Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0C03608g8.850ON49549523960.0
Kwal_27.102048.850ON49449519690.0
SAKL0D01166g8.850ON50543417760.0
ZYRO0C14872g8.850ON49643416400.0
NCAS0C003108.850ON55643516360.0
Kpol_237.18.850ON50343516160.0
KAFR0L019608.850ON51143716160.0
Suva_13.4758.850ON51543816140.0
TBLA0B029008.850ON52043316080.0
YMR285C (NGL2)8.850ON51543816040.0
Skud_13.4588.850ON51443815890.0
TDEL0B001908.850ON49243415860.0
Smik_13.5018.850ON51543815770.0
CAGL0I02684g8.850ON49343715720.0
NDAI0K003708.850ON56842615530.0
TPHA0I003208.850ON52943715400.0
KLLA0C06248g8.850ON51643515390.0
ABL118W8.850ON50442015060.0
KNAG0K006508.850ON48244014740.0
Ecym_46198.850ON48742314210.0
NDAI0E002608.850ON49844711681e-156
NCAS0B002708.850ON47643911121e-148
TBLA0D033008.850ON48044311021e-146
YML118W (NGL3)8.850ON50545010131e-132
Smik_13.168.850ON50245010041e-131
Skud_13.238.850ON4984489811e-127
Suva_13.258.850ON5024439801e-127
KAFR0A028608.850ON4784349541e-124
CAGL0B02387g8.850ON4714479291e-120
KNAG0G034708.850ON4664358841e-113
ACR288W7.78ON7362252036e-16
KNAG0D048407.78ON7792342001e-15
Suva_1.457.78ON8312561964e-15
Ecym_73547.78ON7852251931e-14
KAFR0K006707.78ON7952571921e-14
SAKL0B10032g7.78ON7312391902e-14
KLLA0F15884g7.78ON7902181893e-14
KLTH0D02310g7.78ON7392251884e-14
Skud_1.407.78ON8692281866e-14
CAGL0H06149g7.78ON8732461866e-14
NDAI0H025207.78ON8982181841e-13
Kwal_26.71127.78ON7422391794e-13
Kpol_1040.147.78ON7842241778e-13
YAL021C (CCR4)7.78ON8372341751e-12
ZYRO0D05302g7.78ON8572391752e-12
Smik_1.457.78ON8392311723e-12
TDEL0H037307.78ON7972391689e-12
TPHA0H026807.78ON8722241689e-12
TBLA0A046607.78ON8962231653e-11
NCAS0F016407.78ON8552181625e-11
KLLA0F07733g7.90ON3712371302e-07
ACR277C7.90ON3782801266e-07
KAFR0D012507.90ON3561271241e-06
TBLA0E022607.90ON3882531204e-06
Kwal_26.71707.90ON3722421178e-06
KLTH0D02574g7.90ON3682441161e-05
SAKL0B09768g7.90ON3682361161e-05
Ecym_26367.90ON3672341142e-05
KNAG0L005507.90ON3812341133e-05
TDEL0H036007.90ON3662431099e-05
Kpol_1044.67.90ON3722461062e-04
TPHA0L005307.90ON3912391036e-04
NCAS0I005007.90ON3892491026e-04
CAGL0F01001g7.90ON3592491018e-04
NDAI0A085307.90ON365235980.002
ZYRO0D05588g7.90ON356242970.002
YOL042W (NGL1)7.90ON363235910.013
Skud_15.1157.90ON363235900.018
Smik_15.1257.90ON36377860.051
Suva_15.1277.90ON363235850.071
CAGL0I04708g3.236ON22771741.2
Skud_10.3544.355ON55148723.2
Suva_9.189na 1ON10763648.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0C03608g
         (495 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   927   0.0  
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   763   0.0  
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   688   0.0  
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   636   0.0  
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      634   0.0  
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   627   0.0  
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   627   0.0  
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   626   0.0  
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   624   0.0  
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   622   0.0  
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   616   0.0  
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   615   0.0  
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   612   0.0  
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   610   0.0  
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   602   0.0  
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   597   0.0  
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   597   0.0  
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   584   0.0  
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   572   0.0  
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   551   0.0  
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   454   e-156
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      432   e-148
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   429   e-146
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   394   e-132
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   391   e-131
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   382   e-127
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   382   e-127
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   372   e-124
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   362   e-120
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   345   e-113
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    83   6e-16
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    82   1e-15
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    80   4e-15
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    79   1e-14
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    79   1e-14
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    78   2e-14
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    77   3e-14
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    77   4e-14
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    76   6e-14
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    76   6e-14
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      75   1e-13
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    74   4e-13
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    73   8e-13
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    72   1e-12
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    72   2e-12
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    71   3e-12
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    69   9e-12
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    69   9e-12
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    68   3e-11
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      67   5e-11
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    55   2e-07
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    53   6e-07
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    52   1e-06
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    51   4e-06
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    50   8e-06
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    49   1e-05
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    49   1e-05
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    49   2e-05
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    48   3e-05
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    47   9e-05
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    45   2e-04
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    44   6e-04
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    44   6e-04
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    44   8e-04
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    42   0.002
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    42   0.002
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    40   0.013
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    39   0.018
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    38   0.051
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    37   0.071
CAGL0I04708g Chr9 (422462..423145) [684 bp, 227 aa] {ON} highly ...    33   1.2  
Skud_10.354 Chr10 (626154..627809) [1656 bp, 551 aa] {ON} YJR131...    32   3.2  
Suva_9.189 Chr9 complement(313656..313979) [324 bp, 107 aa] {ON}...    29   8.1  

