPAKFV-------YQRPGQLEPGVEIKQLSHIQKGLDERFYNQ 78
           R L     T   +D   GP K +        QR   LEP +E+KQL  I++  ++R+ ++
Sbjct: 48  RELDNDQATETVVDRSVGPEKDIESINKDFLQRTKGLEPDIELKQLPQIKQEFNQRYKDR 107

Query: 79  HFLPSKNWCRDNAVNWANMK----DYLNMDLTSLSSKQRADMNDSLKPEVFDSESGTFRM 134
           +  PS++W  ++  +    K      +N D   L +K +A                    
Sbjct: 108 YVKPSEDWYVNSWRSLTKPKIPLYKLINSDF-QLITKLKA--------------PNPMEF 152

Query: 135 HPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVPTEVTNPSYAFATIDGHIRFGERNMILLR 194
            P  L++S L +GD VLL+  P++L MCV +P+   +P Y F TIDG + F  +N +LLR
Sbjct: 153 QPVQLMESPLNVGDFVLLKMRPNELAMCVSLPSSTMDPRYTFVTIDGTMCFATKNRVLLR 212

Query: 195 IPSFHKAAAKYLIKEEVPFLNTRIGAVKDSPEKTFMLSIVARQLYTSYVPFEITKAAWNR 254
           IP    A    LI+ E    +  IG VK+   +T +L IVARQL TS  P +I+K AW  
Sbjct: 213 IPHKLPAGIHSLIQPESHHKHLPIGTVKNFSNQTNILPIVARQLITSRYPAQISKLAWKD 272

Query: 255 MGVTTKKLELLHRFLQRSTGPWQMSIFKLCELVALLDIDKCQSSSTG-SYIEGILKEAGM 313
           + +TTKKL+LLHR LQ   GPWQ+  F L  LV  LD++K      G +Y+  ++     
Sbjct: 273 LPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQKLDLNKALDDKNGINYLTSLVNNYHT 332

Query: 314 FRDAHPIESFSGRSLKSIDASDFLATYWSLVQQQEHNLWGQIHSHRAMLTPISVTVLPLT 373
             D              I++  F++TYW+++QQQE NLWG+IH + A+L+PISVT++PL 
Sbjct: 333 VNDI------------PINSPTFVSTYWAIMQQQESNLWGEIHLNTALLSPISVTIIPLK 380

Query: 374 SHHXXXXXXXXXXXXDNYAALESFAKLINTGERNSAKLQYPQISRLLRDYAAGNFHNNGP 433
           S H            ++Y  +  F KL+N  +       YP + +LL+D+AAGNFHNNG 
Sbjct: 381 SQHLYYAQVIEKLEANSYREVNKFVKLVNERKYRDISALYPSVIQLLKDFAAGNFHNNGI 440

Query: 434 IITIVSKLFRKLDKYQNNDITRDLCHEFLQELTCESIPNPQLLSNEIRSPSTSERAVLEQ 493
           I+ ++SK+FRK+++Y++ DITRD+C + + E+T  SIPNP LL+ ++  P++S+    +Q
Sbjct: 441 IVALISKIFRKIERYKDCDITRDICQDLINEITPNSIPNPLLLNMDLALPASSKLVKWQQ 500

Query: 494 KIYDLA--------LPNQNDDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENA-YT 544
           K+YDL             +DD   R+DFG + V+CIDSETAHEIDDG+S++  G +  YT
Sbjct: 501 KLYDLTNIEELQWKKSGTDDD---RYDFGDLRVFCIDSETAHEIDDGVSVKNYGRDGLYT 557

Query: 545 LHIHIADPVSLFSNSQ----EGSFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLG 600
           L+IHIADP S+F  S     EG  S +I N+AL+R FT+YLPD V PMLP+S     DLG
Sbjct: 558 LYIHIADPTSMFPESTNVDIEG-ISTDILNVALKRSFTTYLPDTVVPMLPQSICHLSDLG 616

Query: 601 KDGIASKTLSFSVDIR----CRKNNVEILEETFSVKLGLVSQFPRVTYKVVDRILGL-EQ 655
           K G  +KT+SFSVD++    C   ++EI+ ++F ++ G+VS FP+ TY+ VDRILG    
Sbjct: 617 KQGQRTKTISFSVDVKITSKCSGKSIEIMYDSFKIRKGIVSNFPKATYEDVDRILGTPNS 676

Query: 656 DASQQTQELRTLHKIALLLRSKRVKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQE 715
           +AS   ++L +L  I+ LLR +R+K  NA+IFGEGFN+GLV L        T ++F DQE
Sbjct: 677 EASPVKKDLESLSMISKLLREQRIKNSNAVIFGEGFNKGLVMLNADSEGELTEVTFSDQE 736

Query: 716 ETASTVLVSEIMILANTMAGKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKF 775
           ET ST+LVSE+MILANT+ G++F +  I GVFRCYK L L + A+Q Y+S+        F
Sbjct: 737 ETLSTILVSEMMILANTLTGRYFAENKIGGVFRCYKQLPLGEVAQQQYDSMITSTKKGIF 796

Query: 776 PSAKDIAKLSSLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFP 835
           P  KDI KLSSLLNSSFY+ R  +HEMIGA  YL VTSPLRRF DL+NH Q+H +L   P
Sbjct: 797 PKLKDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKP 856

Query: 836 LKFSEDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRL 895
           L F++ Q+  L W IQSR  +L++A+R+S+++WTL +LK   +L P R   VMVTSVP+ 
Sbjct: 857 LCFNQTQIDSLIWPIQSRADILKRASRNSSTYWTLNYLKKLTKLEPERTFDVMVTSVPQN 916

Query: 896 GVVRCVLPELSTARGILKLKPEASSTVAIGDVVHNCRITRLDCLDSIMELE 946
           G   CV P+LS ARG LKL P +     IGD+V NC+I+++DCL+ ++ELE
Sbjct: 917 GFTGCVFPDLSFARGTLKLHPSSMHYPMIGDIVKNCKISKIDCLEGMLELE 967

>Skud_13.460 Chr13 complement(815990..818899) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  776 bits (2005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/929 (44%), Positives = 582/929 (62%), Gaps = 40/929 (4%)

Query: 34  TLKSLDNIPGPAKFVYQRPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVN 93
           ++KS  +I    K    R   LEP +E+KQLS I++   +R+ +++  PS+ W  ++  +
Sbjct: 63  SIKSAKDIESINKDFLHRTKGLEPNIELKQLSQIKEEFQQRYRDRYIKPSETWYTNSWRS 122

Query: 94  WANMKDYLNMDLTSLSSKQRADMNDSLKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLR 153
            A  K         +SS    + N  L  ++    S      P  L++  L +GDLVLLR
Sbjct: 123 LAKPK---------ISSHNLINSNIQLDAQL--KFSNPLEFQPVQLMERPLNVGDLVLLR 171

Query: 154 SDPSQLCMCVEVPTEVTNPSYAFATIDGHIRFGERNMILLRIPSFHKAAAKYLIKEEVPF 213
             P++L MCV +P+   +P Y F  IDG + F  +N ILLRIP         LI+ E  +
Sbjct: 172 VRPNELAMCVSLPSSTMDPRYTFVAIDGSMCFATKNRILLRIPHRLPVGVNSLIQPEERY 231

Query: 214 LNTRIGAVKDSPEKTFMLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRST 273
            +  IG +K+   +T +L I ARQ+ TS  P +I+K AW  +  TTKKL+LLHR LQ   
Sbjct: 232 GHLPIGTIKNFSNQTNILPIAARQIITSRYPAQISKLAWRDLPFTTKKLQLLHRSLQDYR 291

Query: 274 GPWQMSIFKLCELVALLDIDKCQSSSTG-SYIEGILKEAGMFRDAHPIESFSGRSLKSID 332
           GPWQ+  F L  LV  LD+++      G +Y+  +L   G  + A  +          I 
Sbjct: 292 GPWQIPFFTLVGLVQRLDLNEALDDKYGATYLANLL---GTHQTADNV---------PIS 339

Query: 333 ASDFLATYWSLVQQQEHNLWGQIHSHRAMLTPISVTVLPLTSHHXXXXXXXXXXXXDNYA 392
           ++ F++TYW+++QQQE N WG+IH + A+L+PISVTV+PL S H            D+Y 
Sbjct: 340 SATFVSTYWAIMQQQESNFWGEIHLNTALLSPISVTVIPLKSRHLYYEQVVGKLEADDYN 399

Query: 393 ALESFAKLINTGERNSAKLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNND 452
            +  F KL+N  +       YP + ++L+D+AAGNFHNNG I+T+VSK+FRK+++Y++ D
Sbjct: 400 EINRFVKLVNERKYRDISTLYPSVIQMLKDFAAGNFHNNGIIVTLVSKIFRKIERYKDCD 459

Query: 453 ITRDLCHEFLQELTCESIPNPQLLSNEIRSPSTSERAVLEQKIYDLA----LPNQN-DDI 507
           ITRD+C + + E+   S+ NP LL+ ++  P++S+    +QK+YDL     L  +N D+ 
Sbjct: 460 ITRDICQDLINEILPNSMSNPLLLNMDLALPASSKLVRSQQKLYDLTNIEDLQRKNSDNS 519

Query: 508 SRRHDFGKMNVYCIDSETAHEIDDGISIEATGENA-YTLHIHIADPVSLFSNS----QEG 562
           S R+DFG + V+CIDSETAHEIDDG+SIE  G +  YTLHIHIADP S+F  S     EG
Sbjct: 520 SERYDFGDLKVFCIDSETAHEIDDGVSIENHGTDGLYTLHIHIADPTSMFPESTNYDSEG 579

Query: 563 SFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKN-- 620
             + +I N+AL+R FT+YLPD V PMLPKS     DLGK G  +KT+SFSVD++      
Sbjct: 580 IIT-DILNVALERSFTTYLPDVVVPMLPKSICNLSDLGKQGQKTKTISFSVDVKVMSKGD 638

Query: 621 --NVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQD-ASQQTQELRTLHKIALLLRSK 677
             ++EI+ ++F ++ G+VS FP+VTY  VDRIL    D AS   ++L +L  ++ LLR +
Sbjct: 639 GESLEIMFDSFKIRKGIVSNFPKVTYDDVDRILNTPNDEASPVKKDLESLSMVSNLLRDR 698

Query: 678 RVKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILANTMAGKF 737
           R+K  NA+IFGEGFN+GLV L   +    T +SF DQ ET STVLVSE+MILANT+ GK+
Sbjct: 699 RIKNNNAVIFGEGFNKGLVTLNANEEGELTEISFSDQVETLSTVLVSEMMILANTLTGKY 758

Query: 738 FRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYSARA 797
           F D  I GVFRCYK L L   A++ Y+S+        FP  KDI KLSSLLNSSFY+ R 
Sbjct: 759 FADNKICGVFRCYKQLPLDIIAQEQYDSMITSTKKGLFPQLKDIVKLSSLLNSSFYTGRP 818

Query: 798 EKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVL 857
            +HEMIGA  YL VTSPLRRF DL+NH Q+H +L   PL FS+ Q+  L W IQSR  +L
Sbjct: 819 FRHEMIGAKQYLTVTSPLRRFPDLINHLQIHRHLQKKPLCFSQVQIDRLIWPIQSRADIL 878

Query: 858 RKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPE 917
           ++A R+S+++WTL +LK  ++L+P +   VM+T+VP+ G V CV P+LS ARG LKL P 
Sbjct: 879 KRAGRNSSTYWTLNYLKKLKKLDPEKTYDVMITAVPQNGFVSCVFPDLSFARGTLKLHPS 938

Query: 918 ASSTVAIGDVVHNCRITRLDCLDSIMELE 946
           A     IGD+V NC+I R+DCL+ ++ELE
Sbjct: 939 AKHYPMIGDIVKNCKILRIDCLEGMLELE 967

>ZYRO0C14938g Chr3 complement(1159657..1162557) [2901 bp, 966 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 966

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/933 (43%), Positives = 578/933 (61%), Gaps = 47/933 (5%)

Query: 32  PETLKSLDNIPGPAKFVYQRPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNW---CR 88
           P T  S ++I         R   LEPGVE+K L+ I++    R+  ++  P  +W     
Sbjct: 64  PPTPLSQEDIDRINYMFLSRTKDLEPGVEVKDLNRIKQEFYSRYGARYLNPCNSWFQRSE 123

Query: 89  DNAVNWANMKDYLNMDLTSLSSKQRADMNDSLKPEVFDSESGTFRMHPSHLLDSSLKIGD 148
            N +  +  +  +N D  +L  K +  +        FD         P  L+   L+IGD
Sbjct: 124 QNILGKSFSRSLINADPEALGIKNKRFLK-------FD---------PKELMSRPLQIGD 167

Query: 149 LVLLRSDPSQLCMCVEVPTEVTNPSYAFATIDGHIRFGERNMILLRIPSFHKAAAKYLIK 208
           LVLL+    QLCMC++VP+   +P Y F T+DG I F  RN +L+RIP  H      L+ 
Sbjct: 168 LVLLKHQSPQLCMCIDVPSSTRDPRYTFTTVDGTIIFSTRNKVLMRIP--HHLPNVPLLM 225

Query: 209 EEVPFLNTRIGAVKDSPEKTFMLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRF 268
           +E+      +G VK++  +TF+L IV RQ  TS +  +I+K AW  M  T KKLELLHR 
Sbjct: 226 KEMKHGFEPVGCVKNTTTETFILPIVPRQQITSPISHQISKRAWEEMPFTLKKLELLHRH 285

Query: 269 LQRSTGPWQMSIFKLCELVALLDIDKCQSSSTGS-YIEGILKEAGMFRDAHPIESFSGRS 327
           LQ + GPWQ+    L  +V  LD+    +S+TG+ Y+E +++       A          
Sbjct: 286 LQDARGPWQVPFMNLVSMVEKLDMQLASASNTGAAYVEDLIRTCTFEPQA---------- 335

Query: 328 LKSIDASDFLATYWSLVQQQEHNLWGQIHSHRAMLTPISVTVLPLTSHHXXXXXXXXXXX 387
              +D++ FL+ Y ++  QQ+ +LWG IHS RA+L+P+SVTV+PL S H           
Sbjct: 336 --KLDSAIFLSVYCAIENQQQSHLWGNIHSSRALLSPVSVTVMPLRSQHLYHRSVLQNLK 393

Query: 388 XDNYAALESFAKLINTGERNSAKLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDK 447
             NY A+  FA+L++TG+ N A ++YP+I +LL+DYAAGNF+N+   I++VSK+FRK+ +
Sbjct: 394 VRNYEAVSKFARLVDTGKYNEAIMEYPEIVKLLQDYAAGNFYNDATAISVVSKIFRKIQR 453

Query: 448 YQNNDITRDLCHEFLQEL-TCESIPNPQLLSNEIRSPSTSERAVLEQKIYDLALPN--QN 504
           +Q  DITRD+CH+ L+EL + ++  NP   + ++  PS+S R+  EQ IY+LA P   + 
Sbjct: 454 FQEEDITRDICHQLLKELDSSQTTRNPLHYNLDLGLPSSSLRSSSEQDIYNLAHPVTFEG 513

Query: 505 DDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEGS- 563
            D + RHDFG M VYCIDSETAHEIDDG+SIE+  +   TLHIHIADP S F   QEG+ 
Sbjct: 514 QDKNLRHDFGDMKVYCIDSETAHEIDDGVSIESHSDVKRTLHIHIADPASFFRECQEGTH 573

Query: 564 -FSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKNN- 621
               EI  IAL + FT+YLPD ++PMLP SYSKA DLGK G  +KT++FSVD    KN  
Sbjct: 574 GIESEILQIALNKSFTTYLPDLMSPMLPGSYSKAADLGKQGQKAKTITFSVDGSWIKNGQ 633

Query: 622 VEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDA-------SQQTQELRTLHKIALLL 674
            ++  E+F +KLGLVS FP+VTY  VD +L    +        +   + L+ L+ I+  L
Sbjct: 634 FQLQPESFRIKLGLVSNFPQVTYNTVDSMLAQASEVKNGSANLTDDQRNLKELYAISQNL 693

Query: 675 RSKRVKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILANTMA 734
           R+ R+  Q A++FG  FN+G V L P +      +SF+DQ ET S+VLVSE+MILANT++
Sbjct: 694 RANRINTQQAVVFGSEFNKGQVALSPDENGVLQKVSFKDQLETPSSVLVSEMMILANTLS 753

Query: 735 GKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYS 794
           G+FF+D  +PGVFRCY+ L L   A+  Y  L+  +   K  + KDI  +S++LNSSFYS
Sbjct: 754 GQFFKDNNLPGVFRCYQPLALGPQAQNEYELLKSKIKEGKSLTFKDICMISTILNSSFYS 813

Query: 795 ARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRD 854
           +   +HEMIGAP YL VTSPLRRF D++NH Q+H  L G PL F++D V    WHIQSRD
Sbjct: 814 SDGYRHEMIGAPHYLTVTSPLRRFPDMINHLQIHRLLKGLPLCFNKDDVDRFVWHIQSRD 873

Query: 855 VVLRKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKL 914
            +L+ A+R S ++WTL +LK   E + +++ SVM+ SVP++G VRCVLP+ S+AR  LKL
Sbjct: 874 SILKDASRCSNTYWTLKYLKQLVENDKNKKFSVMINSVPQVGFVRCVLPDYSSARATLKL 933

Query: 915 KPEASSTVAIGDVVHNCRITRLDCLDSIMELEM 947
           KP   S   IGD++ NCRIT++D L+ ++E+E+
Sbjct: 934 KPNEISHPVIGDIIENCRITKIDALEGLLEMEL 966

>Suva_13.477 Chr13 complement(824387..827296) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/915 (43%), Positives = 579/915 (63%), Gaps = 39/915 (4%)

Query: 47  FVYQRPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLNMDLT 106
           F+++  G LEP +E+KQL  I++   +R+ +++ +PS++W  ++   W ++         
Sbjct: 77  FLHRIKG-LEPDIELKQLYQIKEEFYKRYRDRYVVPSESWYSNS---WRSLTK------P 126

Query: 107 SLSSKQRADMNDSLKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVP 166
            + S +  +++     ++  S+   F+  P+ L+ + L +GDLVLL+S P++L MCV +P
Sbjct: 127 KIPSYKLINLDIHFDTKLESSKQMEFQ--PAQLMKNPLNVGDLVLLKSRPNELAMCVSLP 184

Query: 167 TEVTNPSYAFATIDGHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFLNTRIGAVKDSPE 226
           +   +P Y FA+IDG + F  +N +LLRIP         L++ E    +  IG VK+   
Sbjct: 185 SSTMDPRYTFASIDGSMSFATKNRVLLRIPQKLPTGIDSLVQPEDHHKHLPIGTVKNFSN 244

