Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03652g8.852ON27627613940.0
Kwal_27.102108.852ON2782774983e-61
SAKL0D01122g8.852ON3111802268e-21
AFR449W8.852ON2991511782e-14
TDEL0B002108.852ON3331431652e-12
ZYRO0C14916g8.852ON3281451441e-09
CAGL0B02409g8.852ON3612701422e-09
KNAG0G034908.852ON317551314e-08
Suva_13.248.852ON360911281e-07
YML119W8.852ON357891271e-07
NDAI0E002408.852ON519681281e-07
Kpol_237.38.852ON3511551243e-07
Smik_13.158.852ON357491244e-07
KAFR0A028808.852ON4301441228e-07
KLLA0C06292g8.852ON256891209e-07
Skud_13.228.852ON356561201e-06
NCAS0B002508.852ON316571155e-06
TBLA0D033108.852ON502381112e-05
TPHA0I003408.852ON395271013e-04
CAGL0B01232g1.64ON22989674.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03652g
         (276 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03652g Chr3 complement(315850..316680) [831 bp, 276 aa] {O...   541   0.0  
Kwal_27.10210 s27 complement(241952..242788) [837 bp, 278 aa] {O...   196   3e-61
SAKL0D01122g Chr4 (84647..85582) [936 bp, 311 aa] {ON} conserved...    92   8e-21
AFR449W Chr6 (1247197..1248096) [900 bp, 299 aa] {ON} Syntenic h...    73   2e-14
TDEL0B00210 Chr2 complement(39137..40138) [1002 bp, 333 aa] {ON}...    68   2e-12
ZYRO0C14916g Chr3 complement(1158130..1159116) [987 bp, 328 aa] ...    60   1e-09
CAGL0B02409g Chr2 complement(230087..231172) [1086 bp, 361 aa] {...    59   2e-09
KNAG0G03490 Chr7 complement(745476..746429) [954 bp, 317 aa] {ON...    55   4e-08
Suva_13.24 Chr13 (30428..31510) [1083 bp, 360 aa] {ON} YML119W (...    54   1e-07
YML119W Chr13 (30611..31684) [1074 bp, 357 aa] {ON} Putative pro...    54   1e-07
NDAI0E00240 Chr5 (27597..29156) [1560 bp, 519 aa] {ON} Anc_8.852...    54   1e-07
Kpol_237.3 s237 complement(3052..4107) [1056 bp, 351 aa] {ON} co...    52   3e-07
Smik_13.15 Chr13 (26900..27973) [1074 bp, 357 aa] {ON} YML119W (...    52   4e-07
KAFR0A02880 Chr1 complement(598691..599983) [1293 bp, 430 aa] {O...    52   8e-07
KLLA0C06292g Chr3 complement(555112..555882) [771 bp, 256 aa] {O...    51   9e-07
Skud_13.22 Chr13 (30389..31459) [1071 bp, 356 aa] {ON} YML119W (...    51   1e-06
NCAS0B00250 Chr2 (26236..27186) [951 bp, 316 aa] {ON} Anc_8.852 ...    49   5e-06
TBLA0D03310 Chr4 complement(825054..826562) [1509 bp, 502 aa] {O...    47   2e-05
TPHA0I00340 Chr9 complement(64246..65433) [1188 bp, 395 aa] {ON}...    44   3e-04
CAGL0B01232g Chr2 (112175..112864) [690 bp, 229 aa] {ON} highly ...    30   4.0  

>KLTH0C03652g Chr3 complement(315850..316680) [831 bp, 276 aa] {ON}
           conserved hypothetical protein
          Length = 276

 Score =  541 bits (1394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/276 (95%), Positives = 263/276 (95%)

Query: 1   MQNPQYSGVMGQSTLRNNMVRTVPSPNQITMIPVPHLQAHKGEKRTLRNTSPLRKSQDFE 60
           MQNPQYSGVMGQSTLRNNMVRTVPSPNQITMIPVPHLQAHKGEKRTLRNTSPLRKSQDFE
Sbjct: 1   MQNPQYSGVMGQSTLRNNMVRTVPSPNQITMIPVPHLQAHKGEKRTLRNTSPLRKSQDFE 60

Query: 61  GSKPTNTGKSGAGANGHSNSRQRWVDVKIIDDIKCPTSNSEKPRYLTVPGKFDVKXXXXX 120
           GSKPTNTGKSGAGANGHSNSRQRWVDVKIIDDIKCPTSNSEKPRYLTVPGKFDVK     
Sbjct: 61  GSKPTNTGKSGAGANGHSNSRQRWVDVKIIDDIKCPTSNSEKPRYLTVPGKFDVKRGRSG 120

