Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03630g8.851ON84843614e-46
Kwal_27.102098.851ON84843276e-41
SAKL0D01144g8.851ON84843102e-38
ZYRO0C14894g8.851ON84842963e-36
AFR450C8.851ON84842912e-35
Suva_13.4768.851ON83832878e-35
YMR286W (MRPL33)8.851ON86832842e-34
TDEL0B002008.851ON86832833e-34
NDAI0E002508.851ON93832834e-34
Skud_13.4598.851ON83832816e-34
Ecym_46248.851ON84842712e-32
NCAS0B002608.851ON88832722e-32
TPHA0I003308.851ON88832704e-32
KLLA0C06270g8.851ON84842652e-31
Kpol_237.28.851ON86842626e-31
CAGL0I02706g8.851ON89832592e-30
Smik_13.5028.851ON84832549e-30
KAFR0A028708.851ON85842365e-27
TBLA0B029108.851ON85832271e-25
KNAG0G034808.851ON84812122e-23
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03630g
         (84 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03630g Chr3 (315520..315774) [255 bp, 84 aa] {ON} similar ...   143   4e-46
Kwal_27.10209 s27 (241628..241882) [255 bp, 84 aa] {ON} YMR286W ...   130   6e-41
SAKL0D01144g Chr4 complement(85723..85977) [255 bp, 84 aa] {ON} ...   124   2e-38
ZYRO0C14894g Chr3 (1157672..1157926) [255 bp, 84 aa] {ON} highly...   118   3e-36
AFR450C Chr6 complement(1248240..1248494) [255 bp, 84 aa] {ON} S...   116   2e-35
Suva_13.476 Chr13 (823880..824128) [249 bp, 83 aa] {ON} YMR286W ...   115   8e-35
YMR286W Chr13 (841942..842202) [261 bp, 86 aa] {ON}  MRPL33Mitoc...   114   2e-34
TDEL0B00200 Chr2 (38779..39039) [261 bp, 86 aa] {ON} Anc_8.851 Y...   113   3e-34
NDAI0E00250 Chr5 complement(29470..29751) [282 bp, 93 aa] {ON} A...   113   4e-34
Skud_13.459 Chr13 (815502..815750) [249 bp, 83 aa] {ON} YMR286W ...   112   6e-34
Ecym_4624 Chr4 (1221125..1221379) [255 bp, 84 aa] {ON} similar t...   108   2e-32
NCAS0B00260 Chr2 complement(27274..27540) [267 bp, 88 aa] {ON} A...   109   2e-32
TPHA0I00330 Chr9 (63570..63836) [267 bp, 88 aa] {ON} Anc_8.851 Y...   108   4e-32
KLLA0C06270g Chr3 (554658..554912) [255 bp, 84 aa] {ON} highly s...   106   2e-31
Kpol_237.2 s237 (2310..2570) [261 bp, 86 aa] {ON} (2310..2570) [...   105   6e-31
CAGL0I02706g Chr9 (241613..241882) [270 bp, 89 aa] {ON} highly s...   104   2e-30
Smik_13.502 Chr13 (824481..824732) [252 bp, 84 aa] {ON} YMR286W ...   102   9e-30
KAFR0A02870 Chr1 (598363..598620) [258 bp, 85 aa] {ON} Anc_8.851...    96   5e-27
TBLA0B02910 Chr2 (670926..671183) [258 bp, 85 aa] {ON} Anc_8.851...    92   1e-25
KNAG0G03480 Chr7 (745051..745305) [255 bp, 84 aa] {ON} Anc_8.851...    86   2e-23

>KLTH0C03630g Chr3 (315520..315774) [255 bp, 84 aa] {ON} similar
          to uniprot|P20084 Saccharomyces cerevisiae YMR286W
          MRPL33 Mitochondrial ribosomal protein of the large
          subunit
          Length = 84

 Score =  143 bits (361), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 74/84 (88%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIA          TE
Sbjct: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAKVKEVVRVEVTE 60

Query: 61 HALTKEQQRELRKSNPGFTVEKRV 84
          HALTKEQQRELRKSNPGFTVEKRV
Sbjct: 61 HALTKEQQRELRKSNPGFTVEKRV 84

>Kwal_27.10209 s27 (241628..241882) [255 bp, 84 aa] {ON} YMR286W
          (MRPL33) - Mitochondrial ribosomal protein MRPL33
          (YmL33) (E. coli L30) [contig 39] FULL
          Length = 84

 Score =  130 bits (327), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 69/84 (82%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          MVFYKITL+RSTIGLPKA K VVSSLGLGKTGSVVYRQV+PSIAGSIA           E
Sbjct: 1  MVFYKITLTRSTIGLPKAVKDVVSSLGLGKTGSVVYRQVSPSIAGSIAKIKEVVKVDVAE 60