Query: 227 KTFMLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSIFKLCEL 286
           +T +L IVARQ+ TS  P +I+K AW  + +TTKKL+LLHR LQ   GPWQ+  F L  L
Sbjct: 245 QTSILPIVARQMITSKSPAQISKLAWKHLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGL 304

Query: 287 VALLDIDKCQSSSTG-SYIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLATYWSLVQ 345
           V  LD++K   +  G +Y+            A  + S+       ++++ F++TYW++VQ
Sbjct: 305 VQKLDLNKALDNKNGVNYL------------ADLVNSYKSADSVPMNSATFVSTYWAIVQ 352

Query: 346 QQEHNLWGQIHSHRAMLTPISVTVLPLTSHHXXXXXXXXXXXXDNYAALESFAKLINTGE 405
           QQE NLWG+IH + A+L+P SVT++PL S H            DNY  ++ F KL+N  +
Sbjct: 353 QQESNLWGKIHLNTALLSPTSVTIIPLKSRHLYYAQVIEKLEADNYKDIDRFVKLVNERK 412

Query: 406 RNSAKLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLCHEFLQEL 465
                  YP + +LL+D+AAGNFHNNG I+T++SK+FRK++ Y+ +DITRD+C + + E+
Sbjct: 413 YRDISSLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIELYKGSDITRDICQDLVNEI 472

Query: 466 TCESIPNPQLLSNEIRSPSTSERAVLEQKIYDLA----LPNQNDDIS-RRHDFGKMNVYC 520
               + NP LL+ ++  P++S+    +QK+Y+L     +  +N +I+  R+DFG + V+C
Sbjct: 473 LPNKMINPLLLNMDLALPASSKLGQSQQKLYELTNIENMQRKNSNINGDRYDFGDLKVFC 532

Query: 521 IDSETAHEIDDGISIEATGENA-YTLHIHIADPVSLFSNS---QEGSFSKEIWNIALQRG 576
           IDSETAHEIDDG+SIE   ++  YTLHIHIADP SLF  S   +    + ++ N+AL+R 
Sbjct: 533 IDSETAHEIDDGVSIENHKKDGLYTLHIHIADPASLFPESTDIESQGITTDVLNVALKRS 592

Query: 577 FTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKNN----VEILEETFSVK 632
           FT+YLPD V PMLP+S     DLGK G  ++TLSFSVD++    +    +EI+  +  ++
Sbjct: 593 FTTYLPDLVVPMLPESICDLSDLGKQGQKTRTLSFSVDVKVLPKSTGKPIEIIYNSLKIR 652

Query: 633 LGLVSQFPRVTYKVVDRILGL-EQDASQQTQELRTLHKIALLLRSKRVKEQNAIIFGEGF 691
            G+VS FP+ TY  VDRIL + + +A    ++L +L  I+ LLR  R+K+ NA+IFGEGF
Sbjct: 653 KGIVSNFPKATYNDVDRILSITDSEAPPFKEDLESLSMISKLLRELRIKKNNAVIFGEGF 712

Query: 692 NRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILANTMAGKFFRDRGIPGVFRCYK 751
           NRGLV L   +    T +SF DQ ET STVLVSE+MILANT+ G+FF +  I GVFRCYK
Sbjct: 713 NRGLVTLNTNKEGELTEVSFSDQAETPSTVLVSEMMILANTLVGRFFAENKISGVFRCYK 772

Query: 752 GLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYSARAEKHEMIGAPAYLPV 811
            L L   A+Q YNSL        FP  +DI KLSSLLNSSFY+ +  +HEMIGA  YL V
Sbjct: 773 QLPLDAIAQQQYNSLITSAKKGVFPKLEDITKLSSLLNSSFYTGQPFRHEMIGANQYLTV 832

Query: 812 TSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVLRKAARDSASFWTLV 871
           TSPLRRF DL+NH Q+H +L   PL FS+ Q+  L W IQSR  +L+ A+R+S+++WTL 
Sbjct: 833 TSPLRRFPDLINHLQIHRHLQKKPLCFSQAQIDRLIWPIQSRADILKTASRNSSTYWTLN 892

Query: 872 HLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPEASSTVAIGDVVHNC 931
           +LK+  + NP +   VM+TSVP+ G   CV P+LS ARG LKL P       IGD V  C
Sbjct: 893 YLKTMMKSNPEKTYDVMITSVPQNGFAGCVFPDLSFARGTLKLNPSTEHYPMIGDTVKTC 952

Query: 932 RITRLDCLDSIMELE 946
           +I ++DCL+ I+ELE
Sbjct: 953 KILKIDCLEGILELE 967

>Smik_13.503 Chr13 complement(825111..828020) [2910 bp, 969 aa] {ON}
           YMR287C (REAL)
          Length = 969

 Score =  759 bits (1960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/913 (43%), Positives = 572/913 (62%), Gaps = 40/913 (4%)

Query: 50  QRPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLNMDLTSLS 109
           QR   LEP +E+KQLS I++   +R+ +++  PS+ W       + N    L     S  
Sbjct: 79  QRTKGLEPDIELKQLSQIKEEFYQRYKDRYIKPSEAW-------YTNTWRSLTKPKISFH 131

Query: 110 SKQRADMNDSLKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVPTEV 169
               +D+    K +  D         P+ L+++ L +GDLVLL+  P++L MCV +P+  
Sbjct: 132 KLINSDVQLDTKLKDLDP----MEFQPAQLMENPLNVGDLVLLKVKPNELAMCVSLPSST 187

Query: 170 TNPSYAFATIDGHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFLNTRIGAVKDSPEKTF 229
            +P Y F  IDG + F  +N +LLRIP         LI+ E    +  IG +K+   +T 
Sbjct: 188 MDPRYTFVAIDGTMCFATKNRVLLRIPHKLPVGVNSLIQPEGHHKHLPIGTLKNISNQTN 247

Query: 230 MLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSIFKLCELVAL 289
           +L IV RQL TS  P +I+K AW  + +TTKKL+LLHR LQ   GPWQ+  F L  LV  
Sbjct: 248 ILPIVTRQLITSRYPAQISKLAWKCLPITTKKLQLLHRSLQNYMGPWQIPFFTLVGLVQK 307

Query: 290 LDIDKCQSSSTGSYIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLATYWSLVQQQEH 349
           LD++K      G Y  GI     +  + H  ++ +      I++  F++TYW+++QQQE 
Sbjct: 308 LDLNKALD---GKY--GIDYLTDLVNNYHTADNVA------INSPTFVSTYWAILQQQES 356

Query: 350 NLWGQIHSHRAMLTPISVTVLPLTSHHXXXXXXXXXXXXDNYAALESFAKLINTGERNSA 409
           NLWG+IH + A+L+PISVT++PL S H            ++Y  + +F KL+N  +    
Sbjct: 357 NLWGEIHLNTALLSPISVTIVPLKSQHLYYAQVIEKLEANSYKEVNTFVKLVNERKYRDI 416

Query: 410 KLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLCHEFLQELTCES 469
              YP + +LL+D+AAGNFHNNG I+T++SK+FRK+ +Y++ DITRD+C + + E+   S
Sbjct: 417 SNLYPSVIQLLKDFAAGNFHNNGIIVTLISKIFRKIVRYKDYDITRDVCQDLINEIVPNS 476

Query: 470 IPNPQLLSNEIRSPSTSERAVLEQKIY------DLALPNQNDDISRRHDFGKMNVYCIDS 523
           + NP LL+ ++  PS+S+    +QK+Y      DL   N  +D S R+DFG + V+CIDS
Sbjct: 477 LSNPLLLNMDLALPSSSKLMESQQKLYYLTNIEDLQRENSGND-SDRYDFGDLRVFCIDS 535

Query: 524 ETAHEIDDGISIEATGENA-YTLHIHIADPVSLFSNS---QEGSFSKEIWNIALQRGFTS 579
           +TAHEIDDG+S+E  G++  YTLHIHIADP S+F  S        S +I NIA +R FT+
Sbjct: 536 DTAHEIDDGVSVENHGKDGMYTLHIHIADPTSMFPESTAIDSVGISTDILNIAFKRSFTT 595

Query: 580 YLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIR-----CRKNNVEILEETFSVKLG 634
           YLPD V PMLP++     DLGK G  +KT+SFSVD++     C K+ +EI+ ++F ++ G
Sbjct: 596 YLPDVVVPMLPQAICHLSDLGKHGKRTKTISFSVDVKVGYQGCGKS-LEIMYDSFRIRKG 654

Query: 635 LVSQFPRVTYKVVDRILGL-EQDASQQTQELRTLHKIALLLRSKRVKEQNAIIFGEGFNR 693
            VS FP+ TY  VD+IL   + ++S    +L +L  I+ LLR +R+K+ NA+IFGEGFN+
Sbjct: 655 FVSNFPKATYDDVDKILSAPDNESSPVKADLESLSMISKLLREQRIKKNNAVIFGEGFNK 714

Query: 694 GLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILANTMAGKFFRDRGIPGVFRCYKGL 753
           G+V L        T +SF +QEET STVLVSE+MILANT+ G++F +  I GVFRCYK L
Sbjct: 715 GMVTLNANAEGELTEVSFSNQEETPSTVLVSEMMILANTLTGRYFAENNIGGVFRCYKQL 774

Query: 754 QLKDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYSARAEKHEMIGAPAYLPVTS 813
            L   A+Q Y+S+        FP  +DI KLSSLLNSSFY+ R  +HEMIGA  YL VTS
Sbjct: 775 PLDLIAQQQYDSMITGTKKGLFPKLRDIVKLSSLLNSSFYTGRPFRHEMIGAKQYLTVTS 834

Query: 814 PLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHL 873
           PLRRF DL+NH Q+H +L   PL F++ Q+  L W IQSR  +L++A+RDS+++WTL +L
Sbjct: 835 PLRRFPDLINHLQIHRHLQKKPLCFTQTQIDSLIWSIQSRADILKRASRDSSTYWTLNYL 894

Query: 874 KSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPEASSTVAIGDVVHNCRI 933
           K   + +P R   VM+TSVP+ G   CV P LS ARG LKL+P+A     IGD+V +C+I
Sbjct: 895 KKLAKSDPGRTYDVMITSVPQNGFAGCVFPSLSFARGTLKLQPKAKYYPMIGDIVKDCKI 954

Query: 934 TRLDCLDSIMELE 946
           +++DCL+ ++ELE
Sbjct: 955 SKIDCLEGMLELE 967

>TDEL0B00220 Chr2 complement(40373..43180) [2808 bp, 935 aa] {ON}
           Anc_8.853 YMR287C
          Length = 935

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/908 (42%), Positives = 561/908 (61%), Gaps = 46/908 (5%)

Query: 51  RPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLNMDLTSLSS 110
           R   LEPG+E+KQL  I +   +RF  +++ PSK W   N   W N   +    L ++  
Sbjct: 63  RTKDLEPGMEVKQLPQIGREFRDRFDARYYEPSKIWFEKN---WLNRTKFSRKMLNAVPR 119

Query: 111 KQRADMNDSLKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVPTEVT 170
           K+          EVF  ++       S L+   L +GDLVLL+S PS+L MC++VP+   
Sbjct: 120 KEDTK-------EVFQYKA-------SALMAKPLDVGDLVLLKSHPSELSMCIDVPSSTK 165

Query: 171 NPSYAFATIDGHIRFGERNMILLRIP-----SFHKAAAKYLIKEEVPFLNTRIGAVKDSP 225
           +P Y F T+DG ++FG R+++L+RIP        K AA  L+  E       IG +K+  
Sbjct: 166 DPRYCFTTVDGSLKFGSRSLVLMRIPHSLPQELSKMAA--LLVREAKHGFEPIGTIKNQA 223

Query: 226 EKTFMLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSIFKLCE 285
            +T +L ++ARQL TS V   I+K+AW+++ VT KKLELLHR LQ STGP  +  F L  
Sbjct: 224 NETLVLPVIARQLVTSCVTQRISKSAWDQLPVTIKKLELLHRRLQDSTGPVPVPFFDLVM 283

Query: 286 LVALLDIDKCQSSSTGS-YIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLATYWSLV 344
           ++  LDI K  S+  G  YI  +            IE+    S  +ID+S  LATYW++ 
Sbjct: 284 MIQSLDITKAISNRDGEPYIRDV------------IENSRTGSTSTIDSSCALATYWAIE 331

Query: 345 QQQEHNLWGQIHSHRAMLTPISVTVLPLTSHHXXXXXXXXXXXXDNYAALESFAKLINTG 404
            QQ+++L+G I    A+L+P+SV +LP  S H            +   A++ F+KL N G
Sbjct: 332 AQQKNHLFGDIQISGALLSPVSVLILPFASQHLFYSELKEQLKSNGQEAIQEFSKLANKG 391

Query: 405 ERNSAKLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLCHEFL-Q 463
           +      ++P I ++L+ YAAGN HN+  I+++++ +FRK+D++++NDITRD C + L +
Sbjct: 392 KYTELTTRFPHIIQVLKGYAAGNLHNDEGIVSLIAAIFRKIDEFKDNDITRDACEKLLSR 451

Query: 464 ELTCESIPNPQLLSNEIRSPSTSERAVLEQKIYDLALPNQNDDISRRHDFGKMNVYCIDS 523
            L   ++ NP   +  +  P +S R+  +Q++YDL+ P        RHDF  + VYCIDS
Sbjct: 452 TLPQGTVENPIYANFTLGLPDSSARSRTQQQVYDLSKPASAQSTENRHDFKHLRVYCIDS 511

Query: 524 ETAHEIDDGISIEATGENAYTLHIHIADPVSLF---SNSQEGSFSKEIWNIALQRGFTSY 580
           E AHEIDDGISIE  G   YTLHIHIADP SLF    +S++   + E+  +A +R FT+Y
Sbjct: 512 EEAHEIDDGISIEDCGNGKYTLHIHIADPASLFPESESSEQSGINDEVLKVAAERCFTTY 571

Query: 581 LPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKNNVEILEETFSVKLGLVSQFP 640
           LPD V+PMLP++++   DLG  G  +KT++FSVD+  +   ++I  +++ ++LGLVS FP
Sbjct: 572 LPDVVSPMLPQTFTTVCDLGHQGKKTKTITFSVDVLVKDGAIKIFFDSYKIRLGLVSNFP 631

Query: 641 RVTYKVVDRILGLEQDASQQT-QELRTLHKIALLLRSKRVKEQNAIIFGEGFNRGLVKLM 699
           +VTY+ VDR L   ++ +++   +L+ +HKIA +LR  R+++  AI+FG GFN+GLV + 
Sbjct: 632 KVTYETVDRYLSEPKNVNEEILYDLKLMHKIAEILREARIQKDGAIVFGSGFNQGLVAVS 691

Query: 700 PTQTNTATALSFEDQEETASTVLVSEIMILANTMAGKFFRDRGIPGVFRCYKGLQLKDNA 759
           P        +SF DQ+E+ ST+LVSE MILAN++AG+FF ++ IPG+FR Y+ L L+  A
Sbjct: 692 PVDQE----ISFFDQKESKSTLLVSEFMILANSLAGRFFAEKEIPGIFRTYQPLTLRGQA 747

Query: 760 RQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFA 819
            Q Y  ++  +     P+ KDI  LSSLLNSSFY      H MIGA  YL VTSPLRRF 
Sbjct: 748 DQEYERMKKSVKKGILPTTKDINMLSSLLNSSFYCEYPTAHAMIGASQYLTVTSPLRRFP 807

Query: 820 DLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQEL 879
           D++NH Q+H  L   PL F+ED +S + WHIQ RD  L+KA+   AS+WTL ++K+    
Sbjct: 808 DIINHLQIHRVLRNLPLCFTEDALSKMLWHIQLRDAALKKASAHQASYWTLKYIKNLIRD 867

Query: 880 NPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPEASSTVAIGDVVHNCRITRLDCL 939
            P +R  V +TSVP+L V RCVL    +ARG+LKLKP A++   +GD V  C+++++DCL
Sbjct: 868 TPHQRFDVTITSVPQLNVARCVLANFPSARGVLKLKPSATNIPTVGDTVKGCKVSKIDCL 927

Query: 940 DSIMELEM 947
           DS++ELE+
Sbjct: 928 DSLLELEL 935

>KNAG0E01140 Chr5 complement(222456..225245) [2790 bp, 929 aa] {ON}
           Anc_8.853 YMR287C
          Length = 929

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/906 (41%), Positives = 543/906 (59%), Gaps = 48/906 (5%)

Query: 51  RPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLNMDLTSLSS 110
           R   LEPG+EIK+L  I+K  + RF  ++F PSK W +DN V                 S
Sbjct: 62  RTKDLEPGMEIKKLKQIKKEFNTRFAERYFNPSKQWFQDNWV--------------VEPS 107

Query: 111 KQRADMNDSLKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVPTEVT 170
              A  + S       ++  TF++  S  + S L++GDLVL    P++L MCV +P    
Sbjct: 108 TNTAGKSSSQNSMTGKNKHYTFKL--SEFISSVLQMGDLVLTTPYPNELAMCVGLPESAE 165

Query: 171 NPSYAFATIDGHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFLNTRIGAVKDSPEKTFM 230
           +P Y F T+ G + FG ++ + LRIP       +YLI +E P     +G +K + + T++
Sbjct: 166 DPRYTFVTVSGKMFFGTKSFVHLRIPYRLPEKVRYLISKEGPHAFEPVGTIKGTRDVTYI 225

Query: 231 LSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSIFKLCELVALL 290
           L  +ARQL TS +P +I K AW ++    K+LELL R+L++  G WQ+   +L + V  L
Sbjct: 226 LPYLARQLVTSELPSQINKLAWQKLPSIIKRLELLSRYLRKYNGTWQVPFVQLVDAVQRL 285

Query: 291 DIDKCQSSSTGS--YIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLATYWSLVQQQE 348
           +    +    G   YI+ + +   +             S +SI A+ +LATYW++ +QQ 
Sbjct: 286 E----EKGGPGEFEYIKSLFERPSL------------GSRRSIHAATYLATYWAIKEQQN 329

Query: 349 HNLWGQIHSHRAMLTPISVTVLPLTSHHXXXXXXXXXXXXDNYAALESFAKLINTGERNS 408
            N+WG+IH ++A L PIS +V+P  S               +   +     LINT +   
Sbjct: 330 FNIWGKIHVNKAFLAPISTSVVPAASLRSFHDELINDPKRKH---VNKITDLINTKDYEL 386

Query: 409 AKLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLCHEFLQELT-- 466
            + +YP+  +LL D+ AGNF NN  ++T++S++FR LD Y+  ++TRD C + L+E++  
Sbjct: 387 VRERYPEFLQLLSDFTAGNFDNNCEVVTLISQIFRMLDVYRECNVTRDTCFDLLKEISED 446

Query: 467 --CESIPNPQLLSNEIRSPSTSERAVLEQKIYDLALPN-QNDDISRRHDFGKMNVYCIDS 523
             CE   NP L ++++    +SER+ L++ +Y +  P+ Q D  ++RHDF  M VYCIDS
Sbjct: 447 NFCE---NPILSNSDLALAQSSERSALQKCVYSVVQPDIQLDTKTKRHDFLDMPVYCIDS 503