Query: 121 XXXXXXXXVAYYRLAEVPFQGKNTKNELLRSIIDAAQPGFFRKQPIGVSDDPKYLVSTLK 180
                   VAYYRLAEVPFQGKNTKNELLRSIIDAAQPGFFRKQPIGVSDDPKYLVSTLK
Sbjct: 121 LIIGSSSRVAYYRLAEVPFQGKNTKNELLRSIIDAAQPGFFRKQPIGVSDDPKYLVSTLK 180

Query: 181 ELPNAVHEYADRVSGFTLKNSKANPLARLALQESAEVNESVDLSFDGKAMNKSDIFKMVD 240
           ELPNAVHEYADRVSGFTLKNSKANPLARLALQESAEVNESVDLSFDGKAMNKSDIFKMVD
Sbjct: 181 ELPNAVHEYADRVSGFTLKNSKANPLARLALQESAEVNESVDLSFDGKAMNKSDIFKMVD 240

Query: 241 SFSLFPDDDTDEDEAPHFHMGSILPPEITNSTVPDL 276
           SFSLFPDDDTDEDEAPHFHMGSILPPEITNSTVPDL
Sbjct: 241 SFSLFPDDDTDEDEAPHFHMGSILPPEITNSTVPDL 276

>Kwal_27.10210 s27 complement(241952..242788) [837 bp, 278 aa] {ON}
           YML119W - Hypothetical ORF [contig 39] FULL
          Length = 278

 Score =  196 bits (498), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 115/277 (41%), Positives = 163/277 (58%), Gaps = 15/277 (5%)

Query: 5   QYSGVMGQSTLRNNMVRTVPSPNQITMIP---VPHLQAHKGEKRTLRNTSPLRKSQDFEG 61
           QY+   G+S L          P  + M P    P  +  + E+RTLRNTSPLR+SQ  +G
Sbjct: 12  QYTSGNGKSFL----------PASLKMAPTLSAPQGENSRSERRTLRNTSPLRRSQVVDG 61

Query: 62  SKPTNTGKSGAGANGHSNSRQRWVDVKIIDDIKCPTSNSEKPRYLTVPGKFDVKXXXXXX 121
            K + + KS   ++G  NSR RW++ K I D++ P + +   RYL  P K D K      
Sbjct: 62  GKTSPSTKSVTISSGQLNSRPRWIEAKTISDVEKPVAKAGNQRYLASPCKIDYKRGKSSS 121

Query: 122 XXXXX-XXVAYYRLAEVPFQGKNTKNELLRSIIDAAQPGFFRKQPIGVSDDPKYLVSTLK 180
                   V +Y+L E+PF+ K+ + +L++ II A Q  +F+KQPIG ++D KY V  L 
Sbjct: 122 VAEFVPQKVVHYKLEELPFKSKSGRTQLIKDIILAQQEVYFKKQPIGPAEDAKYQVQALG 181

Query: 181 ELPNAVHEYADRVSGFTLKNSKANPLARLALQESAEVNESVDLSFDGKAMNKSDIFKMVD 240
           EL  AV ++ +R +   ++ SKANPL RL +Q+  + N++ DLSFDGKAMN+SDIFK+VD
Sbjct: 182 ELSGAVKKFTERSTRRIIRASKANPLTRLTMQDPGDANDTADLSFDGKAMNRSDIFKIVD 241

Query: 241 SFSLFPDDDTDEDEAP-HFHMGSILPPEITNSTVPDL 276
           SFSL PDD+ ++ E   H +  SIL PEI      DL
Sbjct: 242 SFSLLPDDEEEDSEDILHLNNRSILLPEIAGIASMDL 278

>SAKL0D01122g Chr4 (84647..85582) [936 bp, 311 aa] {ON} conserved
           hypothetical protein
          Length = 311

 Score = 91.7 bits (226), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 64/180 (35%), Positives = 99/180 (55%), Gaps = 12/180 (6%)

Query: 103 PRYLTVPGKFD---VKXXXXXXXXXXXXXVAYYRLAEVPFQGKNTKNELLRSIIDAAQPG 159
           PRY+  P K D    +             +AYY+L E      + +  ++  IIDA +  
Sbjct: 129 PRYMAAPVKIDYEACRTNVVVNETQKRKSIAYYKLCEPMLSEASRRKPMIAKIIDAKRNS 188