Query: 61 HALTKEQQRELRKSNPGFTVEKRV 84
           AL+KEQQRELRKSNPGF VEKR+
Sbjct: 61 QALSKEQQRELRKSNPGFIVEKRL 84

>SAKL0D01144g Chr4 complement(85723..85977) [255 bp, 84 aa] {ON}
          highly similar to uniprot|P20084 Saccharomyces
          cerevisiae YMR286W MRPL33 Mitochondrial ribosomal
          protein of the large subunit
          Length = 84

 Score =  124 bits (310), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 62/84 (73%), Positives = 68/84 (80%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          MVFYKITL+RSTIGLPKATKS+V SLGLGK GS VYR+VTPSIAGSI           TE
Sbjct: 1  MVFYKITLARSTIGLPKATKSIVKSLGLGKRGSTVYRRVTPSIAGSITKIKELVDLEVTE 60

Query: 61 HALTKEQQRELRKSNPGFTVEKRV 84
           AL+KE+QRELRKSNPGF VEKR+
Sbjct: 61 KALSKEEQRELRKSNPGFVVEKRL 84

>ZYRO0C14894g Chr3 (1157672..1157926) [255 bp, 84 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286W
          Length = 84

 Score =  118 bits (296), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 65/84 (77%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          MVFYK+TLSRS IG+P   ++VV SLGLGK GS VYR+VTP  AGS+A          T+
Sbjct: 1  MVFYKVTLSRSLIGVPHTVRNVVKSLGLGKRGSTVYRRVTPQCAGSLAKVKELVNVEVTQ 60

Query: 61 HALTKEQQRELRKSNPGFTVEKRV 84
          HALTKEQQRELRKSNPGFTVEKRV
Sbjct: 61 HALTKEQQRELRKSNPGFTVEKRV 84

>AFR450C Chr6 complement(1248240..1248494) [255 bp, 84 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR286W
          (MRPL33)
          Length = 84

 Score =  116 bits (291), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 64/84 (76%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          MVFYKITL+RSTIGLP   K VV SLGLGK G+ VYR+V+P  AGSIA          TE
Sbjct: 1  MVFYKITLARSTIGLPDKVKGVVHSLGLGKRGTTVYRKVSPGSAGSIAKIKELVKVEVTE 60

Query: 61 HALTKEQQRELRKSNPGFTVEKRV 84
          HALTKE+QR LRKSNPGFTVEKRV
Sbjct: 61 HALTKEEQRMLRKSNPGFTVEKRV 84

>Suva_13.476 Chr13 (823880..824128) [249 bp, 83 aa] {ON} YMR286W
          (REAL)
          Length = 83

 Score =  115 bits (287), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 57/83 (68%), Positives = 63/83 (75%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          MVFYKITLSRS IG+P  TKSVV SLGLGK GS+VY++V P+IAGS+A          TE
Sbjct: 1  MVFYKITLSRSLIGMPHTTKSVVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVEVTE 60

Query: 61 HALTKEQQRELRKSNPGFTVEKR 83
          H LT  QQRELRKSNPGF VEKR
Sbjct: 61 HELTPYQQRELRKSNPGFVVEKR 83

>YMR286W Chr13 (841942..842202) [261 bp, 86 aa] {ON}
          MRPL33Mitochondrial ribosomal protein of the large
          subunit
          Length = 86

 Score =  114 bits (284), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 63/83 (75%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          MVFYK+TLSRS IG+P  TKS+V SLGLGK GS+VY++V P+IAGS+A          TE
Sbjct: 1  MVFYKVTLSRSLIGVPHTTKSIVKSLGLGKRGSIVYKKVNPAIAGSLAKVKELVKVEVTE 60

Query: 61 HALTKEQQRELRKSNPGFTVEKR 83
          H LT  QQRELRKSNPGF VEKR
Sbjct: 61 HELTPSQQRELRKSNPGFIVEKR 83

>TDEL0B00200 Chr2 (38779..39039) [261 bp, 86 aa] {ON} Anc_8.851
          YMR286W
          Length = 86

 Score =  113 bits (283), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 64/83 (77%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          M FYKITL+RS IG P  TKS+V SLGLGKTGS+VY+QVTP+ AG++A          TE
Sbjct: 1  MAFYKITLARSVIGTPHTTKSIVKSLGLGKTGSIVYKQVTPACAGALAKVKELVKVEVTE 60

Query: 61 HALTKEQQRELRKSNPGFTVEKR 83
          + L+KE+QRELRKSNPGF VEKR
Sbjct: 61 NKLSKEEQRELRKSNPGFIVEKR 83

>NDAI0E00250 Chr5 complement(29470..29751) [282 bp, 93 aa] {ON}
          Anc_8.851 YMR286W
          Length = 93