Query: 524 ETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNS-QEGSFSKEIWNIALQRGFTSYLP 582
           ETAHEIDDG+SIE  G+ +YTLH+HIADP S F  S  E +   ++  IA  + FT+YLP
Sbjct: 504 ETAHEIDDGVSIEKNGKGSYTLHVHIADPASFFPESYTESTKLSDVLKIAFDKSFTTYLP 563

Query: 583 DCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKNN-VEILEETFSVKLGLVSQFPR 641
           D V  MLP+S+ +A DLGK    ++T++FSV ++  ++  + I  +TF  +LGLVS FP+
Sbjct: 564 DVVEAMLPESFCRAADLGKQDKKTRTITFSVRVKMDEHGGLHIQSDTFRARLGLVSNFPK 623

Query: 642 VTYKVVDRILGLEQDASQQTQELRTLHKIALLLRSKRVKEQNAIIFGEGFNRGLVKLMPT 701
           VTY +VD +L      S   Q+L TL+KIA  LR  RVK   A++FGEGFN G V+L+  
Sbjct: 624 VTYNIVDSVLNDSSSNSPLRQDLLTLYKIASGLRHNRVKLNGAVVFGEGFNNGQVRLIRD 683

Query: 702 QTNTATALSFEDQEETASTVLVSEIMILANTMAGKFFRDRGIPGVFRCYKGLQLKDNARQ 761
             N    ++FE+  ET STVLVSE+MILANT++G FFR+  IPG+FRCY  L+L   A  
Sbjct: 684 SANKVKDITFENNNETPSTVLVSELMILANTLSGNFFRENKIPGIFRCYNELKLDGKALS 743

Query: 762 GYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADL 821
            Y S++D +   K P+ KDIAK++SL+NSSFYS     H+MIGA  YL VTSPLRR+ DL
Sbjct: 744 DYRSIQDNVQRGKNPTLKDIAKITSLMNSSFYSGEPRNHQMIGAKQYLTVTSPLRRYPDL 803

Query: 822 VNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNP 881
           +NH QLH +LA  PL FS+  +  + W +QSR  +L+  +   +++WTL +LK + E + 
Sbjct: 804 INHIQLHKHLANKPLTFSQQAIDQMIWQVQSRADILKSISTTVSAYWTLTYLKKRIEKDS 863

Query: 882 SRRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPEASSTVAIGDVVHNCRITRLDCLDS 941
           S R  VMVTS P+ G+V C+ P  S ARG LKLK +      IGD+V +C+IT +DCLDS
Sbjct: 864 SARFDVMVTSFPQDGMVNCLFPNHSYARGKLKLKVDRLPP-QIGDIVKDCQITSIDCLDS 922

Query: 942 IMELEM 947
            ++L M
Sbjct: 923 NLQLVM 928

>KAFR0L01970 Chr12 complement(372452..375250) [2799 bp, 932 aa] {ON}
           Anc_8.853 YMR287C
          Length = 932

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/909 (39%), Positives = 534/909 (58%), Gaps = 37/909 (4%)

Query: 46  KFVYQRPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLNMDL 105
           K    R   LEP +EIK+L+ I+K  +ER+  +   PSK W   +   W +         
Sbjct: 52  KLFLSRTSGLEPDLEIKELADIEKDYNERYLKRIIWPSKRWYEHD---WKDRS------- 101

Query: 106 TSLSSKQRADMN--DSLKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCV 163
           T +   +R   N  +  KP  F+  +     H   LL+S LK+GD+VLL+S+ ++L MCV
Sbjct: 102 TKILGMERFSKNLINGAKPN-FNKRNEGITFHTQELLESPLKVGDIVLLKSNATELSMCV 160

Query: 164 EVPTEVTNPSYAFATIDGHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFLNTRIGAVKD 223
            +P    +P Y FATI G++ F  R+ I LRIP         LI  E+P     IG +K 
Sbjct: 161 ALPESADDPRYTFATIKGNLLFSTRSSINLRIPYSIPNGIANLITREIPHGFNPIGVIKS 220

Query: 224 SPEKTFMLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSIFKL 283
           S  +TF+L  V RQ  TS  PF ++  AW  + +T KKLE+LHRFLQ   G +Q+  F+L
Sbjct: 221 SINETFILPTVTRQHITSLKPFTVSHIAWEELPLTIKKLEVLHRFLQNPLGWYQIPFFQL 280

Query: 284 CELVALLDIDKCQSSSTGSYIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLATYWSL 343
             LV  +D+  C       Y++ +            I++    S  ++DAS  L+TYW++
Sbjct: 281 VHLVDTIDMSSCNDRK---YMKTL------------IDNSKNDSYNNLDASRCLSTYWAI 325

Query: 344 VQQQEHNLWGQIHSHRAMLTPISVTVLPLTSHHXXXXXXXXXXXXDNYAALESFAKLINT 403
           ++QQE N+WG I  +   ++PISVTV PL ++              +   +    +L+N 
Sbjct: 326 IEQQETNMWGDIQRNSCSMSPISVTVNPLKAYQHFNDYLVCGTKQKDLDKIGQVTRLMNE 385

Query: 404 GERNSAKLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLCHEFLQ 463
                 K +YP+   +L+DYA+GN + N  +  ++S   RKL+ Y++ D+++ +C++ LQ
Sbjct: 386 KNYTIIKEKYPEFMSMLKDYASGNLNQNSQVAVLISAFLRKLNYYKDMDVSKTVCYKLLQ 445

Query: 464 ELT-CESIPNPQLLSNEIRSPSTSERAVLEQKIYDLALPNQNDDISRRHDFGKMNVYCID 522
           E+   +   N  L ++++   ++S      +++Y L  P  + D + R DFG + VYCID
Sbjct: 446 EIDPTQFFDNILLFNHDLNLSNSSNLGQSNKQLYALCGPQISAD-ADRVDFGNLRVYCID 504

Query: 523 SETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQE--GSFSKEIWNIALQRGFTSY 580
           SETAHEIDDGISI   G   Y+L IHIADP  LFS + E  G  + +++ +A+++ FT+Y
Sbjct: 505 SETAHEIDDGISIINKGNGIYSLSIHIADPSILFSGASEIQGPLNDDVFKLAMEKSFTTY 564

Query: 581 LPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKN-NVEILEETFSVKLGLVSQF 639
           LPD V P+LP +YS+A DLGK+G  +  ++F+V+++   +  + +L +TF +KL  +  F
Sbjct: 565 LPDIVEPLLPNTYSEAADLGKNGQVTNAMTFTVNVKTLPDETLHVLYDTFDIKLSKIRNF 624

Query: 640 PRVTYKVVDRILGLEQDASQQT--QELRTLHKIALLLRSKRVKEQNAIIFGEGFNRGLVK 697
           P+VTY  V++IL    D S  +  Q+L  LHKIA  LR+ R+K   A++FGEGFN+G+++
Sbjct: 625 PKVTYSRVNKILQ-SSDYSNPSVKQDLEDLHKIARALRNNRMKNGGAVVFGEGFNKGMIE 683

Query: 698 LMPTQTNTATALSFEDQEETASTVLVSEIMILANTMAGKFFRDRGIPGVFRCYKGLQLKD 757
                      + F DQEET +T+LVSE+MIL NT+ G FF+   IPG++R Y  L L  
Sbjct: 684 FFEEGQAEVKNVKFIDQEETPATLLVSELMILTNTLCGWFFKKNNIPGIYRSYNKLLLGS 743

Query: 758 NARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYSARAEKHEMIGAPAYLPVTSPLRR 817
            A   Y SL+    S   PS KD+ ++SSL+NSS Y+++   HEMIGA  YL VTSPLRR
Sbjct: 744 KATMEYMSLQSSTKSGVSPSIKDMTRVSSLMNSSVYTSKPRMHEMIGAQQYLTVTSPLRR 803

Query: 818 FADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQ 877
           F DL+NH+Q+H +L   P  F+++++ +L WHIQSR  +L+K +R   ++WTL +L+   
Sbjct: 804 FPDLLNHFQIHRFLKKLPFVFNDEKLQNLIWHIQSRADILKKMSRAINTYWTLEYLQKAI 863

Query: 878 ELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPEASSTVAIGDVVHNCRITRLD 937
             NP++R  VM+TSVP  GVV C+ P++S ARG LKLK      V IGD V NCRI +L+
Sbjct: 864 FENPNKRFDVMITSVPNNGVVNCLFPDMSFARGKLKLKKGMPYPV-IGDTVTNCRIVKLE 922

Query: 938 CLDSIMELE 946
            LD I+ LE
Sbjct: 923 SLDGILYLE 931

>CAGL0M07051g Chr13 complement(716775..719546) [2772 bp, 923 aa]
           {ON} similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287c MSU1
          Length = 923

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/936 (38%), Positives = 534/936 (57%), Gaps = 58/936 (6%)

Query: 36  KSLDNIP--GPAKFVYQRPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVN 93
           + LDN P     K    R   LEP  EI+QL  I  G ++R+  ++  PS+ W +    +
Sbjct: 14  RRLDNAPLENSVKNYLARTKGLEPDFEIRQLPQIISGFNKRYRARYLEPSQRWFK---AD 70

Query: 94  WANMKDYLNMDLTSLSSKQRADMNDSLKPEVFDS----------------ESGTFRMHPS 137
           W    D+     T L           L+PEVFD                 ++      P+
Sbjct: 71  W-KASDHGEDKATRL-----------LRPEVFDKFIINSDFHRGNMEQYQKAQKLSFDPA 118

Query: 138 HLLDSSLKIGDLVLLRSDPSQLCMCVEVPTEVTNPSYAFATIDGHIRFGERNMILLRIPS 197
            LL +SL +GD+VLL+   S+L MCV +P   T+P Y FA  DG + +  +N ++LRIP 
Sbjct: 119 ELLRTSLNVGDIVLLKQCTSELTMCVNLPQSTTDPRYTFAKKDGTLVYAMKNSVILRIPK 178

Query: 198 FHKAAAKYLIKEEVPFLNTRIGAVKDSPEKTFMLSIVARQLYTSYVPFEITKAAWNRMGV 257
                   L+K E      +IG +K+S  +T +L ++ RQL  S+     TK AW ++ +
Sbjct: 179 DLPEEVNQLLKRESNHPYQKIGTIKNSSNETEILPVLTRQLIVSFTLATFTKFAWTQLPI 238

Query: 258 TTKKLELLHRFLQRSTGPWQMSIFKLCELVALLDIDKCQSSSTG-SYIEGILKEAGMFRD 316
             KKLEL+HR+LQ S G   ++   L  ++  L+I +   +  G +Y+  ++ E+    +
Sbjct: 239 VLKKLELIHRYLQDSRGSKHVNFMSLVRIIKNLNIKEATDAINGDAYVRKVIDESMSVVN 298

Query: 317 AHPIESFSGRSLKSIDASDFLATYWSLVQQQEHNLWGQIHSHRAMLTPISVTVLPLTSHH 376
                       KSID +  LATYW + +QQ++NLWG ++++ A+L+P +V VLPL   H
Sbjct: 299 ------------KSIDPTTLLATYWGVREQQQNNLWGSVYTNTALLSPTTVAVLPLKKAH 346

Query: 377 XXXXXXXXXXXXDNYAALESFAKLINTGERNSAKLQYPQISRLLRDYAAGNFHNNGPIIT 436
                       ++Y  +++FAKL+N  + +S   +Y  I  LL DYAAGN   N  + T
Sbjct: 347 LFYQEVITRLESNDYQEIKAFAKLVNDKDYHSIAKRYDYIRTLLNDYAAGNIEENAVLTT 406

Query: 437 IVSKLFRKLDKYQNNDITRDLCHEFLQELTCESIPNPQLLSN-EIRSPSTSERAVLEQKI 495
           I+SK+FR +D Y++ D+TR LC + L E++ +S  +  +L N ++  P +S  + +EQK+
Sbjct: 407 IISKIFRHIDMYRDQDVTRSLCGKLLVEISPQSNSSNFILGNWDLNIPKSSGISSVEQKL 466

Query: 496 YDLALPNQNDDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSL 555
           YD A+P    D + R+DFG M V+CIDSE AHEIDDGISIE        +HIHIADP  L
Sbjct: 467 YDTAMPTIVSD-TDRYDFGDMPVFCIDSEDAHEIDDGISIEELDGVRSRIHIHIADPAGL 525

Query: 556 FSNS---QEGSFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFS 612
           F  S    +   S ++  ++L+R FT+YLPD V PMLPKS+    DLGK    ++T+SFS
Sbjct: 526 FPESFDYTKSGISDDVLRVSLKRAFTTYLPDLVVPMLPKSFCNRADLGKHDRKTETISFS 585

Query: 613 VDIRCRKNN-VEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDA--SQQTQELRTLHK 669
            ++  +++  + +  +TF V+LG+VS FP+VTY  VD IL  + ++  S+Q ++L  LH 
Sbjct: 586 FELVNKEDGGLHVDYDTFQVRLGIVSNFPKVTYDKVDSILNGDDNSLPSKQKKQLELLHT 645

Query: 670 IALLLRSKRVKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMIL 729
           +A  L  KR+ + NA++FG+GFN+GLV L P         +F DQ +T ST+LVSE MIL
Sbjct: 646 LATKLLHKRIHDDNAVVFGDGFNKGLVSLSPDDDGELCIPTFYDQSQTKSTLLVSEFMIL 705

Query: 730 ANTMAGKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLN 789
            N +   FF++  IPGV+RCY GL L + A+  +  L++ +   K PS KDI K+SS L+
Sbjct: 706 TNKLCAAFFQENKIPGVYRCYNGLNLGNQAKAQFELLKENIKLGKLPSLKDITKISSQLS 765

Query: 790 SSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWH 849
           SSFYS     H+MIG  AYL VTSP+RR  DL+NH QLH +L   PL F ++ +    W 
Sbjct: 766 SSFYSPFPLPHKMIGNTAYLTVTSPMRRGPDLINHLQLHRFLKKLPLCFKQEYLDQYVWS 825

Query: 850 IQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTAR 909
            Q+R  +L+   R S+++WTL HL    E + ++   V+VTSVP+ G V C+ PE S AR
Sbjct: 826 FQARADILKIFQRHSSTYWTLKHL----EQSGTKTHDVIVTSVPQNGTVNCLFPEYSYAR 881

Query: 910 GILKLKPEASSTVAIGDVVHNCRITRLDCLDSIMEL 945
           G LKL P       IGD + +C++  +  LD I+ L
Sbjct: 882 GTLKLDPAMKKIPRIGDTIRHCKVESIHPLDGILTL 917

>NCAS0C00300 Chr3 (39415..42237) [2823 bp, 940 aa] {ON} Anc_8.853
           YMR287C
          Length = 940

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/940 (39%), Positives = 529/940 (56%), Gaps = 57/940 (6%)

Query: 30  KSPETLKSLDNIPGPAKFV----YQRPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKN 85
           K P   +S    P   KF+     +R   LEP +++K L  I +  ++RF +++  PSK 
Sbjct: 32  KQPPDTESKRLSPDDIKFIRESFLKRTNWLEPNIQLKSLPQIYREYEKRFLSRYIRPSKF 91

Query: 86  WCR----DNAVNWANMKDYLNMDLT-SLSSKQ--RADMNDSLKPEVFDSESGTFRMHPSH 138
           W      +N       K +LN  L  S+S KQ    D ND                    
Sbjct: 92  WYETLWLNNDTKPPFNKLFLNNPLPDSISKKQLLNFDYND-------------------- 131

Query: 139 LLDSSLKIGDLVLLRSDPSQLCMCVEVPTEVTNPSYAFATIDGHIRFGERNMILLRIPSF 198
           L  + LKI DL +LR+ PS+L MCV++P  V +P Y FA+  G + F  R+MI +RIP  
Sbjct: 132 LAKTPLKIRDLAILRATPSELSMCVQLPESVEDPRYTFASRSGKLYFVYRSMIKIRIPYQ 191

Query: 199 HKAAAKYLIKEEVPFLNTRIGAVKDSPEKTFMLSIVARQLYTSYVPFEITKAAWNRMGVT 258
                + LI +E+    + IG +K + + TF+L  +AR L +     +I KAA  +  + 
Sbjct: 192 VPKGIQGLILKELQHEFSPIGTLKSNTKDTFILPYLARNLLSRTGLSDINKAASYQRPIV 251

Query: 259 TKKLELLHRFLQRSTGPWQMSIFKLCELVALLDIDKCQSSSTGS-YIEGILKEAGMFRDA 317
            KKLELLHR+LQ   GP  +    L  LV  LD+ +      G+ YI  ++KEA    D 
Sbjct: 252 MKKLELLHRYLQNDKGPTSIPFTHLINLVNKLDLSQALHLQAGNDYIINLIKEAN---DP 308

Query: 318 HPIESFSGRSLKSIDASDFLATYWSLVQQQEHNLWGQIHSHRAMLTPISVTVLPLTSHHX 377
             I          ++AS  +A YWSLV+  E  LW  I+ + A L P +VTVLPL S+  
Sbjct: 309 PSI----------MNASLTIAVYWSLVELSETFLWDGINRNSASLFPTTVTVLPLLSYRV 358

Query: 378 XXXXXXXXXXXDNYAALESFAKLINTGERNSAKLQYPQISRLLRDYAAGNFHNNGPIITI 437
                      +NY  L  F+ L+N       +  + +I  LL++Y AGN  NN  I T+
Sbjct: 359 HYTELIEDLERNNYKQLNKFSNLVNDKNYQEIEQSFSKIINLLQEYTAGNLQNNPKITTL 418

Query: 438 VSKLFRKLDKYQNNDITRDLCHEFLQEL-TCESIPNPQLLSNEIRSPSTSERAVLEQKIY 496
           +SKLFR + +YQ  DITRDLC+E L +  + +   NP L ++++ + + S+    +Q +Y
Sbjct: 419 ISKLFRGIKEYQRCDITRDLCNELLMKFPSIKPNSNPLLKNHDLATRADSQHGQRQQILY 478

Query: 497 DLALPNQ---NDDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPV 553
           D   PN     + +  R DFG + VYCIDSETAHEIDDGISIE      +TLHIHIADP 
Sbjct: 479 DYVKPNDLLIQESLRDRFDFGDLRVYCIDSETAHEIDDGISIEKKFNGKFTLHIHIADPA 538

Query: 554 SLF--SNSQEG--SFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTL 609
             F   N+++G      ++  IA +  FT+YLPD V PMLPKSY K  DLG +G  + ++
Sbjct: 539 IFFPECNNEKGVLGLQDDVLKIAYENSFTTYLPDTVVPMLPKSYCKMADLGINGKKTPSI 598