Query: 160 FFRKQPIGVSDDPKYLVSTLKELPNAVHEYADRV---SGFTLKNSKA---NPLARLALQE 213
           +  +QPI +  + +Y V +L++ P+ V +Y + +   +  TL +S     N + +L  QE
Sbjct: 189 YNERQPIKLGANTEYQVVSLEQFPDTVSKYINDLKKPNRRTLASSTRVANNKIDQLIAQE 248

Query: 214 SAEV--NESVDLSFDGKAMNKSDIFKMVDSFSL-FPDDDTDEDEAPHFHMGSILPPEITN 270
           S     N+S+DLSFDGKA++KSDI ++VDSFS+ F DDD DE E   F   +ILP E+T+
Sbjct: 249 SYSTCQNDSIDLSFDGKALDKSDILRIVDSFSVGFDDDDDDEGEPNIFSTTNILPREMTS 308

>AFR449W Chr6 (1247197..1248096) [900 bp, 299 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML119W
          Length = 299

 Score = 73.2 bits (178), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 78/151 (51%), Gaps = 14/151 (9%)

Query: 131 YYRLAE----VPFQGKNTKNELLRSIIDAAQPGFFRKQPIGVSDDPKYLVSTLKELPNAV 186
           YY++AE    V      +  + L  +I   +  + R QPI +     Y V++L +L   +
Sbjct: 147 YYKIAEPLLNVAHDSSKSNTQRLAKLIAQRRSAYHRMQPIRLGSMDGYDVTSLDQLGEII 206

Query: 187 HEYADRVSGFTLKN-SKANPLARLALQESAE-------VNESVDLSFDGKAMNKSDIFKM 238
             Y  +V    +K  S A+       Q+  +        N+S+DLSFDGKA+NKSD  +M
Sbjct: 207 ERY--QVEKPVVKRRSLASSNYSTVFQDRVDYLIVPTNANDSIDLSFDGKAINKSDFLRM 264

Query: 239 VDSFSLFPDDDTDEDEAPHFHMGSILPPEIT 269
           +DSFSL  D++ D ++   FH  +ILP +IT
Sbjct: 265 MDSFSLALDEEDDNNKHYDFHSRNILPRDIT 295

>TDEL0B00210 Chr2 complement(39137..40138) [1002 bp, 333 aa] {ON}
           Anc_8.852 YML119W
          Length = 333

 Score = 68.2 bits (165), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 76/143 (53%), Gaps = 19/143 (13%)

Query: 132 YRLAEVPFQGKNTKNELLRSIIDAAQPGFFRKQPIGVSDDPKYLVSTLKELPNAVHEYAD 191
           YRL  VP    +  ++++R  I+  +  + + QP+  +  P               ++ +
Sbjct: 205 YRLT-VPLMTCDESHQVVRDEIENNRHRYRQTQPLHRNQAP-------------ADDFGE 250

Query: 192 RVSGFTLKNSKANPLARLALQESAEVNESVDLSFDGKAMNKSDIFKMVDSFSLFPDDD-- 249
            V    L+N+K     R  L   + +N+S DLSFDGKA+++SDIF+MVDSFS+   DD  
Sbjct: 251 TVPN--LRNTKKTATLRRPLLAGSSLNDSFDLSFDGKALDRSDIFRMVDSFSVAQSDDEP 308

Query: 250 -TDEDEAPHFHMGSILPPEITNS 271
             D + + + H  ++LP E+T+S
Sbjct: 309 EEDNNNSSNLHSKNVLPAEMTSS 331

>ZYRO0C14916g Chr3 complement(1158130..1159116) [987 bp, 328 aa]
           {ON} some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119W
          Length = 328

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 73/145 (50%), Gaps = 11/145 (7%)

Query: 132 YRLAEVPFQGKNTKNELLRSIIDAAQPGFFRKQPIGVSDDPKYLVSTLKELPNAVHEYAD 191
           Y+L+      ++T   L   I    +  +   QP+ +  D       L++L +   E   
Sbjct: 190 YKLSIPLLVCQDTHRALKNQIERVYRSKYHSYQPLSLFGDMSIRYYRLEDLQSRFIE--- 246

Query: 192 RVSGFTLKNSKANPLARLA--LQESAEVNESVDLSFDGKAMNKSDIFKMVDSFSLFPDDD 249
               F  K  K  P  ++A  L  +  +N+S +LSFDGKA+++SDIF+MVDSFS+   DD
Sbjct: 247 ----FLQKPRKPQPPLQVARSLNGTGALNDSFELSFDGKALDRSDIFRMVDSFSVALSDD 302