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/495 (90%), Positives = 447/495 (90%)

Query: 1   MEEERLADKVNTQIKQDKERHXXXXXXXXXXXXXXXXXXXXXHIXXXXXXXXXXXXXXXX 60
           MEEERLADKVNTQIKQDKERH                     HI                
Sbjct: 1   MEEERLADKVNTQIKQDKERHSGEKGHKSKKKGEKPPKVSPEHIAEVRAQREAAKKKKRE 60

Query: 61  DMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNA 120
           DMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNA
Sbjct: 61  DMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNA 120

Query: 121 LKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIA 180
           LKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIA
Sbjct: 121 LKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIA 180

Query: 181 IVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGII 240
           IVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGII
Sbjct: 181 IVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGII 240

Query: 241 VGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQP 300
           VGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQP
Sbjct: 241 VGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQP 300

Query: 301 FDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFGDGQPEHPV 360
           FDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKAR           NIEKFGDGQPEHPV
Sbjct: 301 FDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARDGEECDDEEGGNIEKFGDGQPEHPV 360

Query: 361 PEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAE 420
           PEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAE
Sbjct: 361 PEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAE 420

Query: 421 TWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEY 480
           TWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEY
Sbjct: 421 TWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEY 480

Query: 481 GSDHLSMMCELELKI 495
           GSDHLSMMCELELKI
Sbjct: 481 GSDHLSMMCELELKI 495

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/495 (72%), Positives = 404/495 (81%), Gaps = 1/495 (0%)

Query: 1   MEEERLADKVNTQIKQDKERHXXXXXXXXXXXXXXXXXXXXXHIXXXXXXXXXXXXXXXX 60
           MEEE+LA  +N QI+ DK+RH                     HI                
Sbjct: 1   MEEEKLAQVINEQIENDKQRHAGESSTKSKKKGKKPSKVSPEHIAEVRAKREAAKKAKRE 60

Query: 61  DMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNA 120
           +M+ARGLDP+FPPDLQFI RPML L+ + +  GFVFK+MTYNCLAQALIRRKLFPTSGNA
Sbjct: 61  EMLARGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNA 120

Query: 121 LKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIA 180
           LKWFKRSRVLLNEFMHY +DV CLQE+DYIQYQSFWKEEF KLGY+SQFHRHGTKNHGIA
Sbjct: 121 LKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIA 180

Query: 181 IVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGII 240
           IVWKRD+FTMVDKML+DYDKEPSG+L+PRTTTKNVGL +AL F+KKVL KYPG+SKRGI+
Sbjct: 181 IVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGIL 240

Query: 241 VGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQP 300
           VGTTHLFWHPFGTFERTRQCYV+LNKMK+F+HR+NVLQD G++ E  WYPFFCGDFN+QP
Sbjct: 241 VGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQD-GSSPEKKWYPFFCGDFNAQP 299

Query: 301 FDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFGDGQPEHPV 360
           FDTPYLS+SSKPV YK RAKTVIECSTSYTFSKAR           NIEKFGDGQPEHPV
Sbjct: 300 FDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARDGEECDDEEGGNIEKFGDGQPEHPV 359