Query: 610 SFSVDI--RCRKNNVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQ--TQELR 665
           SFSVD+     K+N++I  +TF ++LGLVS FP+ TY  VD IL  E ++ Q+    +LR
Sbjct: 599 SFSVDVILNKEKSNLKICYDTFQIRLGLVSNFPKATYDNVDDILSSEVNSEQKLLQDDLR 658

Query: 666 TLHKIALLLRSKRVKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSE 725
            L  IA +LR+KR +E  AI FGEGFNRG  K        +  +SF DQ+ T S  LV+E
Sbjct: 659 QLSMIAGILRNKRTQENGAITFGEGFNRGTPKYSEDSETESDVISFVDQKNTKSNELVTE 718

Query: 726 IMILANTMAGKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLS 785
           +MILANT+ G++F++  I GV+RCY  L L+  A+  YN LR+   + K P+ +DI K+ 
Sbjct: 719 LMILANTLCGRYFKENKIFGVYRCYNDLNLEPKAKMQYNKLREECKNGKLPTLEDIVKVQ 778

Query: 786 SLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSD 845
           SLLNSS+YS    +H+MIG+  YL VTSPLRRF DLV+H QLH +L G PL F++  + +
Sbjct: 779 SLLNSSYYSEHPSRHDMIGSEQYLTVTSPLRRFTDLVSHIQLHNHLKGHPLPFNQKAIRN 838

Query: 846 LAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPEL 905
              HIQSR   LRK + +S    TL +LK+  +  P     V +TSVP  G  RC++PE 
Sbjct: 839 FVPHIQSRADKLRKISTESNVCMTLSYLKNLLKTKPDTMFDVKITSVPSEGRARCLIPEY 898

Query: 906 STARGILKLKPEASSTVAIGDVVHNCRITRLDCLDSIMEL 945
           S ARG ++L P       +GD V++C++ ++ C+D I+E 
Sbjct: 899 SFARGEIRLSPSLKVYPKVGDTVNSCKVVKISCVDGILEF 938

>TBLA0B02920 Chr2 complement(671467..674556) [3090 bp, 1029 aa] {ON}
            Anc_8.853 YMR287C
          Length = 1029

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/988 (37%), Positives = 547/988 (55%), Gaps = 115/988 (11%)

Query: 51   RPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLNMDLTSLSS 110
            R  +L+P + IK+L  I     +RF  +  +PS  W   N++ W         D  +++ 
Sbjct: 65   RIKELDPSITIKELPEITNEYRKRFLQRFIIPSSKWF--NSIEW---------DSRTITP 113

Query: 111  KQRADMNDS-------LKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCV 163
            K    M +S        +  + +S + TF  H   L    L IGDL+LL  D S L MCV
Sbjct: 114  KFSKYMLNSTFSFDAWYQKIISNSFNLTFTKHSLEL--DPLNIGDLILL-PDSSNLLMCV 170

Query: 164  EVPTEVTNPSYAFATIDGHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFL-----NTRI 218
            ++P    +P Y FA+ DG + F  R+ I LRIP+       YL+   + F      N  I
Sbjct: 171  DIPHNTKDPRYTFASSDGKLFFKTRSNIPLRIPN---KLPNYLMDSRLLFTEFDHGNNSI 227

Query: 219  GAVKDSPEKTFMLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQM 278
            G +K++     +L I+ARQL    +   + K+A +++ +  KKLEL+HR +Q   GP+Q+
Sbjct: 228  GTIKNTQNIKILLPIIARQLVVRPILNNLNKSANDKLSIILKKLELIHRLIQNGNGPYQI 287

Query: 279  SIFKLCELVALLDIDKCQSSSTGSYIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLA 338
            S FKL +L+ +L+++   +S        I         ++ IES +  +   IDAS FLA
Sbjct: 288  SFFKLIKLIDILNLNDFDNSKKFD----INLNFSKLLSSNEIESLNSST--EIDASTFLA 341

Query: 339  TYWSLVQQQEHNLWGQIHSHRAMLTPISVTVLPLTSHHXXXXX---XXXXXXXDNYAALE 395
            TYW++  QQ+  LWG+I  ++A+L+PISVTVLPL  +H               +  + L+
Sbjct: 342  TYWAIRLQQQDFLWGKIQVNKALLSPISVTVLPLVLYHNYYNNFLQRSNNAIKNGKSLLD 401

Query: 396  SF-----------------------AKLINTGERNSAK---LQYPQISRLLRDYAAGNFH 429
            SF                           N  + +S+K     YP+   + ++Y AGNF 
Sbjct: 402  SFIDDINNQSTTNTTNNNNNTTIITTTTTNNNKLDSSKNISQNYPEFINIFQNYCAGNFD 461

Query: 430  NNGPIITIVSKLFRKLDKYQNNDITRDLCHEFLQ-------------------------- 463
            +N  II ++SK+ R+L K++++D+T+D C E L                           
Sbjct: 462  DNSKIIALISKILRRLTKFKDSDLTKDTCKELLDLCTSKGTSKGTSGDASGDASRNTSKD 521

Query: 464  --ELTCESIPN------PQ--LLSN--EIRSPSTSERAVLEQKIYDLALPNQNDDISR-R 510
              + T +  PN      PQ  LL N  EI  P++S+    +   Y+L  P +    S+  
Sbjct: 522  SSQGTSKDTPNGINNQDPQFNLLHNNIEIALPNSSKLTKDQTLFYNLIEPPKLTQFSKFH 581

Query: 511  HDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEGSFSKEIWN 570
            HDF  + VYCIDSETAHEIDDGISIE    N +TLHIHIADP S+F N ++ S  + + N
Sbjct: 582  HDFNDLKVYCIDSETAHEIDDGISIEKLNNNLFTLHIHIADPSSIFLNHEKNSDIQNLLN 641

Query: 571  IALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKNN--VEILEET 628
            +AL + FT+YLPD V+PMLPKS+ K  DLG D   + T+SFSV++    NN  ++IL  T
Sbjct: 642  MALSKSFTTYLPDLVSPMLPKSFCKLSDLGYDNQKTATISFSVNVEVDSNNESIKILHNT 701

Query: 629  FSVKLGLVSQFP-RVTYKVVDRIL------GLEQDASQQTQ-ELRTLHKIALLLRSKRVK 680
            F V+LG+VS+FP   TY  VDRIL       L+   +   Q +LR L +I+ LL+  R++
Sbjct: 702  FKVRLGIVSKFPSNTTYDNVDRILSNSTEENLKSGVTSDIQNDLRNLSQISNLLKKNRIQ 761

Query: 681  EQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILANTMAGKFFRD 740
              NA+IFGEGFN+GLV L  ++ +    ++F+DQ +T S  LV+E+MILAN++A + F++
Sbjct: 762  NGNAVIFGEGFNKGLVTLSCSK-DGGPVINFKDQNDTKSVTLVTEMMILANSLAARLFKE 820

Query: 741  RGIPGVFRCYKGLQLKDNARQGYNSLRDMMH-SQKFPSAKDIAKLSSLLNSSFYSARAEK 799
              IPG+FRCY  L L   A+  ++ LR+ +  +   P+ K+I+K  SLLNSSFY+     
Sbjct: 821  NKIPGIFRCYHELHLAKKAQLEFDILRENIKVNSHLPNIKEISKFGSLLNSSFYTDLPLP 880

Query: 800  HEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVLRK 859
            H+MIGA  YL VTSPLRRF DLVNH Q+  ++   P K+S   +  +   IQSRD+++R+
Sbjct: 881  HQMIGAANYLTVTSPLRRFPDLVNHMQIQHFIKKKPFKYSTTDIQKMLPIIQSRDIIIRE 940

Query: 860  AARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPEAS 919
             +     ++ L +LK Q + NPS+   V++TSV  LG + C+LP  S++ GILKLKP+  
Sbjct: 941  LSGKCNKYYLLNYLKEQIKKNPSQTFDVLITSVSNLGFIHCILPNFSSSMGILKLKPDLD 1000

Query: 920  STVAIGDVVHNCRITRLDCLDSIMELEM 947
             T +IGDV+ NC+I ++D LD  ++  M
Sbjct: 1001 FTPSIGDVIRNCKIDKIDALDGRLDFSM 1028

>NDAI0K00320 Chr11 (60516..63404) [2889 bp, 962 aa] {ON} Anc_8.853
           YMR287C
          Length = 962

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/922 (37%), Positives = 529/922 (57%), Gaps = 49/922 (5%)

Query: 50  QRPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDY-LNMDLTSL 108
           +R   LEP + +K  + I   LD+RF  ++  PSK+W   N   W  + +  L + +  L
Sbjct: 63  KRTNDLEPDIRLKTTAQIHYELDKRFNARYLQPSKSWYESN---WEKLNEKRLTLSIREL 119

Query: 109 SSKQRADMN-DSLKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVPT 167
            +K  A+   +  K   F+ E  T            LKIGD+VLL+++ S+  MC+++P 
Sbjct: 120 INKDPAEFKFNYYKNLKFNIEDVT----------EPLKIGDIVLLKTNTSEFSMCIDLPQ 169

Query: 168 EVTNPSYAFATIDGHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFLNTRIGAVKDSPEK 227
            + +P Y F +  G + FG R+MILL+IP       + LI +E       IG +K S ++
Sbjct: 170 SLKDPRYTFISSTGDLIFGMRSMILLKIPFKLPGNIERLIIKEPAHKYNPIGTIKSSLDE 229

Query: 228 TFMLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSIFKLCELV 287
           T ++ ++ARQL  +++P +I+K A  ++ V  KKLELLHR+LQ  +GP Q+   KL  ++
Sbjct: 230 TVLVPVIARQLLINFMPAQISKCATKQLPVIIKKLELLHRYLQDFSGPQQIHFHKLINII 289

Query: 288 ALLDIDKCQSSSTGS-YIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLATYWSLVQQ 346
             L++D+      G+ Y+  +LK+   + D      ++  SL S+DA+  L+TYW++++Q
Sbjct: 290 EALNLDRATDYEKGNEYVNELLKQK-YYND------YTDLSLSSLDATVALSTYWAIIEQ 342

Query: 347 QEHNLWGQIHSHRAMLTPISVTVLPLTSHHXXXXXXXXXXXXDNYAALESFAKLINTGER 406
           Q+  LWG+I  + + L P +VT+LP  SHH            +N+     F+  IN    
Sbjct: 343 QDLFLWGEIKRNSSSLFPTTVTILPF-SHHVYYTKLIKSLRKNNFRRTNEFSAFINEHNL 401

Query: 407 NSA----KLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLCHEFL 462
           N++    + ++P+   LL++Y AGN  +N  IITI+SK+FR L+ ++  DIT+DL +E L
Sbjct: 402 NTSSPEIQFKFPEFLHLLKEYCAGNLLDNPKIITILSKIFRNLNDFKERDITKDLAYELL 461

Query: 463 QEL--TCESIPNPQLLSNEIRSPSTSERAVLEQKIYDLALPNQ---NDDISRRHDFGKMN 517
            +L  T   + NP L ++++  P+ S R   + K+Y+LA P +    +  ++RH+F  +N
Sbjct: 462 TKLIPTSNLLANPLLANHDLSLPTNSGRGENQSKLYELATPTKIESGETTTKRHNFNDLN 521

Query: 518 VYCIDSETAHEIDDGISIEA--TGENAYTLHIHIADPVSLFSNSQEG--SFSKEIWNIAL 573
           VYCIDSETAHEIDDGISI+     +  Y+  +     +S+  +++E       +I  IA 
Sbjct: 522 VYCIDSETAHEIDDGISIKKYLKIDLLYSFILLTLQFISMKDSNKEKKTGIDDDILKIAY 581

Query: 574 QRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRC-----RKNNVEILEET 628
            R FT+YLPD V PMLP  Y +  DLGK     +TL+FSVDI        +  ++IL +T
Sbjct: 582 YRSFTTYLPDNVVPMLPSKYCEMSDLGKSNQNIETLTFSVDITIFDGSNNEETLKILYDT 641

Query: 629 FSVKLGLVSQFPRVTYKVVDRIL--GLEQDASQQTQELRTLHKIALLLRSKRVKEQNAII 686
           F ++ GLVS FP+VTY  VD+IL    +   +  T++LR L +IA LLR  R+ E NAI+
Sbjct: 642 FKIQFGLVSNFPKVTYDTVDKILDNSTKIPDTSITEDLRQLSRIAKLLRKYRINENNAIV 701

Query: 687 FGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILANTMAGKFFRDRGIPGV 746
           FGEGFNRG+    P   +T   + F DQ+ + S  LVSE+MILANT+ GK+ +D  IP +
Sbjct: 702 FGEGFNRGI----PDLQSTEDEIIFTDQKNSDSNELVSEMMILANTLTGKYCKDHKIPVI 757

Query: 747 FRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYSARAEKHEMIGAP 806
           +RCY  L +   A+Q    LR   +  + PS  D+AK+SS LNSS+YS    +H M+G+ 
Sbjct: 758 YRCYSPLDIGPEAQQECIILRSK-NIDRLPSNIDMAKMSSFLNSSYYSGTPSRHSMLGSD 816

Query: 807 AYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVLRKAARDSAS 866
            Y  VTSPLRRF DL+NH QLH +L G+ L F+ + V+     IQSR   L+       +
Sbjct: 817 EYATVTSPLRRFPDLLNHIQLHNHLKGYQLPFTPNHVAHYLTTIQSRSDTLKNIGNAVYT 876

Query: 867 FWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPEASSTVAIGD 926
             TL ++K      P++   V+VTSVP  G  RC +     ARG +KLK E +    IGD
Sbjct: 877 EMTLNYIKLLINKEPTKAFDVLVTSVPIEGSARCAIVGYEYARGTIKLKAEINPVPIIGD 936

Query: 927 VVHNCRITRLDCLDSIMELEMQ 948
           ++  C++T++  ++  +EL M+
Sbjct: 937 IITKCKVTKIFPIEGALELSME 958

>AFR448W Chr6 (1244187..1246640) [2454 bp, 817 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR287C (MSU1)
          Length = 817

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/823 (39%), Positives = 483/823 (58%), Gaps = 15/823 (1%)

Query: 134 MHPSHLLDSSLKIGDLVLLRSDPSQLCMCVEVPTEVTNPSYAFATIDGHIRFGERNMILL 193
           M P  L  ++L+IGDL +L + P +L +CVE PT+  +  YAFA  DG + +  ++ + L
Sbjct: 1   MRPGDLAGTTLQIGDLCVLSAVPGKLVVCVEQPTDAADARYAFAGADGAVCYATKSDVRL 60

Query: 194 RIPSFHKAAAKYLIKEEVPFLNTRIGAVKDSPEKTFMLSIVARQLYTSYVPFEITKAAWN 253
           R+P  HK   +YL+  E       +G VK++  +T++L +  R+L+ +    EI++ A  
Sbjct: 61  RVPGLHKRPLRYLLHREADHGYAPVGTVKNNISRTYLLPVAVRRLFAALGVTEISQQAVA 120

Query: 254 RMGVTTKKLELLHRFLQRSTGPWQMSIFKLCELVALLDIDKCQSSSTGSYIEGILKE--- 310
           ++     KLELLHR LQ   GPWQ+S+FKL +LV  L++      ++   +  +L E   
Sbjct: 121 QLPEVVAKLELLHRHLQSHLGPWQLSLFKLVDLVTRLELPNSPGEASEK-VAKLLAELNI 179

Query: 311 -AGMFRDAHPIESFSGRSLKSIDASDFLATYWSLVQQQEHNLWGQIHSHRAMLTPISVTV 369
             G +  A  I +    + K +D + +LATYW ++QQQ   +WG I  HRA+ +P+SVTV
Sbjct: 180 GQGSYCSAADI-NLRMAAPKQVDIALYLATYWGVLQQQGDQMWGDISYHRALFSPLSVTV 238

Query: 370 LPLTSHHXXXXXXXXXXXXDNYAALESFAKLINTGERNSAKLQYPQISRLLRDYAAGNFH 429
           LPL                D+YAAL+ FA L+N G+   A   Y  + +LLRDY AGN +
Sbjct: 239 LPLRDQTLFYDYLLRDMKRDDYAALDEFACLVNQGKYKEACSNYKSVLQLLRDYCAGNIN 298

Query: 430 NNGPIITIVSKLFRKLDKYQNNDITRDLCHEFLQELTCESIPNPQLLSNEIRSPSTSERA 489
           +N  +I +V++LFR+LD Y+  ++TR +  + L +L  E+  NP   ++++  P ++ R 
Sbjct: 299 SNAALIYLVTRLFRRLDAYKEEEVTRTIAFQLLGQLCPETPHNPLHWNHQLELPLSNPRT 358

Query: 490 VLEQKIYDLALPN-QNDDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIH 548
            LEQK+YDLA P    ++   R +F  +  YCIDS  AHEIDDG+SIE    + Y LH+H
Sbjct: 359 ALEQKVYDLASPPLDQEEPGPRKEFSGV-CYCIDSPDAHEIDDGVSIERLKGSRYRLHVH 417

Query: 549 IADPVSLFSNS-QEGSFSKE-IWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIAS 606
           IA P SLF  S   G    + + +IA +R FT+YLPD V PM+PKSY++A DLG+    +
Sbjct: 418 IAYPYSLFKKSYTPGEVPIDPVMDIAFRRAFTTYLPDLVFPMMPKSYTRASDLGQWDKPT 477

Query: 607 KTLSFSVDIRCRKNNVEILEETFSVKLGLVSQFPRVTYKVVDRIL-GLEQDASQQTQELR 665
           KT++ SVD+   K    + E T  + LG      RVTY  VD +L    QDA  +  +LR
Sbjct: 478 KTITISVDVDLSKKLRVVDEATLQIALGTTRTSKRVTYDYVDDLLESKRQDA--EASDLR 535

Query: 666 TLHKIALLLRSKRVKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSE 725
            L+K+A  LR +R   ++AI+FG+  N GL+ L P +      +   D + T S  LVSE
Sbjct: 536 LLYKVAESLREERKVLKHAIMFGDVQN-GLISLTPNEDGKLLNVQLVDSKSTKSNTLVSE 594

Query: 726 IMILANTMAGKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLS 785
           +MI+AN++AG++F +  IPGV+R    L LK  A   Y SL+  M  +   S+ D+ K++
Sbjct: 595 LMIMANSLAGRYFHENTIPGVYRGCTELLLKFEASNQYASLQRAMRQKGSVSSSDLVKVA 654

Query: 786 SLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSD 845
           + L +S YS+   +H M+G   YL +TSPLRR  D++NH QLH +L   P  FS++Q+  
Sbjct: 655 AFLTNSHYSSTPCRHAMVGTEEYLTITSPLRRLPDMINHMQLHRHLRSLPPCFSQEQIDA 714

Query: 846 LAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPEL 905
           L WHI +RDV L+ A++ S+ FWTL +LK Q    P +R  ++VTS+P  G V C +P +
Sbjct: 715 LNWHILARDVALKDASKRSSVFWTLGYLKDQLCAEPDKRWDLVVTSLPLNGFVHCKIPGI 774