Query: 250 TDEDEAPHFHMG--SILPPEITNST 272
             EDE+   +    +ILP E+T + 
Sbjct: 303 DAEDESSFVNSSGRNILPAEMTGTV 327

>CAGL0B02409g Chr2 complement(230087..231172) [1086 bp, 361 aa] {ON}
           some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119w
          Length = 361

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 74/270 (27%), Positives = 116/270 (42%), Gaps = 46/270 (17%)

Query: 26  PNQITMIPVPHLQAHKGEKRTLRNT------SPLRKSQDFEGSKPTNTGKSGAGANGHSN 79
           PN +   P    +      R  RN+      SP++ +    GSK  N   SG G      
Sbjct: 113 PNHVHASPTTGRKKKVSLNRNPRNSNLVMPSSPIKNNNIDTGSKTANL--SGPG------ 164

Query: 80  SRQRWVDVKIIDDIKCPTSNSEKP----RYL--------TVPGKFDVKXXXXXXXXXXXX 127
             +++ +++ IDD+     N E P    RY             K +V             
Sbjct: 165 --KKYKELRDIDDLPRSPCNYETPNLKNRYFGPVQKVEDNTDRKANVNISYKNSKSKQKK 222

Query: 128 XVAYYRLAEVPFQGKNTKNELLRS-IIDAAQPGFFRKQPIGVSDDPKYLVSTLKELPNAV 186
               Y+LA  P   K+  N L  S ++    P +++ QPI      K+L S   E    +
Sbjct: 223 PPVVYKLA-TPLASKDV-NALDNSFLLQPDTPRYYKIQPI------KFLHSEPIENFAGL 274

Query: 187 HEYADRVSGFTLKNSKANPLARLALQES--AEVNESVDLSFDGKAMNKSDIFKMVDSFSL 244
            +    +S   L N+     + ++  +   A  N+S DLSFDGKA+++SDIF+MVDSFS+
Sbjct: 275 QD----ISTHLLDNNTPKKKSHISRVQPPPAATNDSFDLSFDGKALDRSDIFRMVDSFSI 330

Query: 245 FPDDDTDEDEAPHF---HMGSILPPEITNS 271
              DD D +E+      +   ILP ++TN+
Sbjct: 331 AFSDDEDNEESSFISRRNNNDILPADMTNN 360

>KNAG0G03490 Chr7 complement(745476..746429) [954 bp, 317 aa] {ON}
           Anc_8.852 YML119W
          Length = 317

 Score = 55.1 bits (131), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/55 (63%), Positives = 43/55 (78%), Gaps = 2/55 (3%)

Query: 218 NESVDLSFDGKAMNKSDIFKMVDSFSLFPDDDTDEDEAPHFHM--GSILPPEITN 270
           N+S DLSFDGKAM++SDIF+MVDSFS+ PD+D DED +P       +ILP EITN
Sbjct: 260 NDSFDLSFDGKAMDRSDIFRMVDSFSIAPDEDDDEDPSPTGRQVPRNILPAEITN 314

>Suva_13.24 Chr13 (30428..31510) [1083 bp, 360 aa] {ON} YML119W
           (REAL)
          Length = 360

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 55/91 (60%), Gaps = 10/91 (10%)

Query: 164 QPIGVSDDPKYLVS-TLKEL--------PNAVHEYADRVSGFTLKNSK-ANPLARLALQE 213
           QPI +S + K  VS +++EL        P +  ++  + +   +KN++  N   R ++  
Sbjct: 234 QPIQLSTNKKTRVSKSIEELCRDLLSPPPPSKSQHQLQSNIKPMKNAQNTNTKQRTSINA 293

Query: 214 SAEVNESVDLSFDGKAMNKSDIFKMVDSFSL 244
               NES +LSFDGKAM++SDIF+MVDSFS+
Sbjct: 294 GTNANESFELSFDGKAMDRSDIFRMVDSFSI 324

>YML119W Chr13 (30611..31684) [1074 bp, 357 aa] {ON} Putative
           protein of unknown function; YML119W is not an essential
           gene; potential Cdc28p substrate
          Length = 357

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 47/89 (52%), Gaps = 8/89 (8%)