Query: 361 PEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAE 420
           P+ + A  EQK LV++MA LHNSLDMR IS+YSV YKHVH ENAG DN  NEPEISNWAE
Sbjct: 360 PDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWAE 419

Query: 421 TWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEY 480
           TWRGLLDYIFFIK+W+F+D   PEEL+ F+ EN +KI  LLRMPP++EMPNHGQPHEGEY
Sbjct: 420 TWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGEY 479

Query: 481 GSDHLSMMCELELKI 495
           GSDHLS+MCE+EL +
Sbjct: 480 GSDHLSLMCEIELNL 494

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/434 (72%), Positives = 366/434 (84%)

Query: 62  MIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNAL 121
           M+A GLDP+ PPDLQFI RP+L L+  E   GF FK+MTYN LAQALIRRKLFP+SGNA+
Sbjct: 72  MLAHGLDPNVPPDLQFIKRPLLCLHEEEPVKGFKFKIMTYNALAQALIRRKLFPSSGNAV 131

Query: 122 KWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAI 181
           KWFKRS+VLLNEF HY++DV CLQE+D+IQYQ+FWKEEF+KLGY SQFHR GTKNHG+AI
Sbjct: 132 KWFKRSKVLLNEFKHYDADVHCLQEIDHIQYQAFWKEEFQKLGYASQFHRIGTKNHGVAI 191

Query: 182 VWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIV 241
           VW+  +FTMVD ML+DYDKEPSG + PRTTTKN GL +AL FT KVL ++PG+ K GI++
Sbjct: 192 VWRCSLFTMVDTMLVDYDKEPSGDIPPRTTTKNAGLILALKFTDKVLNQFPGTKKSGILI 251

Query: 242 GTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPF 301
           GTTHLFWHPFGTFERTRQCYV+LNKMKE +HR+NVLQ+      + WYPF CGDFNSQPF
Sbjct: 252 GTTHLFWHPFGTFERTRQCYVVLNKMKELIHRVNVLQNNQDRDYSHWYPFICGDFNSQPF 311

Query: 302 DTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFGDGQPEHPVP 361
           DTPYLS++SKPVTY+GRAKTVIECSTS+TFSK R           NIEKFG GQPEHPVP
Sbjct: 312 DTPYLSMTSKPVTYRGRAKTVIECSTSFTFSKLRDGEEGEDEEGGNIEKFGKGQPEHPVP 371

Query: 362 EKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAET 421
           ++F ATEEQ  LV+ M SLHNSLDMR IS+Y+VGYKHVH ENAGLDN+  EPEISNWAET
Sbjct: 372 KEFHATEEQTALVKQMESLHNSLDMRAISLYAVGYKHVHPENAGLDNDSGEPEISNWAET 431

Query: 422 WRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEYG 481
           WRGLLDYIFF+K W+ +D++S ++++ F+ ENGIKIRGLLRMPP +EM  HGQPHEGEY 
Sbjct: 432 WRGLLDYIFFVKNWNGTDRSSVDKIDVFERENGIKIRGLLRMPPGEEMTKHGQPHEGEYP 491

Query: 482 SDHLSMMCELELKI 495
           SDHLSMMCE+EL +
Sbjct: 492 SDHLSMMCEIELNV 505

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/434 (67%), Positives = 347/434 (79%), Gaps = 3/434 (0%)

Query: 62  MIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNAL 121
           M+A+G+DPDFPP+LQFI RP+L L+  EN  GF FKLMTYNCLAQALIRRKLFPTSG+AL
Sbjct: 62  MMAQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDAL 121

Query: 122 KWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAI 181
           KW++RS+VLLNEF +YN+DV+CLQE+DYIQYQSFWK+E  KLGY+SQFHR  +KNHG+AI
Sbjct: 122 KWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAI 181

Query: 182 VWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIV 241
           VWKR+ F M DKMLID+D+E SG + PRTTT N GL ++L F+ KV A+     K GIIV
Sbjct: 182 VWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKV-AQEHNLKKTGIIV 240

Query: 242 GTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPF 301
           GTTHLFWHPFGTFERTRQCYV+LNK+KEF HR+NVLQ+      + WYPFFCGDFNSQPF
Sbjct: 241 GTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQPF 300

Query: 302 DTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKAR--XXXXXXXXXXXNIEKFGDGQPEHP 359
           D+PYLS++ KP+ Y  RAKTVIECSTSYTFSK R             NIEKFG  QP+HP
Sbjct: 301 DSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRDGEEDDAEEEEGGNIEKFGTDQPDHP 360