Query: 906 STARGILKLKPEASSTVAIGDVVHNCRITRLDCLDSIMELEMQ 948
             + G LK+ P  ++  A+G  V NC ITRLD LD  +  EM+
Sbjct: 775 FYSSGKLKI-PSGANNPAVGSTVANCFITRLDSLDGTLRFEMK 816

>TPHA0I00350 Chr9 complement(65929..68760) [2832 bp, 943 aa] {ON}
           Anc_8.853 YMR287C
          Length = 943

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/922 (37%), Positives = 522/922 (56%), Gaps = 52/922 (5%)

Query: 45  AKFVYQRPGQLEPGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKDYLNMD 104
           +KF+ +R   LE   EIK++  IQ      F N++ +PSK W      + +   D +N  
Sbjct: 42  SKFL-ERTKGLEHISEIKEVDEIQNQSMMTFNNEYIVPSKVWFDTVTSSGSFSNDLINET 100

Query: 105 LTSLSSKQRADMNDSLKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMCVE 164
           L S   K+  D+   +        +G +  +   L D SL IGDLVLLR+   +L MCV+
Sbjct: 101 LISKKWKKFPDLPIKM--------NGDYSFNALQLFDRSLDIGDLVLLRNSDKELLMCVD 152

Query: 165 VPTEVTNPSYAFATIDGHIRFGERNMILLRI-PSFHKAAAKY-LIKE--EVPFLNTRIGA 220
           +P  + +P + FA  DG + F  +  + LRI  +  K    + LIK   E   +N +   
Sbjct: 153 IPMSIEDPRFTFAKPDGTLVFSTKQNVTLRILNTLPKNILNHDLIKNKYEAGLINRKENN 212

Query: 221 VKDSPEKTFMLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSI 280
               P     L +VARQ+ TS +P EI++ A   + V  KKLE+LHR++        +S 
Sbjct: 213 AIKLPS----LPVVARQIATSPLPSEISRIAARDLNVNLKKLEVLHRYISDGVETSSISF 268

Query: 281 FKLCELVALLDIDKC---QSSSTGSYIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFL 337
            KL  LV  +D++K    ++    ++I  I++     +D         + +  IDA   L
Sbjct: 269 LKLVHLVQNVDLNKLARNRADHDANHISNIIRNT---KD-------DIQYMTKIDAITLL 318

Query: 338 ATYWSLVQQQEHNLWGQIHSHRAMLTPISVTVLPLTSHHXXXXXXXXXXXXDNYAALESF 397
           +TYW+++QQQ+  LWG I  H A+L PISV+VLP  +              +N   +  F
Sbjct: 319 STYWAVIQQQQSQLWGDIQIHSALLFPISVSVLPFNNVIYLNETIPRVATDEN---INKF 375

Query: 398 AKLINTGERNSAKLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDL 457
            + IN         ++P    +L++Y  G ++ N  I TI+SKLFR+++ Y+N +++RD 
Sbjct: 376 TEAINKHNLEKINEKFPDFLNMLKEYGNGCYYGNEKITTIISKLFRRIETYKNKELSRDN 435

Query: 458 CHEFLQELT-CESIPNPQLLSNEIRSPSTSERAVLEQKIYDLALPNQNDDIS-RRHDFGK 515
           C +   EL     I N  LLS ++  P  S     EQ IY L   + +  I  RRHDF  
Sbjct: 436 CQKLYNELNPSNKILNSLLLSKDLCLPEISGTTRTEQLIYSLTEVDNHAIIDQRRHDFKD 495

Query: 516 MNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLF---SNSQEGSFSKEIWNIA 572
           + V+CID +TAHEIDDG+S+     N   L IHIADP SLF   +  +  S S EI NIA
Sbjct: 496 LKVFCIDEKTAHEIDDGVSVLRKDGNITRLFIHIADPASLFPLHNTIENNSTSDEILNIA 555

Query: 573 LQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKNNVEILEETFSVK 632
            +R FT+YLP+ V PMLPKS+    DLG  G  + T++FSVD    K++  ILE+TF ++
Sbjct: 556 FRRAFTTYLPEFVLPMLPKSFCTKSDLGNTGKMTNTITFSVDFD--KSSCSILEDTFEIQ 613

Query: 633 LGLVSQFPR-VTYKVVDRILG----LEQDASQQTQELRTLHKIALLLRSKRVKEQNAIIF 687
           LG V+ FP+  TYK VD+IL      E D  +  +E+R    IA  LR  R+ + +A+IF
Sbjct: 614 LGKVNNFPKNTTYKEVDKILNSSIKRENDIERDLREMRF---IANHLRKCRI-DNSAVIF 669

Query: 688 GEGFNRGLVKLMPTQTN--TATALSFEDQEETASTVLVSEIMILANTMAGKFFRDRGIPG 745
           GEGFN+G V L+  + +   +  ++F+D E T S ++VSE MILAN++AGK+F++  IP 
Sbjct: 670 GEGFNKGAVNLIEKKQDGEKSYKVNFKDSETTPSNIIVSEFMILANSLAGKYFKNHKIPA 729

Query: 746 VFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYSARAEKHEMIGA 805
           +++ YKGL +K  A   +  + ++ + ++ PS K+I+K+ SLL+SS +S++   HEMIG 
Sbjct: 730 IYKTYKGLNMKPKASSQFKKILNV-NKKRLPSIKEISKIGSLLSSSTFSSKPSIHEMIGT 788

Query: 806 PAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVLRKAARDSA 865
             Y  VTSPLRRF DL+NH+QLH YL   PL FS++++ ++ WH+  RD +LR  +R   
Sbjct: 789 DQYATVTSPLRRFPDLINHFQLHRYLTNQPLCFSQEKLDEMVWHLIERDTILRHYSRKFN 848

Query: 866 SFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPEASSTVAIG 925
            +WTL +L  + E NP  R  VMV SV   G V C+LP+LS A G LKLKP A++  AIG
Sbjct: 849 KYWTLQYLNEKIEGNPLLRFDVMVQSVSENGRVHCILPKLSYATGTLKLKPSATTIPAIG 908

Query: 926 DVVHNCRITRLDCLDSIMELEM 947
           +++ NC+I  +DCL + +E  +
Sbjct: 909 EIIKNCKIANIDCLGNSLEFAI 930

>Kpol_237.4 s237 complement(4514..7264) [2751 bp, 916 aa] {ON}
           complement(4514..7264) [2751 nt, 917 aa]
          Length = 916

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/820 (38%), Positives = 485/820 (59%), Gaps = 37/820 (4%)

Query: 140 LDSSLKIGDLVLLRSDPSQLCMCVEVPTEVTNPSYAFATIDGHIRFGERNMILLRIPSFH 199
           L+     GD+VLL  D S L MC+E+P    +P Y+FA  +G I F  R+ +LLRIP   
Sbjct: 117 LNKKFNRGDIVLLSQDLSNLYMCIELPQSTADPRYSFANSNGDIIFANRSSVLLRIP--L 174

Query: 200 KAAAKYLIKEEV--PFLNTRIGAVKDSPEKTFMLSIVARQLYTSYVPFEITKAAWNRMGV 257
           +     L+ ++   P     +G VK+S +  ++L ++ RQL  S     I+  A N + +
Sbjct: 175 QLPTNLLLSDDFLQPEPTQGVGTVKNSIDNPYVLPVLLRQLVISPSLSTISSNANNLLPI 234

Query: 258 TTKKLELLHRFLQRSTGPWQMSIFKLCELVALLDIDKCQSSSTGSYIEGILKEAGMFRDA 317
             KKL+LLHR LQ       + + +L  LV  LD+ K  S+   SYI   +  +      
Sbjct: 235 VLKKLQLLHRNLQAFK---IIPLVQLSSLVQNLDLTKATSNDGESYISNFIANSN----- 286

Query: 318 HPIESFSGRSLKSIDASDFLATYWSLVQQQEHNLWGQIHSHRAMLTPISVTVLPLTSHHX 377
                    S++SI++S+ +AT+W++ QQQ+ +LWG IH  +A+L P++V++LPL S++ 
Sbjct: 287 ------ENYSIESINSSNLIATFWAIRQQQQDHLWGDIHYSKALLFPLAVSILPLQSNYM 340

Query: 378 XXXXXXXXXXXDNYAALESFAKLINTGERNSAKLQYPQISRLLRDYAAGNFHNNGPIITI 437
                      D+  ++E F K    G  N+   ++PQ+  LL+ YA+G    +  I+T+
Sbjct: 341 YYKEILPAIELDH--SIERFTK---NGIPNTPN-EFPQLLNLLKQYASGAVLMDDKIVTM 394

Query: 438 VSKLFRKLDKYQNNDITRDLCHEFLQELTC--ESIPNPQLLSNEIRSPSTSERAVLEQKI 495
           +SK+FR LD Y+  D++RDLC +   EL    + I N  L + ++  P  S R   ++K+
Sbjct: 395 ISKIFRNLDDYKKYDVSRDLCQKLYNELVPKEQKIQNSLLYNTDLALPLASNRTEEQEKV 454

Query: 496 YDLALPNQNDDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSL 555
           Y +  P Q  + S RHDFG + V+CID +TAHEIDDG+SIE    N YTLH+HIADP S 
Sbjct: 455 YQMYNPIQTSNNSNRHDFGDLRVFCIDEKTAHEIDDGVSIEYKQNNVYTLHVHIADPSSY 514

Query: 556 FSNSQEGSFS---KEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFS 612
           F    + + +    EI  IALQR FT+YLPD V PMLPK   +A DLGK G  +KT++FS
Sbjct: 515 FKICNDHNVNIENDEILKIALQRSFTTYLPDQVLPMLPKLLCRAADLGKTGEKTKTITFS 574

Query: 613 VDIRCRKNN--VEILEETFSVKLGLVSQFPR-VTYKVVDRILGLEQDASQQTQ---ELRT 666
           VD++  K +  V++L+ TF V+LG VS F + +TY  VD IL   +++ +  +   +L++
Sbjct: 575 VDVKLNKKDMTVKVLDNTFQVRLGYVSNFVKDMTYSDVDSILNDSKESGRDKKVEKDLKS 634

Query: 667 LHKIALLLRSKRVKEQNAIIFGEGFNRGLVKLMPTQ-TNTATALSFEDQEETASTVLVSE 725
           +  IA  L + R+   NA+IF +  N G ++L   + T   T ++F+  + T S +LVSE
Sbjct: 635 MFLIAKGLNNSRIM-NNAVIFSDEINNGKIELTKDEITGEVTQINFKGGKFTDSNILVSE 693

Query: 726 IMILANTMAGKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLS 785
           +MILAN++AGKFF + GIP ++R Y  L L  +A+  YN++   +   K P+ KDI K+S
Sbjct: 694 LMILANSLAGKFFAENGIPAIYRSYSDLLLGKDAQSEYNAMLSNLKLGKRPTLKDINKIS 753

Query: 786 SLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQVSD 845
           SL N+S ++     H MI    Y  VTSPLRRF D++NH Q+H  L+  PL F++  + +
Sbjct: 754 SLFNTSKFTTYPSPHSMIATKYYATVTSPLRRFPDMINHLQIHRILSKQPLCFTQRDLEN 813

Query: 846 LAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLSVMVTSVPRLGVVRCVLPEL 905
           + W+IQ++DV+LR ++R   ++WTL H+K Q   +P ++  VM+TSV + GV  C+L + 
Sbjct: 814 MNWNIQTKDVILRSSSRMINTYWTLRHIKDQLSEDPDKKFDVMITSVQQNGVAHCILAQF 873

Query: 906 STARGILKLKPEASSTVAIGDVVHNCRITRLDCLDSIMEL 945
           S A+G L   P   S   IGD V NC+IT++DCL +++E 
Sbjct: 874 SFAKGKLVFDPNDESHPLIGDTVSNCKITKIDCLGNVLEF 913

>KLLA0C06314g Chr3 complement(556468..559419) [2952 bp, 983 aa] {ON}
           similar to uniprot|P39112 Saccharomyces cerevisiae
           YMR287C MSU1 RNase component of the mitochondrial
           degradosome along with the ATP-dependent RNA helicase
           Suv3p the degradosome associates with the ribosome and
           mediates turnover of aberrant or unprocessed RNAs
          Length = 983

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/911 (34%), Positives = 513/911 (56%), Gaps = 23/911 (2%)

Query: 57  PGVEIKQLSHIQKGLDERFYNQHFLPSKNWCRDNAVNWANMKD---YLNMDLTSLSS--- 110
           P VEIK     +     RF ++   PS +W R    +     D   ++++    +SS   
Sbjct: 64  PEVEIKPFRRTKAETLMRFNDRFVQPSIDWYRKVGKSHGENTDKDEFMHLLRNDISSSTL 123

Query: 111 -----KQRADMNDSLKPEVF---DSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLCMC 162
                K  +  N  L+   +   D++   F   PS ++ S+L  GD+ +L++ P +L +C
Sbjct: 124 FEETLKWLSKDNYKLRNNTYNGYDTQEIEFYFDPSAIVSSTLMPGDICVLKNSPFELLVC 183

Query: 163 VEVPTEVTNPSYAFATIDGHIRFGERNMILLRIPSFHKAAAKYLIKEEVPFLNTRIGAVK 222
           V+ P+E  +  + FA  DG++ +  +  + LR P+        +++ E     + +G+VK
Sbjct: 184 VKTPSEAMDARFTFANTDGNVVYAWKTSVHLRFPTIFNTTELEILQREKLHGYSPVGSVK 243

Query: 223 DSPEKTFMLSIVARQLYTSYVPFEITKAAWNRMGVTTKKLELLHRFLQRSTGPWQMSIFK 282
           +  + TF++  + R++  S V F I  AA  ++ +  KKLEL+HR+LQ  + PWQ+ I K
Sbjct: 244 NDKDVTFVIPTLPRRMLISNVTFRIADAAVQQLPIIKKKLELIHRYLQSGSSPWQIPILK 303

Query: 283 LCELVALLDI-DKCQSSSTGSYIEGILKEAGMFRDAHPIESFSGRSLKSIDASDFLATYW 341
           L E+ + L++ +  + S   ++++  L    ++  A+     S +    ++ S  LA YW
Sbjct: 304 LVEICSNLELSNNIEKSIATAFMKSGLSSDALYSLANSHFELSSKVPNKVECSRLLAVYW 363

Query: 342 SLVQQQEHNLWGQIHSHRAMLTPISVTVLPLTSHHXXXXXXXXXXXXDNYAALESFAKLI 401
           +L+ QQ   +WG++  HR +  P +VTVLPLT  H                 +   A LI
Sbjct: 364 ALLHQQGTQMWGEMTVHRGIFFPSAVTVLPLTKQHLHYHNIIHKLRQHGGVRINRIAALI 423

Query: 402 NTGERNSAKLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLCHEF 461
           N  +  S    +P I  LLRDYAAGN  +N  I +++S LFRKLD+Y+  +I+RD+C + 
Sbjct: 424 NENDLASLNKSFPYIVPLLRDYAAGNLEHNDTITSLISSLFRKLDEYKELNISRDVCFDL 483

Query: 462 LQELTCESIPNPQLLSNEIRSPSTSERAVLEQKIYDLALPNQNDDISR-RHDFGKMNVYC 520
           L+ +     PNP L+++E++ P  +ER  LEQKIYDLA+P + +  +  R ++  +  YC
Sbjct: 484 LKRINPSEPPNPLLINHELQLPVNNERVKLEQKIYDLAVPPKIEHSAEIRTEYKDLICYC 543

Query: 521 IDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEG--SFSKEIWNIALQRGFT 578
           IDS  AHEIDD +SI++ G   Y ++IH+ADP SLF  + E   + +  + +IA QR FT
Sbjct: 544 IDSPDAHEIDDAVSIKSLGGAKYRIYIHVADPASLFPEANEDGTTINSPVLDIAYQRAFT 603

Query: 579 SYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKN-NVEILEETFSVKLGLVS 637
           +YLPD V PMLP +Y+++ DLG+ G  +K ++FSVD    K+  + +L+++  V+L ++ 
Sbjct: 604 TYLPDKVFPMLPTTYARSSDLGQFGKPTKAVTFSVDCTFSKSKGLCLLKDSLKVELSVLH 663

Query: 638 QFPRVTYKVVDRILG--LEQDASQQTQELRTLHKIALLLRSKRVKEQNAIIFGEGFNRGL 695
           +  R+TY+ VD +L     +  S + ++L+TL  IA  LR +R+ +  A++F E  + G+
Sbjct: 664 KSTRITYEAVDELLDEPTTKPKSGKHEDLKTLFYIAKALRRQRIVDGGAVVF-ENSSTGI 722

Query: 696 VKLMPTQTNTATALSFEDQEETASTVLVSEIMILANTMAGKFFRDRGIPGVFRCYKGLQL 755
           V L P   +    +SF+DQ ET ST+LVSE+MILAN++   +F +  IPG++R Y+ L +
Sbjct: 723 VSLSPDDNSELVEVSFKDQIETKSTILVSELMILANSLTASYFEENQIPGIYRGYRPLNV 782

Query: 756 KDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLNSSFYSARAEKHEMIGAPAYLPVTSPL 815
            ++A      ++      K  S  DIAK+ S L SSFYS+    H+M+G   YL +TSPL
Sbjct: 783 VEDATSVPEWVKAKTQENKIISKADIAKMKSFLTSSFYSSLPTPHDMLGTSHYLTITSPL 842

Query: 816 RRFADLVNHWQLHCYLAGFPLKFSEDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKS 875
           RRF DLVNH QLH  L G PL + + Q+  + WHI +RDV L+ A+ D+  +WTL  LK 
Sbjct: 843 RRFPDLVNHLQLHRTLKGLPLLYKQSQLDGMVWHILTRDVTLKNASVDAQRYWTLRFLKK 902

Query: 876 QQELNPSRRLSVMVTSVPRLGVVRCVLPELSTARGILKLKPEASSTVAIGDVVHNCRITR 935
           + E        + +TS+   G   CV+ + + A G LK+    +  + +GD + +C I+ 
Sbjct: 903 EIEDPTKNNWKLQITSLTDNGYAHCVILDKAFAVGQLKINLNKNPPL-VGDQISDCEISN 961

Query: 936 LDCLDSIMELE 946
           + CLD I++ E
Sbjct: 962 IQCLDGILQFE 972

>TBLA0D05070 Chr4 (1255978..1258971) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 97/444 (21%), Positives = 174/444 (39%), Gaps = 89/444 (20%)

Query: 507 ISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQ----EG 562
           ++RR D     +  ID     +IDD +  +      + + +HIAD       +     EG
Sbjct: 524 LARRKDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIADVTHFVKPNTPLDAEG 583

Query: 563 SFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTL----SFSVDIRCR 618
           +           RG + YL D    MLP        LG D  + K      +FSV +   
Sbjct: 584 A----------SRGTSVYLVDKRIDMLPLL------LGTDLCSLKPYVDRYAFSV-LWEL 626