 Score =  113 bits (283), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 65/83 (78%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          MVFYKITL RS IGLPK T+++V ++GLGK GS+VYR+VTP++AGS+A          TE
Sbjct: 1  MVFYKITLQRSLIGLPKQTRTIVKTIGLGKRGSIVYRRVTPAMAGSLAKVKELIDVEITE 60

Query: 61 HALTKEQQRELRKSNPGFTVEKR 83
           AL K +QRELRKSNPGFT+EKR
Sbjct: 61 KALNKMEQRELRKSNPGFTIEKR 83

>Skud_13.459 Chr13 (815502..815750) [249 bp, 83 aa] {ON} YMR286W
          (REAL)
          Length = 83

 Score =  112 bits (281), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 62/83 (74%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          MVFYKITL+RS IG+P  TKS+V SLGLGK GS+ Y++V P+IAGS+A          TE
Sbjct: 1  MVFYKITLNRSLIGMPHTTKSIVKSLGLGKRGSIAYKRVNPAIAGSLAKVKELIMIEVTE 60

Query: 61 HALTKEQQRELRKSNPGFTVEKR 83
          H LT  QQRELRKSNPGF VEKR
Sbjct: 61 HELTSTQQRELRKSNPGFVVEKR 83

>Ecym_4624 Chr4 (1221125..1221379) [255 bp, 84 aa] {ON} similar to
          Ashbya gossypii AFR450C
          Length = 84

 Score =  108 bits (271), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 52/84 (61%), Positives = 65/84 (77%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          MVFYKI LSRSTIG+P  T++VV SLGLGK GSVVY  V+P++AG+IA          T+
Sbjct: 1  MVFYKIVLSRSTIGMPAKTRAVVKSLGLGKRGSVVYHSVSPTVAGAIAKVKELVNVEVTD 60

Query: 61 HALTKEQQRELRKSNPGFTVEKRV 84
           AL+KE+QR+LR SNPG+TVEKR+
Sbjct: 61 KALSKEEQRQLRTSNPGYTVEKRL 84

>NCAS0B00260 Chr2 complement(27274..27540) [267 bp, 88 aa] {ON}
          Anc_8.851 YMR286W
          Length = 88

 Score =  109 bits (272), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 64/83 (77%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          MV+YKITL+RS IGLP+AT+ +V +LGLGK GSV+YRQVTP+IAGS+           T+
Sbjct: 1  MVYYKITLARSVIGLPQATRDIVKTLGLGKRGSVIYRQVTPAIAGSMIKVKEIIDVEVTK 60

Query: 61 HALTKEQQRELRKSNPGFTVEKR 83
           +L K +QR+LRKSNPGF VEKR
Sbjct: 61 DSLNKFEQRQLRKSNPGFVVEKR 83

>TPHA0I00330 Chr9 (63570..63836) [267 bp, 88 aa] {ON} Anc_8.851
          YMR286W
          Length = 88

 Score =  108 bits (270), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 52/83 (62%), Positives = 64/83 (77%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          MVFYKITL+RS IG P   K+VV ++GLGK GSVVYR+ TP++AG++A          TE
Sbjct: 1  MVFYKITLARSLIGTPPYIKNVVKAIGLGKRGSVVYREATPAMAGTLAMVKEIVKVEVTE 60

Query: 61 HALTKEQQRELRKSNPGFTVEKR 83
          + L+KEQQRELRKSNPGFTV+KR
Sbjct: 61 NQLSKEQQRELRKSNPGFTVQKR 83

>KLLA0C06270g Chr3 (554658..554912) [255 bp, 84 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286W MRPL33 Mitochondrial ribosomal protein of the
          large subunit
          Length = 84

 Score =  106 bits (265), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 52/84 (61%), Positives = 62/84 (73%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          MVFY+ITL RS IG P+ T++VV SLGLGK GSV Y+  TPSIAG++A           +
Sbjct: 1  MVFYRITLQRSVIGTPQKTRAVVKSLGLGKRGSVAYQPATPSIAGAVAQIKELVSVELAD 60

Query: 61 HALTKEQQRELRKSNPGFTVEKRV 84
           AL+K +QRELRKSNPGFTVEKRV
Sbjct: 61 KALSKAEQRELRKSNPGFTVEKRV 84

>Kpol_237.2 s237 (2310..2570) [261 bp, 86 aa] {ON} (2310..2570)
          [261 nt, 87 aa]
          Length = 86