Query: 360 VPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWA 419
           VP+ + A + ++ LVE M SLHNSLDMR +S+YSV Y+ VH ENAGLDN   EPEISNWA
Sbjct: 361 VPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNWA 420

Query: 420 ETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGE 479
            TWRGLLDY+FFI+ WDFSD    + LE+F+ EN +KIRGLLR+PP KEM  HGQPH GE
Sbjct: 421 HTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTGE 480

Query: 480 YGSDHLSMMCELEL 493
           Y SDHL M+CELEL
Sbjct: 481 YPSDHLCMLCELEL 494

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/435 (68%), Positives = 347/435 (79%), Gaps = 4/435 (0%)

Query: 63  IARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNALK 122
           +A+GLDP+  PDLQFI RP+L L+  E   GF   +MTYNCLAQALIRRKLFP SG+ALK
Sbjct: 121 LAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGDALK 180

Query: 123 WFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAIV 182
           WFKRS+VL NEF HYN DV+CLQE+D++QYQSFWK EFEK+GYESQFHR  +KNHG+AI+
Sbjct: 181 WFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVAII 240

Query: 183 WKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYP-GSSKRGIIV 241
           W++++FT+ DKMLID+DKEPSG + PRTTT N GLA++L FT+K L+K+  G+S+ GIIV
Sbjct: 241 WRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIV 300

Query: 242 GTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPF 301
           GTTHLFWHPFGT+ERTRQCYV+LNKMKEFMHRINVLQ+      + WYPFFCGDFNSQPF
Sbjct: 301 GTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPF 360

Query: 302 DTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKAR-XXXXXXXXXXXNIEKFGDGQPEHPV 360
           DTPYLS++SKP+ YKGRAKTVIECSTSY FSK R            NIEKFG  QP+ PV
Sbjct: 361 DTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRDGEEDADEEEGGNIEKFGKDQPQTPV 420

Query: 361 PEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAE 420
           P+ F A EEQK LV++M  LHNSLDMR IS+Y VGY+ VH ENAGLDN+  EPEISNWA 
Sbjct: 421 PDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWAH 480

Query: 421 TWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMP--NHGQPHEG 478
           TW GLLDYI FIK W F D    + LE F+ EN IK+RG LRMPP+ EM    HGQPH G
Sbjct: 481 TWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTG 540

Query: 479 EYGSDHLSMMCELEL 493
           EY SDHLSM+CELEL
Sbjct: 541 EYPSDHLSMICELEL 555

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/435 (66%), Positives = 341/435 (78%), Gaps = 2/435 (0%)

Query: 61  DMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNA 120
           +++A+GLDPD+PP+LQFI RPML L+  E   GF F LMTYNCLAQALIRRKLFP SG A
Sbjct: 67  ELLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEA 126

Query: 121 LKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIA 180
           +KWF+RS+VLL EF HYNSDV+CLQE+D+IQYQ+FWK EFEKLGYESQFHR  +KNHG+A
Sbjct: 127 VKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVA 186

Query: 181 IVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSK-RGI 239
           IVWKR+MF M D+MLID+DKE S  + PRT T N GL ++L F+ K+L+  P ++K  GI
Sbjct: 187 IVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNTKTTGI 246

Query: 240 IVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQ 299
           I+GTTHLFWHPFGT+ERTRQCYV+LNKMKEFMHR+NVLQ+      + W PFFCGDFNSQ
Sbjct: 247 IIGTTHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQ 306

Query: 300 PFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARX-XXXXXXXXXXNIEKFGDGQPEH 358
           PFD+PYLS++SKP+ Y  RAKTVI+CSTSY FSK R            NIEKFG  QP+ 
Sbjct: 307 PFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNGEEDVDDEEGGNIEKFGKDQPQT 366

Query: 359 PVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNW 418
           PVPE F A EEQ  LVE MA +HN L MR  S+YSVGYKHVHAENAG+DN   EP ISNW
Sbjct: 367 PVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNW 426

Query: 419 AETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEG 478
           A TWRGLLDYIF +  WDF ++ + + LE F+ EN I++RG LRMP   EMP HGQPHEG
Sbjct: 427 ANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHEG 486

Query: 479 EYGSDHLSMMCELEL 493
           EY SDHLSM+C +EL
Sbjct: 487 EYASDHLSMICNIEL 501

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  627 bits (1616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/437 (66%), Positives = 346/437 (79%), Gaps = 3/437 (0%)