Query: 619 KNNVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLLRSKR 678
            +N  I++  F+    ++      +Y+     +  +    + TQ +R L K+++ L+ KR
Sbjct: 627 DDNANIVDVNFTK--SVIRSREAFSYEQAQIRIDDKSQTDELTQGMRALLKLSIKLKQKR 684

Query: 679 VKEQNAIIFGEGFNRGLVKLMPTQ------TNTATALSFEDQEETASTVLVSEIMILAN- 731
                        + G + L   +      + T+     E ++  A+  LV E M+LAN 
Sbjct: 685 ------------LDAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANI 732

Query: 732 TMAGKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQK-----FPSAKDIAK--- 783
           ++A K F       + R + G+    N    + +L +M+H +K       S+K +A    
Sbjct: 733 SVARKIFESFPQTAMLRRH-GVPPSTN----FETLNEMLHQRKQMTISLESSKALADSLD 787

Query: 784 ---------LSSLLN--------------SSFYSARAEKHEMIGAPAYLPVTSPLRRFAD 820
                     ++L+               S  YS    +H  +    Y   TSP+RR+ D
Sbjct: 788 RCVDPKDPYFNTLIRIMSTRCMMAAQYFYSGAYSYSEFRHYGLAVDIYTHFTSPIRRYCD 847

Query: 821 LVNHWQLHCYLAGFPLKFS---EDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQ 877
           +V H QL   +   PL  S   ++++  +  +I  R    + A R S  ++    +++ +
Sbjct: 848 VVAHRQLAGAIGYEPLDLSHRDKNKMDMICRNINKRHRNAQFAGRASIEYYVGQVMRNNE 907

Query: 878 ELNPSRRLSVM----VTSVPRLGV 897
            +     + V+    V  VPR GV
Sbjct: 908 SVETGYVIKVLNNGIVVLVPRFGV 931

>Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON}
           (83527..86493) [2967 nt, 989 aa]
          Length = 988

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 101/434 (23%), Positives = 169/434 (38%), Gaps = 69/434 (15%)

Query: 507 ISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNS-----QE 561
           + +R D     +  ID     +IDD +  +      + + +HIAD V+ F  +      E
Sbjct: 515 LQKRVDLRDKLICSIDPPGCVDIDDALHAKKLPNGHFEVGVHIAD-VTHFVKAGTPLDAE 573

Query: 562 GSFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKT----LSFSVDIRC 617
           G+           RG + YL D    MLP        LG D  + K      +FSV I  
Sbjct: 574 GA----------SRGTSVYLVDKRIDMLPML------LGTDLCSLKPYVDRFAFSV-IWE 616

Query: 618 RKNNVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLLRSK 677
              N +I++  FS    ++      +Y+       L  D   QT EL TL   ALL  S 
Sbjct: 617 LDENADIVKVDFSK--SVIRSREAFSYEQAQ----LRIDDKNQTDEL-TLGMRALLDLSI 669

Query: 678 RVKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILAN-TMAGK 736
           ++K++             VK+    + T+     E ++  A+  LV E M+LAN ++A K
Sbjct: 670 KLKQKRLDAGALNLASPEVKVH-MDSETSDPGEVEIKKLLATNSLVEEFMLLANISVARK 728

Query: 737 FF---------RDRGIP---------GVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSA 778
            +         R    P          + +  KGL +   + +      D    +K P  
Sbjct: 729 IYDSFPQTAMLRRHAAPPSTNFEILNEMLQKRKGLSISLESSKALADSLDRCVDKKDPYF 788

Query: 779 KDIAKLSS--------LLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCY 830
             + ++ S           S  YS    +H  +    Y   TSP+RR+ D+V H QL   
Sbjct: 789 NTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGA 848

Query: 831 LAGFPLKFS---EDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLSV 887
           +   PL  S   ++++  +  +I  R    + A R S  ++    +++ + +     + V
Sbjct: 849 IGYEPLDLSHRDKNKMEMICKNINRRHRNAQFAGRASIEYYVGQVMRNNESVETGYVIKV 908

Query: 888 M----VTSVPRLGV 897
           +    V  VP+ GV
Sbjct: 909 LNNGIVVIVPKFGV 922

>NDAI0C04050 Chr3 complement(921707..925489) [3783 bp, 1260 aa] {ON}
            Anc_5.307 YDR293C
          Length = 1260

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 93/414 (22%), Positives = 159/414 (38%), Gaps = 96/414 (23%)

Query: 475  LLSNEI---RSPSTSERAVLEQKIYDLALPNQNDDISRRHDFGKMNVYCI----DSETAH 527
             LSNE    + P T E+A+ +      ALP   ++++ R DF   + Y I    ++++  
Sbjct: 671  FLSNEYLDNKDP-TKEKAMFQ------ALPIPENELAVRTDFTDPSEYSILAIAENDSLS 723

Query: 528  EIDDGISIEATGENAYTLHIHIADPVSLFSNSQEGSFSKEIWNIALQRGFTSYLPDCVTP 587
            E    + ++   +  + L  H+ D  +     +  S  +     A +R    ++P  V  
Sbjct: 724  EF--ALHVKNNNDGTFELGCHVVDATAHIE--ENSSLDRR----ARKRSSGVFMPQKVVN 775

Query: 588  MLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKNNVEILEETFSVKLGLVSQFPRVTYKVV 647
            +LPK+ +++  L KD    K+ + SV        +EI   T    + L S+F  +T K +
Sbjct: 776  LLPKALNESLSLKKD---KKSATLSVIYTLNAETLEIRSTTVCESIILPSRF--MTAKEI 830

Query: 648  DRILGLEQDASQQTQELRTLHKIALLLRSKRVKEQNAIIFGEGFNRGLVKLMPTQT---- 703
            D  L     +      L  + KIA    + R++   A            KLMPT +    
Sbjct: 831  DDNLA----SDDVDPYLSIVEKIATSFYATRIEYPEA------------KLMPTLSLFES 874

Query: 704  --NTATALSFEDQEETASTVLVSEIMILAN-TMAGKFFRDRGIPGVFRCYKGLQLKDNAR 760
              +    +     + T   V+++EI    N T+A K +   G     R           R
Sbjct: 875  IDDEKVNVDLNILDRTLGYVVINEIQHKVNSTIAEKIYTKLGDSSFLR-----------R 923

Query: 761  QGYNSLRDMM----HSQKFPSAKDIAKLSSLLNS-------------------------S 791
            +    +  M       QKF    DI  +++++ S                          
Sbjct: 924  EAQPVITKMSLFKNKIQKFGLDIDITSIATIIQSILKIEDSDVRVGVEILLFKTMSRAKY 983

Query: 792  FYSARAE----KHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSED 841
            F + + +     H  +  P Y   TSPLRR+AD V H QL   + G P  ++ED
Sbjct: 984  FVAGKVDPDQYSHYSLNLPIYTHFTSPLRRYADHVVHRQLRSAIRGVP--YTED 1035

>ZYRO0G01166g Chr7 complement(91672..94653) [2982 bp, 993 aa] {ON}
           highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021C DIS3 Nucleolar exosome component
           involved in rRNA processing and RNA degradation binds
           Gsp1p/Ran and enhances the GEF activity of Srm1p
           implicated in mitotic control homologous to the E. coli
           RNase R of the RNase II family
          Length = 993

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 90/435 (20%), Positives = 164/435 (37%), Gaps = 71/435 (16%)

Query: 507 ISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEGSFSK 566
           + +R D     +  ID     +IDD +  +      + + +HIAD V+ F          
Sbjct: 520 LPKRRDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIAD-VTHFVKPNTA---- 574

Query: 567 EIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKT----LSFSVDIRCRKNNV 622
            +      RG + YL D    MLP        LG D  + K      +FSV +     N 
Sbjct: 575 -LDGEGASRGTSVYLVDKRIDMLPML------LGTDLCSLKPYVDRFAFSV-LWELNENA 626

Query: 623 EILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLLRSKRVKEQ 682
           +I+   F+    ++      +Y+     +       + T  +R L K+++ L+ KR+   
Sbjct: 627 DIVNVDFAK--SVIKSREAFSYEQAQLRIDDPNQQDELTHGMRALLKLSIKLKEKRI--- 681

Query: 683 NAIIFGEGFNRGLVKLMPTQ------TNTATALSFEDQEETASTVLVSEIMILAN-TMAG 735
                    N G + L   +      + T+     E ++  A+  LV E M+LAN ++A 
Sbjct: 682 ---------NAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVAR 732

Query: 736 KFF----------RDRGIPG--------VFRCYKGLQLKDNARQGYNSLRDMMHSQKFPS 777
           K +          R    P         + +  KG+ +   + +      D     K P 
Sbjct: 733 KIYDSFPQTAMLRRHASPPSTNFELLNEMLQTRKGMSISLESSKALADSLDRCIDPKDPY 792

Query: 778 AKDIAKLSS--------LLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHC 829
              + ++ S           S  YS    +H  +    Y   TSP+RR+ D+V H QL  
Sbjct: 793 FNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAG 852

Query: 830 YLAGFPLKFS---EDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLS 886
            +   PL  S   ++++  +  +I  +    + A R S  ++    +++ + +     + 
Sbjct: 853 AIGYEPLDLSHRDKNRMDMICKNINKKHRNAQFAGRASIEYYVGQVMRNNESVETGYVIK 912

Query: 887 VM----VTSVPRLGV 897
           V+    V  VP+ GV
Sbjct: 913 VLNNGIVVLVPKFGV 927

>TDEL0D02380 Chr4 complement(463000..465993) [2994 bp, 997 aa] {ON}
           Anc_1.367 YOL021C
          Length = 997

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 90/435 (20%), Positives = 164/435 (37%), Gaps = 71/435 (16%)

Query: 507 ISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEGSFSK 566
           + +R D     +  ID     +IDD +  +      + + +HIAD V+ F        ++
Sbjct: 524 LQKRRDLRDKLICSIDPPGCVDIDDALHAKRLSNGNWEVGVHIAD-VTHFVKPNTALDAE 582

Query: 567 EIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKT----LSFSVDIRCRKNNV 622
                   RG + YL D    MLP        LG D  + K      +FSV I    +N 
Sbjct: 583 -----GASRGTSVYLVDKRIDMLPML------LGTDLCSLKPYVERFAFSV-IWELDDNA 630

Query: 623 EILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLLRSKRVKEQ 682
            I+   F     ++      +Y+     +       + T+ +R L ++++ L+ KR+   
Sbjct: 631 NIVNVDFMK--SVIKSREAFSYEQAQLRIDDPNQKDELTEGMRALLQLSIKLKQKRL--- 685

Query: 683 NAIIFGEGFNRGLVKLMPTQ------TNTATALSFEDQEETASTVLVSEIMILAN-TMAG 735
                    + G + L   +      + T+     E ++  A+  LV E M+LAN ++A 
Sbjct: 686 ---------DAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVAR 736

Query: 736 KFF---------RDRGIP---------GVFRCYKGLQLKDNARQGYNSLRDMMHSQKFPS 777
           K F         R    P          + +  KGL +   + +      D     + P 
Sbjct: 737 KIFDAFPQTAMLRRHAAPPSTNFETLNEMLQTRKGLSISIESSKALADSLDRCIDPQDPY 796

Query: 778 AKDIAKLSS--------LLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHC 829
              + ++ S           S  YS    +H  +    Y   TSP+RR+ D+V H QL  
Sbjct: 797 FNTLVRIMSTRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAG 856

Query: 830 YLAGFPLKF---SEDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLS 886
            +   PL      ++++  +  +I  +    + A R S  ++    +++ + +     + 
Sbjct: 857 AIGYEPLDLMHRDKNKMDMICRNINKKHRNAQFAGRASIEYYVGQVMRNNETVEAGYVIK 916

Query: 887 VM----VTSVPRLGV 897
           V+    V  VPR GV
Sbjct: 917 VLNNGIVVLVPRFGV 931

>NDAI0H03560 Chr8 (869622..872660) [3039 bp, 1012 aa] {ON} Anc_1.367
           YOL021C
          Length = 1012

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 92/440 (20%), Positives = 168/440 (38%), Gaps = 81/440 (18%)

Query: 507 ISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEGSFSK 566
           ++ R D     +  ID     +IDD +  +      + + +HIAD V+ F   Q  +   
Sbjct: 539 LANRKDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIAD-VTHFV-KQGTALDA 596

Query: 567 EIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKT----LSFSVDIRCRKNNV 622
           E       RG + YL D    MLP        LG D  + K      +FSV +    +N 
Sbjct: 597 E----GASRGTSVYLVDKRIDMLPML------LGTDLCSLKPYVDRFAFSV-LWELDSNA 645

Query: 623 EILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLLRSKRVKEQ 682
           +I++  F+    ++      +Y+     +         TQ +R L ++++ L+ KR+   
Sbjct: 646 DIVKVDFTK--SVIKSREAFSYEQAQLRIDDPNQTDDLTQGMRALLQLSIKLKQKRL--- 700

Query: 683 NAIIFGEGFNRGLVKLMPTQ------TNTATALSFEDQEETASTVLVSEIMILAN-TMAG 735
                    + G + L   +      + T+     E ++  A+  LV E M+LAN ++A 
Sbjct: 701 ---------DNGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISVAR 751

Query: 736 KFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQK-----FPSAKDIAK------- 783
           K +       + R +            +  L +M+H +K       S+K +A        
Sbjct: 752 KIYDAFPQTAMLRRHAA-----PPSTNFELLNEMLHRRKNMSISLESSKALADSLDRCED 806

Query: 784 -------------------LSSLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNH 824
                               +    S  YS    KH  +    Y   TSP+RR+ D+V H
Sbjct: 807 PKDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRYCDVVAH 866

Query: 825 WQLHCYLAGFPLKFS---EDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNP 881
            QL   +   PL  S   ++++  +  +I  +    + A R S  ++    +++ + +  
Sbjct: 867 RQLAGAIGYEPLSLSHRDKNKMDMICRNINKKHRNAQFAGRASIEYYVGQVMRNNETVET 926

Query: 882 SRRLSV----MVTSVPRLGV 897
              + V    +V  VP+ GV
Sbjct: 927 GYVIKVFNNGIVVLVPKFGV 946

>NCAS0D00590 Chr4 complement(98734..101730) [2997 bp, 998 aa] {ON}
           Anc_1.367
          Length = 998

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 98/442 (22%), Positives = 168/442 (38%), Gaps = 89/442 (20%)

Query: 509 RRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEGSFSKEI 568
           RR D     +  ID     +IDD +  +      + + +HIAD V+ F        ++  
Sbjct: 527 RRKDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIAD-VTHFVKPGTALDAE-- 583

Query: 569 WNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKT----LSFSVDIRCRKNNVEI 624
                 RG + YL D    MLP        LG D  + K      +FSV +     N +I
Sbjct: 584 ---GASRGTSVYLVDKRIDMLPML------LGTDLCSLKPYVDRFAFSV-LWELDENADI 633

Query: 625 LEETFSVKLGLVSQFPRVTYKVVD-RILGLEQDASQQ---TQELRTLHKIALLLRSKRVK 680
           +   F+    ++      +Y+    RI     DASQ    TQ +R L ++++ L+ KR+ 
Sbjct: 634 VNVDFTK--SVIKSREAFSYEQAQLRI----DDASQTDDLTQGMRALLQLSIKLKQKRL- 686

Query: 681 EQNAIIFGEGFNRGLVKLMPTQ------TNTATALSFEDQEETASTVLVSEIMILAN-TM 733
                      + G + L   +      + T+     E ++  A+  LV E M+LAN ++
Sbjct: 687 -----------DAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLANISV 735

Query: 734 AGKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQK-----FPSAKDIAK----- 783
           A K +       + R +            +  L +M+H +K       S+K +A      
Sbjct: 736 ARKIYDAFPQTAMLRRHAA-----PPSTNFELLNEMLHQRKNMSISLESSKALADSLDRC 790

Query: 784 ---------------------LSSLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLV 822
                                 +    S  YS    KH  +    Y   TSP+RRF D+V
Sbjct: 791 EDPKDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRFCDVV 850

Query: 823 NHWQLHCYLAGFPLKFS---EDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQEL 879
            H QL   +   PL  S   ++++  +  +I  +    + A R S  ++    +++ +  
Sbjct: 851 AHRQLAGAIGYEPLDLSHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRNNEST 910

Query: 880 NPSRRLSV----MVTSVPRLGV 897
                + V    +V  VP+ GV
Sbjct: 911 ETGYVIKVFNNGIVVLVPKFGV 932

>Skud_15.137 Chr15 complement(241849..244941) [3093 bp, 1030 aa]
           {ON} YOL021C (REAL)
          Length = 1030

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 97/443 (21%), Positives = 174/443 (39%), Gaps = 87/443 (19%)

Query: 507 ISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQ----EG 562
           +++R D     +  ID     +IDD +         + + +HIAD       S     EG
Sbjct: 557 LTKRKDLRDKVICSIDPPGCVDIDDALHARKLPNGNWEVGVHIADVTHFVKPSTALDAEG 616

Query: 563 SFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKT----LSFSVDIRCR 618
           +           RG + YL D    MLP        LG D  + K      +FSV     
Sbjct: 617 A----------ARGTSVYLVDKRIDMLPML------LGTDLCSLKPYVDRFAFSVMWELD 660

Query: 619 KN----NVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLL 674
            N    NVE ++     +      + +   ++ D+     QD  + T  +R L K+++ L
Sbjct: 661 DNADIVNVEFMKSVIKSREAF--SYEQAQLRIDDK----NQD-DELTLGMRALLKLSIKL 713

Query: 675 RSKRVKEQNAIIFGEGFNRGLVKL-MPTQTNTATALSFEDQEETASTVLVSEIMILAN-T 732
           + KR+ E  A+          VK+ M ++T+    +  E ++  A+  LV E M+LAN +
Sbjct: 714 KQKRL-EAGAL----NLASPEVKVHMDSETSDPNEV--EIKKLLATNSLVEEFMLLANIS 766

Query: 733 MAGKFFRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQK-----FPSAKDIA-KLSS 786
           +A K +       + R +            + +L +M++++K       S+K +A  L  
Sbjct: 767 VARKIYDAFPQTAMLRRHAA-----PPSTNFETLNEMLNTRKNMSISLESSKALADSLDR 821

Query: 787 LLNSS---------------------FYSARAE----KHEMIGAPAYLPVTSPLRRFADL 821
            ++S                      FYS        +H  +    Y   TSP+RR+ D+
Sbjct: 822 CVDSEDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDV 881

Query: 822 VNHWQLHCYLAGFPLKFS---EDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQE 878
           V H QL   +   PL  +   ++++  +  +I  +    + A R S  ++    ++S + 
Sbjct: 882 VAHRQLAGAIGYEPLSLAHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRSNES 941