 Score =  105 bits (262), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 50/84 (59%), Positives = 64/84 (76%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          M FYKITL+RS IGLP+AT+++V ++GLGK GS+VYR+VTPSIAGS+A          ++
Sbjct: 1  MAFYKITLTRSLIGLPQATRNIVKTIGLGKRGSIVYREVTPSIAGSLAKVKELVSVELSD 60

Query: 61 HALTKEQQRELRKSNPGFTVEKRV 84
            LT+E+    RKSNPGFTVEKRV
Sbjct: 61 KMLTREEVNASRKSNPGFTVEKRV 84

>CAGL0I02706g Chr9 (241613..241882) [270 bp, 89 aa] {ON} highly
          similar to uniprot|P20084 Saccharomyces cerevisiae
          YMR286w MRPL33
          Length = 89

 Score =  104 bits (259), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 65/83 (78%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          M +YK+TL RS IG P+AT+++V ++GLGK GSVVYR+V+PS+AGS+A          T+
Sbjct: 1  MAYYKVTLVRSLIGTPEATRNIVKAIGLGKRGSVVYRKVSPSMAGSLAKIKELISVDVTK 60

Query: 61 HALTKEQQRELRKSNPGFTVEKR 83
            LTK+QQRELRK+NPGFTVEK+
Sbjct: 61 SRLTKQQQRELRKTNPGFTVEKQ 83

>Smik_13.502 Chr13 (824481..824732) [252 bp, 84 aa] {ON} YMR286W
          (REAL)
          Length = 84

 Score =  102 bits (254), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 58/83 (69%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          M FYKI L RS IG+P  TKS+V SLGLGK GS+VY++V P+IAGS+A          T+
Sbjct: 1  MAFYKIALKRSLIGVPHTTKSIVKSLGLGKRGSIVYKRVNPAIAGSLAKVKELVTVKVTK 60

Query: 61 HALTKEQQRELRKSNPGFTVEKR 83
          H LT  QQR LR SNPGF VEKR
Sbjct: 61 HELTPSQQRVLRMSNPGFVVEKR 83

>KAFR0A02870 Chr1 (598363..598620) [258 bp, 85 aa] {ON} Anc_8.851
          YMR286W
          Length = 85

 Score = 95.5 bits (236), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 60/84 (71%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          MV+Y+ TL RS IGLPK T+++V +LG  K GS +YR+VTP+I GS+           TE
Sbjct: 1  MVYYRATLVRSLIGLPKTTRTIVKTLGFTKRGSTIYRKVTPAITGSLLKVKELISLKLTE 60

Query: 61 HALTKEQQRELRKSNPGFTVEKRV 84
           ++TK +QRE+RKSNPG+ VEKR+
Sbjct: 61 KSVTKAEQREIRKSNPGYIVEKRI 84

>TBLA0B02910 Chr2 (670926..671183) [258 bp, 85 aa] {ON} Anc_8.851
          YMR286W
          Length = 85

 Score = 92.0 bits (227), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 43/83 (51%), Positives = 59/83 (71%)

Query: 2  VFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTEH 61
          +FYKITL RS IGLP+ ++S+V SLGLGK GS+ Y++++PS AG+I           T+ 
Sbjct: 1  MFYKITLQRSLIGLPQKSRSIVKSLGLGKRGSIAYQKISPSTAGAILRVKELVDVELTDK 60

Query: 62 ALTKEQQRELRKSNPGFTVEKRV 84
          ALTK +  + R+SNPGF +EKRV
Sbjct: 61 ALTKAEVHDSRRSNPGFIIEKRV 83

>KNAG0G03480 Chr7 (745051..745305) [255 bp, 84 aa] {ON} Anc_8.851
          YMR286W
          Length = 84

 Score = 86.3 bits (212), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 56/81 (69%)

Query: 1  MVFYKITLSRSTIGLPKATKSVVSSLGLGKTGSVVYRQVTPSIAGSIAXXXXXXXXXXTE 60
          MVFYK+TL+RS IG+P+AT+ +V +LGLGK GS VY++ TP+IAGS+           + 
Sbjct: 1  MVFYKVTLARSLIGMPRATRQIVKTLGLGKRGSTVYKRATPAIAGSLLKVKELITVEVSP 60

Query: 61 HALTKEQQRELRKSNPGFTVE 81
            ++K + R  RKSNPG+ VE
Sbjct: 61 QKVSKGEMRLARKSNPGYVVE 81

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.127    0.337 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,564,356
Number of extensions: 165709
Number of successful extensions: 257
Number of sequences better than 10.0: 21
Number of HSP's gapped: 257
Number of HSP's successfully gapped: 21
Length of query: 84
Length of database: 53,481,399
Length adjustment: 56
Effective length of query: 28
Effective length of database: 47,060,103
Effective search space: 1317682884
Effective search space used: 1317682884
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)