Query: 164 QPIGVSDDPKYLVS-TLKELPNAVHEYADRVSGFTLKNSK-------ANPLARLALQESA 215
           QPI +S + K  +S +L EL         R       NSK       +N   R     S 
Sbjct: 233 QPIQLSTNSKTRISKSLDELCGVQLTSTLRQQKQLQGNSKPVKNLPNSNAKQRAGASVST 292

Query: 216 EVNESVDLSFDGKAMNKSDIFKMVDSFSL 244
             NES +LSFDGKAM++SDIF+MVDSFS+
Sbjct: 293 NANESFELSFDGKAMDRSDIFRMVDSFSI 321

>NDAI0E00240 Chr5 (27597..29156) [1560 bp, 519 aa] {ON} Anc_8.852
           YML119W
          Length = 519

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 41/68 (60%), Gaps = 16/68 (23%)

Query: 218 NESVDLSFDGKAMNKSDIFKMVDSFSLFPDDDTDE---------DEAPHFHMG------- 261
           N+S DLSFDGKAM++SDIF+MVDSF++   DD  E         ++A  F +        
Sbjct: 431 NDSFDLSFDGKAMDRSDIFRMVDSFTMALSDDERELSGIILDTNNKAKKFDLQLKDNINI 490

Query: 262 SILPPEIT 269
           +ILP EIT
Sbjct: 491 NILPAEIT 498

>Kpol_237.3 s237 complement(3052..4107) [1056 bp, 351 aa] {ON}
           complement(3052..4107) [1056 nt, 352 aa]
          Length = 351

 Score = 52.4 bits (124), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/155 (32%), Positives = 83/155 (53%), Gaps = 18/155 (11%)

Query: 132 YRLAEVPFQGKNTKNELLRSIIDAAQPGFFRK-QPI-GVSDDPKYLVSTLKELPNAVHEY 189
           Y+L + P   + T  +++  +ID     ++ K QP   +SDD   L S    + NA+ + 
Sbjct: 202 YKLNK-PVMQEKTSYKVVVELIDQVYNKYYNKLQPYRSISDDNIDLGS----IENAIEKL 256

Query: 190 ADRVSGFTLKNSK----ANPLARLA----LQESAEVNESVDLSFDGKAMNKSDIFKMVDS 241
            +R+   T  N +     + +A+++    L  S   N+S +LSFDGKA+++SDI +MVDS
Sbjct: 257 CERLENSTATNKRTPNNVHDIAKISNSRTLLTSTIGNDSFELSFDGKALDRSDILRMVDS 316

Query: 242 FSLFPDDDTDEDEAPHFHM---GSILPPEITNSTV 273
           FS+   DD DE++   F        LP EIT+S +
Sbjct: 317 FSVAFSDDDDENDNGEFIASLSNKFLPAEITSSAL 351

>Smik_13.15 Chr13 (26900..27973) [1074 bp, 357 aa] {ON} YML119W
           (REAL)
          Length = 357

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 34/49 (69%), Gaps = 1/49 (2%)

Query: 197 TLKN-SKANPLARLALQESAEVNESVDLSFDGKAMNKSDIFKMVDSFSL 244
           +LKN S  N   R     +   NES +LSFDGKAM++SDIF+MVDSFS+
Sbjct: 272 SLKNPSNTNAKQRTGASVALAANESFELSFDGKAMDRSDIFRMVDSFSI 320

>KAFR0A02880 Chr1 complement(598691..599983) [1293 bp, 430 aa] {ON}
           Anc_8.852 YML119W
          Length = 430

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 68/144 (47%), Gaps = 34/144 (23%)

Query: 164 QPIGVSDDPKYLVSTLKELP-NAVHEYADRV----SGFTL-KNSKANP----LARLALQE 213
           QP+ ++ +  + +  L E     + +Y  ++    +G TL KNS  N       R  L  
Sbjct: 285 QPLFIAGNKNFKIDELNEASVELIDKYLSQLDKSSTGRTLIKNSSLNSSKMQRQRRPLIN 344

Query: 214 SAEVNESVDLSFDGKAMNKSDIFKMVDSFSLFPDD------------------------D 249
            +  N+S DLSFDGKA++++DIF+MVDSFS+   D                        +
Sbjct: 345 VSNYNDSFDLSFDGKALDRNDIFRMVDSFSIAVSDNESSDIIANSSDISYTQTGNNIHYN 404

Query: 250 TDEDEAPHFHMGSILPPEITNSTV 273
            ++D     +  +ILP EIT+S V
Sbjct: 405 NEKDNYTTTNSNNILPAEITSSNV 428

>KLLA0C06292g Chr3 complement(555112..555882) [771 bp, 256 aa] {ON}
           some similarities with uniprot|Q03208 Saccharomyces
           cerevisiae YML119W
          Length = 256