Query: 879 LNPSRRLSV----MVTSVPRLGV 897
                 + V    +V  VP+ GV
Sbjct: 942 TETGYIIKVFNNGIVVLVPKFGV 964

>KLTH0H13420g Chr8 (1172833..1175793) [2961 bp, 986 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 986

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 90/441 (20%), Positives = 172/441 (39%), Gaps = 83/441 (18%)

Query: 507 ISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQ-----E 561
           + +R D     +  ID     +IDD +  +      + + +HIAD V+ F  +      E
Sbjct: 513 LPKRRDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIAD-VTHFVKANTPLDAE 571

Query: 562 GSFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKT----LSFSVDIRC 617
           G+           RG + YL D    MLP        LG +  + K      +FSV    
Sbjct: 572 GA----------SRGTSVYLVDKRIDMLPML------LGTNLCSLKPYVDRFAFSVLWEL 615

Query: 618 RKN-NVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLLRS 676
            +N N+  ++ T SV    +      +Y+     +  E    + TQ +R L ++++ L+ 
Sbjct: 616 DENANIVNVDFTKSV----IKSREAFSYEQAQLRIDDESQKDELTQGMRALLQLSIKLKQ 671

Query: 677 KRVKEQNAIIFGEGFNRGLVKLMPTQ------TNTATALSFEDQEETASTVLVSEIMILA 730
           KR+            + G + L   +      + T+     E ++  A+  LV E M+LA
Sbjct: 672 KRL------------DAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFMLLA 719

Query: 731 NTMAGK----------FFRDRGIP---------GVFRCYKGLQLK-DNARQGYNSLRDM- 769
           N    +            R    P          + +  KG+ +  ++++   NSL    
Sbjct: 720 NISVARRIYEAFPQTAMLRRHAAPPATNFETLNEMLQLRKGMSISLESSKALANSLDRCV 779

Query: 770 -MHSQKFPSAKDIAKLSSLLNSSFYSARAE-----KHEMIGAPAYLPVTSPLRRFADLVN 823
            +    F +   I     ++ + ++ A A      +H  +    Y   TSP+RR+ D+V 
Sbjct: 780 DLEDPYFNTLVRIMSTRCMMAAQYFYAGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVA 839

Query: 824 HWQLHCYLAGFPLKFS---EDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELN 880
           H QL   +   PL  +   ++++  +  +I  +    + A R S  ++    +++ + + 
Sbjct: 840 HRQLAAAIGYEPLDLNHRDKNKMDFMCRNINKKHRNAQFAGRASIEYYVGQVMRNNESVE 899

Query: 881 PSRRLSV----MVTSVPRLGV 897
               + V    +V  VP+ GV
Sbjct: 900 TGYVIRVFHNGIVVLVPKFGV 920

>KAFR0C04530 Chr3 (904255..907257) [3003 bp, 1000 aa] {ON} Anc_1.367
           YOL021C
          Length = 1000

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 95/434 (21%), Positives = 161/434 (37%), Gaps = 69/434 (15%)

Query: 507 ISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEGSFSK 566
           +++R D     +  ID     +IDD +  +      + + +HIAD V+ F        ++
Sbjct: 527 LAKRTDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIAD-VTHFVKPGTALDAE 585

Query: 567 EIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKT----LSFSVDIRCRKNNV 622
                   RG + YL D    MLP        LG D  + K      +FSV         
Sbjct: 586 -----GASRGTSVYLVDKRIDMLPML------LGTDLCSLKPYVDRFAFSVIW------- 627

Query: 623 EILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLLRSKRVKEQ 682
           E+ E+   V +       R           +  D S Q  EL TL   ALL  SK++K++
Sbjct: 628 ELNEDADIVNVDFTKSVIRSREAFSYEQAQVRIDDSNQKDEL-TLGMRALLHLSKKLKQK 686

Query: 683 NAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILAN-TMAGKFFRDR 741
                        VK+    + T+     E ++  A+  LV E M+LAN ++A K +   
Sbjct: 687 RLDAGALNLASPEVKVH-MDSETSDPGEVEIKKLLATNSLVEEFMLLANISVARKIYDAF 745

Query: 742 GIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQK-----FPSAKDIAK------------- 783
               + R +            +  L +M+H +K       S+K +A              
Sbjct: 746 PQTAMLRRHAA-----PPSTNFELLNEMLHQRKNMTISLESSKALADSLDRCIDPQDAYF 800

Query: 784 -------------LSSLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCY 830
                         +    S  YS    KH  +    Y   TSP+RR+ D+V H QL   
Sbjct: 801 NTLVRIMSTRCMMAAQYFYSGAYSYPDFKHYGLAVDIYTHFTSPIRRYCDVVAHRQLAAA 860

Query: 831 LAGFPLKF---SEDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLSV 887
           +   PL      ++++  +  +I  +    + A R S  ++    +++ + +     + V
Sbjct: 861 IDYEPLSLMHRDKNKMDMVCRNINKKHRNAQFAGRASIEYYVGQVMRNNESVETGYVIKV 920

Query: 888 ----MVTSVPRLGV 897
               +V  VP+ GV
Sbjct: 921 FNNGIVVLVPKFGV 934

>CAGL0H04411g Chr8 complement(415101..418124) [3024 bp, 1007 aa]
           {ON} highly similar to uniprot|Q08162 Saccharomyces
           cerevisiae YOL021c DIS3
          Length = 1007

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 98/448 (21%), Positives = 172/448 (38%), Gaps = 69/448 (15%)

Query: 493 QKIYDLALPNQNDDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADP 552
           +K+ D A   ++  + +R D     +  ID     +IDD +  +      + + +HIAD 
Sbjct: 520 EKLSDSAAIAKDPLLPKRRDLRDKLICSIDPPNCVDIDDALHAKMLENGNWEVGVHIAD- 578

Query: 553 VSLFSNSQEGSFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASK----T 608
           V+ F        ++        RG + YL D    MLP        LG D  + K     
Sbjct: 579 VTHFVKPGTALDAE-----GASRGTSVYLVDKRIDMLPML------LGTDLCSLKPYVDR 627

Query: 609 LSFSV----DIRCRKNNVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQEL 664
            +FSV    D      NV+  +     +     +  ++      RI     D   QT EL
Sbjct: 628 FAFSVLWELDQDANIVNVDFTKSVIRSREAFSYEQAQI------RI-----DDPNQTDEL 676

Query: 665 RTLHKIALLLRSKRVKEQNAIIFGEGFNRGLVKL-MPTQTNTATALSFEDQEETASTVLV 723
            T    ALL  SK++K++             VK+ M ++T+    +  E ++  A+  LV
Sbjct: 677 -TQGMRALLQLSKKLKQKRLDAGALNLASPEVKVHMDSETSDPNEV--EIKKLLATNSLV 733

Query: 724 SEIMILAN-TMAGKFF---------RDRGIP---------GVFRCYKGLQLKDNARQGYN 764
            E M+LAN ++A K +         R    P          + +  KGL +   + +   
Sbjct: 734 EEFMLLANISVARKIYDSFPQTAMLRRHAAPPSTNFEILNEMLQTKKGLTISLESSKALA 793

Query: 765 SLRDMMHSQKFPSAKDIAKLSS--------LLNSSFYSARAEKHEMIGAPAYLPVTSPLR 816
              D    +  P    + ++ S           S  YS    +H  +    Y   TSP+R
Sbjct: 794 DSLDRCVDKNDPYFNTLVRIMSTRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIR 853

Query: 817 RFADLVNHWQLHCYLAGFPLKFS---EDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHL 873
           R+ D+V H QL   +   PL  +   + ++  +  +I  +    + A R S  ++    +
Sbjct: 854 RYCDVVAHRQLAAAIGYEPLSLTHRDKTKMDMICKNINRKHRNAQFAGRASIEYYVGQVM 913

Query: 874 KSQQELNPSRRLSV----MVTSVPRLGV 897
           ++ + +     + V    +V  VP+ GV
Sbjct: 914 RNNESVETGYVIKVFNNGIVVLVPKFGV 941

>TPHA0A02320 Chr1 complement(485855..488902) [3048 bp, 1015 aa] {ON}
           Anc_1.367 YOL021C
          Length = 1015

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 91/435 (20%), Positives = 168/435 (38%), Gaps = 71/435 (16%)

Query: 507 ISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEGSFSK 566
           +  R D     +  ID     +IDD +  +      + + +HIAD V+ F        ++
Sbjct: 542 LKNRQDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIAD-VTHFVKPGTALDAE 600

Query: 567 EIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASK----TLSFSVDIRCRKNNV 622
                   RG + YL D    MLP        LG D  + K      +FSV I    +N 
Sbjct: 601 -----GASRGTSVYLVDKRIDMLPML------LGTDLCSLKPYVDRFAFSV-IWELDDNA 648

Query: 623 EILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLLRSKRVKEQ 682
           EI++  F+    ++      +Y+     +  +    + T+ +R L ++++ L+ KR+   
Sbjct: 649 EIIDVKFTK--SVIRSREAFSYEQAQLRIDDKNQTDELTKGMRALLELSVKLKQKRL--- 703

Query: 683 NAIIFGEGFNRGLVKLMPTQ------TNTATALSFEDQEETASTVLVSEIMILAN-TMAG 735
                    + G + L   +      + T+     E ++  A+  LV E M+LAN ++A 
Sbjct: 704 ---------DAGALNLASPEVKVHMDSETSDPNEVEIKKLLATNSLVEEFMLLANISVAR 754

Query: 736 KFFRDRGIPGVFRCYKG------------LQLKDNARQGYNSLRDMMHS------QKFPS 777
           K F       + R +              LQ + N      S + +  S       K P 
Sbjct: 755 KIFDAFPQTAMLRRHASPPSTNFAILNEMLQKRKNLSISLESSKALADSLDRCIDPKDPY 814

Query: 778 AKDIAKLSS----LLNSSFYSARAE----KHEMIGAPAYLPVTSPLRRFADLVNHWQLHC 829
              + ++ S    +    FYS   +    +H  +    Y   TSP+RRF D++ H QL  
Sbjct: 815 FNTLIRIMSTRCMMAAQYFYSGAYQYSDFRHYGLAVDIYTHFTSPIRRFCDVIAHRQLAG 874

Query: 830 YLAGFPLKF---SEDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLS 886
            +   PL      ++++  +  +I  +    + A R S  ++    +++ +       + 
Sbjct: 875 AIGYEPLALMHRDKNKMEMICKNINKKHRNAQFAGRASIEYYVGQVMRNNECTETGYVIK 934

Query: 887 VM----VTSVPRLGV 897
           V+    V  VP+ GV
Sbjct: 935 VLNNGIVVLVPKFGV 949

>Ecym_2715 Chr2 complement(1383023..1385989) [2967 bp, 988 aa] {ON}
           similar to Ashbya gossypii AEL031C
          Length = 988

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 94/433 (21%), Positives = 164/433 (37%), Gaps = 53/433 (12%)

Query: 507 ISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEGSFSK 566
           +++R D     +  ID     +IDD +  +      + + +HIAD V+ F        ++
Sbjct: 516 LAKRRDMRDKLICSIDPPGCVDIDDALHAKKLINGNWEVGVHIAD-VTHFVKPNTALDAE 574

Query: 567 EIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLSFSVDIRCRKNNVEILE 626
                   R  + YL D    MLP       DL     +    +FSV I    N+  I+ 
Sbjct: 575 -----GASRATSVYLVDKRIDMLPMLL--GTDLCSLKASVDRFAFSV-IWELDNDANIVS 626

Query: 627 ETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLLRSKRVKEQNAII 686
             F+    ++      +Y+       L  D   Q  EL TL   ALL  SK++K++    
Sbjct: 627 VEFTK--SVIRSREAFSYEQAQ----LRIDDPNQNDEL-TLGMRALLQLSKKLKQKRLDA 679

Query: 687 FGEGFNRGLVKL-MPTQTNTATALSFEDQEETASTVLVSEIMILAN-TMAGKFFRDRGIP 744
                    VK+ M ++T+  + +  +    T S  LV E M+LAN ++A K +      
Sbjct: 680 GALNLASPEVKVHMDSETSDPSEVEIKKLLSTNS--LVEEFMLLANISVARKIYDSFPQT 737

Query: 745 GVFRCYKG------------LQLKDNARQGYNSLRDMMHSQKFPSAKDIAKLSSLLN--- 789
            + R +              LQ++ N      S + +  S       D    ++L+    
Sbjct: 738 AMLRRHAAPPSTNFESLNEMLQVRKNMSISLESSKALADSLDRCVDSDDVYFNTLVRIMS 797

Query: 790 -----------SSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKF 838
                      S  YS    +H  +    Y   TSP+RR+ D++ H QL   +    L  
Sbjct: 798 TRCMMAAQYFYSGAYSYSDFRHYGLAVDIYTHFTSPIRRYCDIIAHRQLAAAIGYESLDL 857

Query: 839 S---EDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLSV----MVTS 891
           S   + ++  +  +I  R    + A R S  +     +++ + +     + V    +   
Sbjct: 858 SHRDKQKMEIICRNINKRHRNAQFAGRASIEYHVGQVMRNNESIETGYVIKVFNNGIAVL 917

Query: 892 VPRLGVVRCVLPE 904
           VP+ GV   +L E
Sbjct: 918 VPKFGVEGLILAE 930

>KNAG0C01950 Chr3 (377736..380726) [2991 bp, 996 aa] {ON} Anc_1.367
           YOL021C
          Length = 996

 Score = 38.9 bits (89), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 106/466 (22%), Positives = 173/466 (37%), Gaps = 68/466 (14%)

Query: 479 EIRSPSTSERAVLEQKIYDLALPNQNDDI---------SRRHDFGKMNVYCIDSETAHEI 529
           E R  S      L ++ +D   P   DDI         ++R D     +  ID     +I
Sbjct: 486 EYRPFSKKVLECLPEEGHDWKAPVSVDDIEANKADPLLAKRKDLRDKLICSIDPPGCVDI 545

Query: 530 DDGISIEATGENAYTLHIHIADPVSLFSNSQEGSFSKEIWNIALQRGFTSYLPDCVTPML 589
           DD +  +      + + +HIAD V+ F        ++        RG + YL D    ML
Sbjct: 546 DDALHAKKLPNGHWEVGVHIAD-VTHFVKPGTALDAE-----GASRGTSVYLVDKRIDML 599

Query: 590 PKSYSKAGDLGKDGIASKT----LSFSVDIRCRKNNVEILEETFSVKLGLVSQFPRVTYK 645
           P        LG D  + K      +FSV I     N +I+   F     ++       Y+
Sbjct: 600 PML------LGTDLCSLKPYVDRFAFSV-IWELDENADIINVEF--HKSVIRSREAFAYE 650

Query: 646 VVDRILGLEQDASQQTQELRTLHKIALLLRSKRVKEQNAIIFGEGFNRGLVKLMPTQTNT 705
                  L  D  +Q  EL TL   ALL  S ++K++             VK+    + T
Sbjct: 651 QAQ----LRIDDPKQQDEL-TLGMRALLQLSIKLKQKRLEAGALNLASPEVKVH-MDSET 704

Query: 706 ATALSFEDQEETASTVLVSEIMILAN-TMAGKFFRDRGIPGVFRCY------------KG 752
           +     E ++  A+  LV E M+LAN ++A K +       + R +            + 
Sbjct: 705 SDPGEVEIKKLLATNSLVEEFMLLANISVARKIYDSFPQTAMLRRHAPPPATNFEILNEM 764

Query: 753 LQLKDNARQGYNSLR------DMMHSQKFPSAKDIAKLSS--------LLNSSFYSARAE 798
           LQ + N      S +      D     K P    + ++ S           S  YS    
Sbjct: 765 LQRRKNMSISVESSKALADSLDRCEDPKDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDF 824

Query: 799 KHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKF---SEDQVSDLAWHIQSRDV 855
           +H  +    Y   TSP+RR+ D+V H QL   +   PL      + ++  +  +I  +  
Sbjct: 825 RHYGLAVDIYTHFTSPIRRYCDIVAHRQLAGAIDYEPLSLDHRDKHKMDMICRNINRKHR 884

Query: 856 VLRKAARDSASFWTLVHLKSQQELNPSRRLSV----MVTSVPRLGV 897
             + A R S  ++    +K+ + L     + V    +V  VP+ GV
Sbjct: 885 NAQFAGRASIEYYVGQVMKNNESLESGYVIKVFNNGIVVLVPKFGV 930

>SAKL0D10186g Chr4 (852303..855269) [2967 bp, 988 aa] {ON} highly
           similar to uniprot|Q08162 Saccharomyces cerevisiae
           YOL021C DIS3 Nucleolar exosome component involved in
           rRNA processing and RNA degradation binds Gsp1p/Ran and
           enhances the GEF activity of Srm1p implicated in mitotic
           control homologous to the E. coli RNase R of the RNase
           II family
          Length = 988

 Score = 38.9 bits (89), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 92/445 (20%), Positives = 169/445 (37%), Gaps = 91/445 (20%)

Query: 507 ISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNS-----QE 561
           + +R D     +  ID     +IDD +  +      + + +HIAD V+ F  +      E
Sbjct: 515 LPKRRDLRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGVHIAD-VTHFVKAGTPLDAE 573

Query: 562 GSFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKT----LSFSV---- 613
           G+           RG + YL D    MLP        LG D  + K      +FSV    
Sbjct: 574 GA----------SRGTSVYLVDKRIDMLPML------LGTDLCSLKPYVDRFAFSVIWEL 617

Query: 614 DIRCRKNNVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALL 673
           D +    NV+  +     +          +Y+     +       + TQ +R L  +++ 
Sbjct: 618 DQKASIVNVDFTKSVIRSREAF-------SYEQAQLRIDDPNQKDELTQGMRALLNLSVK 670

Query: 674 LRSKRVKEQNAIIFGEGFNRGLVKLMPTQ------TNTATALSFEDQEETASTVLVSEIM 727
           L+ KR+            + G + L   +      + T+     E ++  A+  LV E M
Sbjct: 671 LKQKRL------------DAGALNLASPEVKVHMDSETSDPGDVEIKKLLATNSLVEEFM 718

Query: 728 ILAN-TMAGKFFRDRGIPGVFRCYKG------------LQLK-------DNARQGYNSLR 767
           +LAN ++A K +       + R +              LQL+       ++++   +SL 
Sbjct: 719 LLANISVAKKIYEAFPQTAMLRRHAAPPSTNFETLNEMLQLRKSMSISLESSKALADSLD 778

Query: 768 DMMHSQKFPSAKDIAKLSS--------LLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFA 819
             +  Q  P    + ++ S           S  YS    +H  +    Y   TSP+RR+ 
Sbjct: 779 RCIDPQD-PYFNTLVRIMSTRCMMAAQYFYSGAYSYADFRHYGLAVDIYTHFTSPIRRYC 837

Query: 820 DLVNHWQLHCYLAGFPLKFS---EDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQ 876
           D+V H QL   +   PL  +   ++++  +  +I  R    + A R S  ++    +++ 
Sbjct: 838 DVVAHRQLAGAIGYEPLDLTHRDKNKMEMICKNINKRHRNAQFAGRASIEYYVGQVMRNN 897

Query: 877 QELNPSRRLSV----MVTSVPRLGV 897
           + +     + V    +V  VP+ GV
Sbjct: 898 ESVETGYVIRVFNNGIVVLVPKFGV 922

>Kwal_23.5705 s23 complement(1284606..1288292) [3687 bp, 1228 aa] {ON}
            YDR293C (SSD1) - Product of gene unknown [contig 11] FULL
          Length = 1228

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 33/69 (47%), Gaps = 10/69 (14%)

Query: 799  KHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQV----------SDLAW 848
            +H  +  P Y   T+PLRR+AD V H QL   L+G   K ++D +           D A 
Sbjct: 960  EHFALNLPLYTHFTAPLRRYADHVVHRQLRAVLSGGKYKENDDSLKITSEYCNFKKDCAH 1019

Query: 849  HIQSRDVVL 857
            H Q + + L
Sbjct: 1020 HAQEQAIHL 1028

>NCAS0F02570 Chr6 (516508..520245) [3738 bp, 1245 aa] {ON} Anc_5.307
            YDR293C
          Length = 1245

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 800  HEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSED 841
            H  +  P Y   T PLRR+AD V H QL   + G P  +SED
Sbjct: 980  HYALNLPIYTHFTCPLRRYADHVVHKQLKSIIRGVP--YSED 1019

>Kpol_1023.50 s1023 (111088..114849) [3762 bp, 1253 aa] {ON}
            (111088..114849) [3762 nt, 1254 aa]
          Length = 1253

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 65/298 (21%), Positives = 114/298 (38%), Gaps = 65/298 (21%)

Query: 572  ALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKTLS--FSVDIRCRKNNVEILEETF 629
            A +R    ++P     +LPK+ +++  L ++   S TLS  +S+D++  +     + ET 
Sbjct: 751  ARKRSSAVFMPQTTVNLLPKTLNESLKLDQNK-TSATLSVVYSLDVKSLEVKSCWIGETV 809

Query: 630  SVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLLRSKRVKEQNAIIFGE 689
                 ++S         +D I   +  +   +  L T+ KIA      R++   A +  E
Sbjct: 810  ISPSSVIS---------IDDIT--DDKSPNHSGSLSTMKKIARSFYQNRIQNDKAELIPE 858

Query: 690  GFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEI-MILANTMAGKFFRDRGIPGVFR 748
                  + L  +  +    +     ++    V+V EI   + NT+A + + + G     R
Sbjct: 859  ------LPLFDSLDDERVKVELNILDKKLGYVVVEEIERFVNNTIAKELYNNLGERAFLR 912

Query: 749  CYKGLQLKDNARQGYNSLRDMMH----SQKFPSAKDIAKLSSLLNS-------------- 790
                       RQ   +L  M +     QK     +I+  SSL+NS              
Sbjct: 913  -----------RQASPTLNKMENFKRKVQKLGYEVNISSPSSLINSILKIDNDDIRIGVE 961

Query: 791  -----------SFYSARAE----KHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAG 833
                        F + + +     H     P Y   T+PLRR+AD V H QL   L+G
Sbjct: 962  ILLFKSMPRAKYFVAGKVDVEQYDHFAFNFPLYTHFTAPLRRYADHVVHRQLKSILSG 1019

>Smik_15.145 Chr15 complement(248837..251842) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 90/438 (20%), Positives = 171/438 (39%), Gaps = 77/438 (17%)

Query: 507 ISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEGSFSK 566
           +++R D     +  ID     +IDD +  +      + + +HIAD V+ F        ++
Sbjct: 528 LTKRKDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIAD-VTHFVKPGTALDAE 586

Query: 567 EIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKT----LSFSVDIRCRKN-- 620
                   RG + YL D    MLP        LG D  + K      +FSV     +N  
Sbjct: 587 -----GAARGTSVYLVDKRIDMLPML------LGTDLCSLKPYVDRFAFSVIWELDENAN 635

Query: 621 --NVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLLRSKR 678
             NV+ ++     +     +  ++      RI  + Q+  + T  +R L ++++ L+ KR
Sbjct: 636 IVNVDFMKSVIRSREAFSYEQAQL------RIDDINQN-DELTLGMRALLQLSVKLKQKR 688

Query: 679 VKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILAN-TMAGKF 737
           + E  A+          VK+    + T+     E ++  A+  LV E M+LAN ++A K 
Sbjct: 689 L-EAGAL----NLASPEVKVH-MDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKI 742

Query: 738 FRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQK-----FPSAKDIAK--------- 783
           +       + R +            + +L +M++++K       S+K +A          
Sbjct: 743 YDAFPQTAMLRRHAA-----PPSTNFETLNEMLNTRKNMSISLESSKALADSLDRCVDPE 797

Query: 784 -----------------LSSLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQ 826
                             +    S  YS    +H  +    Y   TSP+RR+ D+V H Q
Sbjct: 798 DPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQ 857

Query: 827 LHCYLAGFPLKFS---EDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSR 883
           L   +   PL  +   ++++  +  +I  +    + A R S  ++    +++ +      
Sbjct: 858 LAGAIGYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTETGY 917

Query: 884 RLSV----MVTSVPRLGV 897
            + V    +V  VP+ GV
Sbjct: 918 VIKVFNNGIVVLVPKFGV 935

>Suva_15.147 Chr15 complement(255214..258219) [3006 bp, 1001 aa]
           {ON} YOL021C (REAL)
          Length = 1001

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 87/433 (20%), Positives = 165/433 (38%), Gaps = 67/433 (15%)

Query: 507 ISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEGSFSK 566
           +++R D     +  ID     +IDD +  +      + + +HIAD V+ F        ++
Sbjct: 528 LTKRKDLRDKLICSIDPPGCVDIDDALHAKRLPNGNWEVGVHIAD-VTHFVKPNTALDAE 586

Query: 567 EIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKT----LSFSV----DIRCR 618
                   RG + YL D    MLP        LG D  + K      +FSV    D    
Sbjct: 587 -----GAARGTSVYLVDKRIDMLPML------LGTDLCSLKPYVDRFAFSVIWELDDDAN 635

Query: 619 KNNVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLLRSKR 678
             NV+ ++     +      + +  +++ D+         + T  +R L ++++ L+ KR
Sbjct: 636 IVNVDFMKSVIKSREAF--SYEQAQFRIDDK-----NQNDELTSGMRALLELSIKLKQKR 688

Query: 679 VKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILAN-TMAGKF 737
           + E  A+          VK+    + T+     E ++  A+  LV E M+LAN ++A K 
Sbjct: 689 L-EAGAL----NLASPEVKVH-MDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKI 742

Query: 738 F---------RDRGIPG---------VFRCYKGLQLKDNARQGYNSLRDMMHSQKFPSAK 779
           +         R    P          +    K + +   + +      D     + P   
Sbjct: 743 YDAFPQTAMLRRHAAPPSTNFEIMNEMLNTRKNMSISLESSKALADSLDRCVDPEDPYFN 802

Query: 780 DIAKLSS--------LLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYL 831
            + ++ S           S  YS    +H  +    Y   TSP+RR+ D+V H QL   +
Sbjct: 803 TLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQLAGAI 862

Query: 832 AGFPLKFS---EDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSRRLSV- 887
              PL  +   ++++  +  +I  +    + A R S  ++    +++ +       + V 
Sbjct: 863 GYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTETGYVIKVF 922

Query: 888 ---MVTSVPRLGV 897
              +V  VP+ GV
Sbjct: 923 NNGIVVLVPKFGV 935

>KAFR0E01390 Chr5 (277260..280913) [3654 bp, 1217 aa] {ON} Anc_5.307
           YDR293C
          Length = 1217

 Score = 36.2 bits (82), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 800 HEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSED 841
           H  +  P Y   T PLRR+AD V H QL   + G P  ++ED
Sbjct: 948 HYALNLPIYAHFTCPLRRYADHVVHRQLKSIINGIP--YNED 987

>YOL021C Chr15 complement(282421..285426) [3006 bp, 1001 aa] {ON}
           DIS3Exosome core complex catalytic subunit; possesses
           both endonuclease and 3'-5' exonuclease activity;
           involved in 3'-5' RNA processing and degradation in both
           the nucleus and the cytoplasm; has similarity to E. coli
           RNase R and to human DIS3
          Length = 1001

 Score = 36.2 bits (82), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 89/438 (20%), Positives = 166/438 (37%), Gaps = 77/438 (17%)

Query: 507 ISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNSQEGSFSK 566
           +++R D     +  ID     +IDD +  +      + + +HIAD V+ F        ++
Sbjct: 528 LTKRKDLRDKLICSIDPPGCVDIDDALHAKKLPNGNWEVGVHIAD-VTHFVKPGTALDAE 586

Query: 567 EIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASKT----LSFSV----DIRCR 618
                   RG + YL D    MLP        LG D  + K      +FSV    D    
Sbjct: 587 -----GAARGTSVYLVDKRIDMLPML------LGTDLCSLKPYVDRFAFSVIWELDDSAN 635

Query: 619 KNNVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALLLRSKR 678
             NV  ++     +      + +   ++ D+         + T  +R L K+++ L+ KR
Sbjct: 636 IVNVNFMKSVIRSREAF--SYEQAQLRIDDKTQN-----DELTMGMRALLKLSVKLKQKR 688

Query: 679 VKEQNAIIFGEGFNRGLVKLMPTQTNTATALSFEDQEETASTVLVSEIMILAN-TMAGKF 737
           + E  A+          VK+    + T+     E ++  A+  LV E M+LAN ++A K 
Sbjct: 689 L-EAGAL----NLASPEVKVH-MDSETSDPNEVEIKKLLATNSLVEEFMLLANISVARKI 742

Query: 738 FRDRGIPGVFRCYKGLQLKDNARQGYNSLRDMMHSQK-----FPSAKDIAK--------- 783
           +       + R +            +  L +M++++K       S+K +A          
Sbjct: 743 YDAFPQTAMLRRHAA-----PPSTNFEILNEMLNTRKNMSISLESSKALADSLDRCVDPE 797

Query: 784 -----------------LSSLLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFADLVNHWQ 826
                             +    S  YS    +H  +    Y   TSP+RR+ D+V H Q
Sbjct: 798 DPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCDVVAHRQ 857

Query: 827 LHCYLAGFPLKFS---EDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQELNPSR 883
           L   +   PL  +   ++++  +  +I  +    + A R S  ++    +++ +      
Sbjct: 858 LAGAIGYEPLSLTHRDKNKMDMICRNINRKHRNAQFAGRASIEYYVGQVMRNNESTETGY 917

Query: 884 RLSV----MVTSVPRLGV 897
            + V    +V  VP+ GV
Sbjct: 918 VIKVFNNGIVVLVPKFGV 935

>TPHA0E01380 Chr5 (278339..281998) [3660 bp, 1219 aa] {ON} Anc_5.307
           YDR293C
          Length = 1219

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 2/43 (4%)

Query: 799 KHEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSED 841
           K+ +   P Y   TSPLRR+AD + H QL   L G   +F ED
Sbjct: 951 KNFITNIPLYTHFTSPLRRYADHIVHRQLKSLLRGN--EFEED 991

>Kwal_34.16245 s34 complement(260089..263049) [2961 bp, 986 aa] {ON}
           YOL021C (DIS3) - 3'-5' exoribonuclease complex subunit
           [contig 265] FULL
          Length = 986

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 89/444 (20%), Positives = 165/444 (37%), Gaps = 81/444 (18%)

Query: 503 QNDDISRRHDFGKMNVYCIDSETAHEIDDGISIEATGENAYTLHIHIADPVSLFSNS--- 559
           Q+  + +R D     +  ID     +IDD +  +      + + +HIAD       +   
Sbjct: 509 QDPLLPKRRDLRDKLICSIDPPGCVDIDDALHAKQLPNGNWEVGVHIADVTHFVKPNTPL 568

Query: 560 -QEGSFSKEIWNIALQRGFTSYLPDCVTPMLPKSYSKAGDLGKDGIASK----TLSFSVD 614
             EG+           RG + YL D    MLP        LG +  + K      +FSV 
Sbjct: 569 DAEGA----------SRGTSVYLVDKRIDMLPML------LGTNLCSLKPYVDRFAFSVL 612

Query: 615 IRCRKN-NVEILEETFSVKLGLVSQFPRVTYKVVDRILGLEQDASQQTQELRTLHKIALL 673
               ++ N+  ++ T SV    +      +Y+     +       + TQ +R L  +++ 
Sbjct: 613 WELDQDANIVNVDFTKSV----IKSREAFSYEQAQLRIDDSTQTDELTQGMRALLSLSIK 668

Query: 674 LRSKRVKEQNAIIFGEGFNRGLVKLMPTQ------TNTATALSFEDQEETASTVLVSEIM 727
           L+ KR+            N G + L   +      + T+     E ++  A+  LV E M
Sbjct: 669 LKEKRL------------NAGALNLASPEVKVHMDSETSDPGEVEIKKLLATNSLVEEFM 716

Query: 728 ILAN-TMAGKFF----------RDRGIPG--------VFRCYKGLQLKDNARQGYNSLRD 768
           +LAN ++A K +          R    P         + +  KG+ +   + +      D
Sbjct: 717 LLANISVARKIYEAFPQTAMLRRHAAPPATNFEALNEMLQLRKGMSISLESSKALADSLD 776

Query: 769 MMHSQKFPSAKDIAKLSS--------LLNSSFYSARAEKHEMIGAPAYLPVTSPLRRFAD 820
                K P    + ++ S           S  YS    +H  +    Y   TSP+RR+ D
Sbjct: 777 RCVDPKDPYFNTLVRIMSTRCMMAAQYFYSGAYSYPDFRHYGLAVDIYTHFTSPIRRYCD 836

Query: 821 LVNHWQLHCYLAGFPLKFS---EDQVSDLAWHIQSRDVVLRKAARDSASFWTLVHLKSQQ 877
           +V H QL   +    L  +   ++++  +  +I  +    + A R S  ++    +++ +
Sbjct: 837 VVAHRQLAAAIGYEALDLNHRDKNKMEFMCRNINKKHRNAQFAGRASIEYYVGQVMRNNE 896

Query: 878 ELNPSRRLSV----MVTSVPRLGV 897
                  + V    +V  VP+ GV
Sbjct: 897 SEETGYVIRVFHNGIVVLVPKFGV 920

>TPHA0D01820 Chr4 complement(376666..380529) [3864 bp, 1287 aa] {ON}
            Anc_5.307 YDR293C
          Length = 1287

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 800  HEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSED 841
            H +   P Y   TSP++R+AD V H QL   +   P  +SED
Sbjct: 1022 HFVSNLPLYTHFTSPMKRYADHVVHRQLRSVIKNVP--YSED 1061

>CAGL0H01287g Chr8 complement(123328..127302) [3975 bp, 1324 aa] {ON}
            similar to uniprot|P24276 Saccharomyces cerevisiae
            YDR293c SSD1
          Length = 1324

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 800  HEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSED 841
            H ++  P Y   T+P+RR+AD V H QL   +   P  +S+D
Sbjct: 1055 HYILNLPLYTHFTAPMRRYADHVVHRQLKAAIYDVP--YSDD 1094

>KLTH0G06248g Chr7 (494464..498141) [3678 bp, 1225 aa] {ON} similar to
            uniprot|P24276 Saccharomyces cerevisiae YDR293C SSD1
            Protein with a role in maintenance of cellular integrity
            interacts with components of the TOR pathway ssd1 mutant
            of a clinical S. cerevisiae strain displays elevated
            virulence
          Length = 1225

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 30/68 (44%), Gaps = 10/68 (14%)

Query: 800  HEMIGAPAYLPVTSPLRRFADLVNHWQLHCYLAGFPLKFSEDQV----------SDLAWH 849
            H  +  P Y   T+PLRR+AD V H QL   L     K ++D +           D A H
Sbjct: 958  HFALNLPLYTHFTAPLRRYADHVVHRQLKSVLNDSSYKENDDSLKITSEYCNFKKDCAHH 1017

Query: 850  IQSRDVVL 857
             Q + + L
Sbjct: 1018 AQEQAIHL 1025

>Skud_5.163 Chr5 (251090..252571) [1482 bp, 493 aa] {ON} YER051W
           (REAL)
          Length = 493

 Score = 32.7 bits (73), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 403 TGERNSAKLQYPQISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLCH 459
           + + +S  L YP  S+ ++ Y    +HN G ++T+++   RK  + +NN+ + D  H
Sbjct: 44  SNDTSSEILSYPNSSKQIKSYRCS-YHNEGELLTMIALNIRKGKRQRNNEKSEDSGH 99

>YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbon
           source-responsive zinc-finger transcription factor,
           required for transcription of the glucose-repressed gene
           ADH2, of peroxisomal protein genes, and of genes
           required for ethanol, glycerol, and fatty acid
           utilization
          Length = 1323

 Score = 32.3 bits (72), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 16/80 (20%)

Query: 416 ISRLLRDYAAGNFHNNGPIITIVSKLFRKLDKYQNNDITRDLC------HEFLQELTCES 469
           +S++ R   A   +NN P  +I SKLF        N+  R++C      +E     + ES
Sbjct: 565 LSKISRALPASTVNNNQPSHSIESKLF--------NEPMRNMCIKVLRYYEKFSHDSSES 616

Query: 470 I--PNPQLLSNEIRSPSTSE 487
           +   NP LLS E+  P+ SE
Sbjct: 617 VMDSNPNLLSKELLMPAVSE 636

>KLTH0D14036g Chr4 (1144430..1146511) [2082 bp, 693 aa] {ON} weakly
           similar to uniprot|Q7LHY6 Saccharomyces cerevisiae
           YLR381W CTF3 Outer kinetochore protein that forms a
           complex with Mcm16p and Mcm22p may bind the kinetochore
           to spindle microtubules
          Length = 693

 Score = 32.0 bits (71), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 34/64 (53%)

Query: 101 LNMDLTSLSSKQRADMNDSLKPEVFDSESGTFRMHPSHLLDSSLKIGDLVLLRSDPSQLC 160
           +N DL+S SS +  +M   L  +VF      ++  P   + S  K+ +++++ +DP  LC
Sbjct: 462 INEDLSSCSSNRHVNMTLRLLIKVFSFILLRYKHMPDWDITSFYKLLEVLIITNDPLALC 521

Query: 161 MCVE 164
             VE
Sbjct: 522 SIVE 525

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 95,603,392
Number of extensions: 4130550
Number of successful extensions: 10714
Number of sequences better than 10.0: 58
Number of HSP's gapped: 10826
Number of HSP's successfully gapped: 61
Length of query: 948
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 829
Effective length of database: 39,836,145
Effective search space: 33024164205
Effective search space used: 33024164205
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)