 Score = 50.8 bits (120), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 50/89 (56%), Gaps = 8/89 (8%)

Query: 164 QPIGVSDDPKYLVSTLKELPNAVHEY------ADRVSGFTLKNSKANPLARLALQESA-- 215
           +   + +D ++  +TL  LP  + +Y        R+          N + +L  QE+   
Sbjct: 137 EAFKLCNDNRFGYTTLDALPAVLSKYISQNMSVQRLPQRPKTKHLYNRVDQLLAQENQFF 196

Query: 216 EVNESVDLSFDGKAMNKSDIFKMVDSFSL 244
             N+S++LSFDGKAMNK+DIF++VDSFS+
Sbjct: 197 SANDSIELSFDGKAMNKNDIFRIVDSFSV 225

>Skud_13.22 Chr13 (30389..31459) [1071 bp, 356 aa] {ON} YML119W
           (REAL)
          Length = 356

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 39/56 (69%), Gaps = 4/56 (7%)

Query: 217 VNESVDLSFDGKAMNKSDIFKMVDSFSLFPDDDTDEDEAPHFHM----GSILPPEI 268
            NES +LSFDGKAM++SDIF+MVDSFS+   D+ ++D+  +F        ILP EI
Sbjct: 294 ANESFELSFDGKAMDRSDIFRMVDSFSIAISDEDEDDDEDNFQQRNKSNRILPAEI 349

>NCAS0B00250 Chr2 (26236..27186) [951 bp, 316 aa] {ON} Anc_8.852
           YML119W
          Length = 316

 Score = 48.9 bits (115), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 40/57 (70%), Gaps = 4/57 (7%)

Query: 215 AEVNESVDLSFDGKAMNKSDIFKMVDSFSL-FPDDDTDEDEAPHFHMGSILPPEITN 270
           A +  S +LSFDGKA++KSDI ++VDSF++ F D++ D +E  +    +ILP ++ N
Sbjct: 258 ATMENSFELSFDGKALDKSDILRIVDSFTMAFSDEEIDTNENEN---NNILPADLLN 311

>TBLA0D03310 Chr4 complement(825054..826562) [1509 bp, 502 aa] {ON}
           Anc_8.852 YML119W
          Length = 502

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 30/38 (78%), Gaps = 1/38 (2%)

Query: 217 VNESVDLSFDGKAMNKSDIFKMVDSFSL-FPDDDTDED 253
           +  S DLSFDGKA+++SDI +MVDSFS+ F D++ D +
Sbjct: 419 IQNSFDLSFDGKALDRSDILRMVDSFSVAFSDEENDNE 456

>TPHA0I00340 Chr9 complement(64246..65433) [1188 bp, 395 aa] {ON}
           Anc_8.852 YML119W
          Length = 395

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/27 (66%), Positives = 25/27 (92%)

Query: 218 NESVDLSFDGKAMNKSDIFKMVDSFSL 244
           N+S +LSFDGKA+++SDI +MVDSFS+
Sbjct: 320 NDSFELSFDGKALDRSDILRMVDSFSV 346

>CAGL0B01232g Chr2 (112175..112864) [690 bp, 229 aa] {ON} highly
           similar to uniprot|Q06287 Saccharomyces cerevisiae
           YLR186w
          Length = 229

 Score = 30.4 bits (67), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 41/89 (46%), Gaps = 5/89 (5%)

Query: 5   QYSGVMGQSTLRNNMVRTVPSPN----QITMIPVPHLQAHKGEKRTLRNTSPLRKSQDFE 60
           ++SG+M Q  L    +R++ S N    ++   PV         K TL   + + + Q++ 
Sbjct: 115 RFSGLMVQ-LLHKLSIRSMESSNTHLLRVVKNPVTKYLPADCRKVTLSFDAEVMRPQEYL 173

Query: 61  GSKPTNTGKSGAGANGHSNSRQRWVDVKI 89
           G K +     GA A GH +    +VD KI
Sbjct: 174 GDKQSVCVFVGAMARGHDSFADEYVDDKI 202

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,140,226
Number of extensions: 1382414
Number of successful extensions: 3502
Number of sequences better than 10.0: 34
Number of HSP's gapped: 3590
Number of HSP's successfully gapped: 34
Length of query: 276
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 168
Effective length of database: 41,097,471
Effective search space: 6904375128
Effective search space used: 6904375128
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)