Query: 62  MIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNAL 121
           M+A+GLDPD PP+LQFI RP+L+L+ +E+  GF FK+MTYNCLAQALIRRKLFP SG A+
Sbjct: 75  MLAQGLDPDLPPELQFIRRPLLALSKAESTAGFEFKIMTYNCLAQALIRRKLFPDSGEAV 134

Query: 122 KWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAI 181
           KWF+RS+VLLNEF +Y+SDV+CLQEVD IQ+Q+FWKEEF+KLGY+SQFH   +KNHGI+I
Sbjct: 135 KWFRRSKVLLNEFKYYDSDVICLQEVDRIQFQTFWKEEFDKLGYDSQFHAKPSKNHGISI 194

Query: 182 VWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIV 241
           +WKR +FTM DKMLIDYDKE SG + PRTTT NVGL +AL F+ KVL ++P + K GIIV
Sbjct: 195 LWKRSLFTMTDKMLIDYDKEISGNIPPRTTTNNVGLVLALKFSPKVLERFPNTRKSGIIV 254

Query: 242 GTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPF 301
           GTTHLFWHPFGT+ERTRQCY++LNK KEFMHR+NVLQ+     ++ WY FF GDFNSQPF
Sbjct: 255 GTTHLFWHPFGTYERTRQCYIVLNKTKEFMHRVNVLQNNNDEIKDHWYTFFGGDFNSQPF 314

Query: 302 DTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKAR-XXXXXXXXXXXNIEKFGDGQPEHPV 360
           DTPYLS++SKPV Y  RAKTVIECSTSYTFSK+R            NIEKFG  QP  PV
Sbjct: 315 DTPYLSMTSKPVKYSNRAKTVIECSTSYTFSKSRDGEEDAEDEEGGNIEKFGKDQPATPV 374

Query: 361 PEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAE 420
           P  F A+ EQ+ LV +M  LHNSLDMR IS+YSVGY  VH ENAGLDN   EPEISNWA 
Sbjct: 375 PSFFDASSEQQSLVANMEKLHNSLDMRAISLYSVGYGTVHIENAGLDNTRGEPEISNWAH 434

Query: 421 TWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPN--HGQPHEG 478
            W GLLDY+F IK WDFSDK   + L+ F+DEN +K++  L+MP   EM    HGQPH G
Sbjct: 435 AWNGLLDYLFVIKSWDFSDKIQVDSLKKFEDENELKVKAFLKMPTKAEMGKFGHGQPHVG 494

Query: 479 EYGSDHLSMMCELELKI 495
           EY SDHLSM+C+LELK+
Sbjct: 495 EYPSDHLSMICKLELKL 511

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/438 (66%), Positives = 348/438 (79%), Gaps = 4/438 (0%)

Query: 62  MIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNAL 121
           M+A+G+DPD PP+L FI RP LSL+  E   GF FKLMTYNCLAQALIRRKLFP SG+AL
Sbjct: 78  MLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDAL 137

Query: 122 KWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAI 181
           KW++RSRVLLNEF HYN+DV+CLQE+D+IQ+QSFWKEEF KLGYE Q+HR+ TKNHG+AI
Sbjct: 138 KWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLGYEGQYHRNSTKNHGVAI 197

Query: 182 VWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKY--PGSSKRGI 239
           +W+RDMF  VDKMLID+DKE SG +  RTTT NVGL +AL F++KVL+      S K GI
Sbjct: 198 IWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGI 257

Query: 240 IVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQ 299
           ++GT+HLFWHPFGT+ERTRQCY++L KM+EFMHR+NVLQ++     + W+PFFCGDFNSQ
Sbjct: 258 LIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQ 317

Query: 300 PFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKAR-XXXXXXXXXXXNIEKFGDGQPEH 358
           PFDTPYLS++ KPV Y+ RAKTVIECSTS+ FSK R            NIEKFG  QPE 
Sbjct: 318 PFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRDGEEGADEEEGGNIEKFGKDQPES 377

Query: 359 PVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNW 418
           PVP+ F A EEQ  LV+ MA LHNSLDMR +S+YSV YK+VH ENAGLDN+  EPEISNW
Sbjct: 378 PVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKNVHPENAGLDNDRGEPEISNW 437

Query: 419 AETWRGLLDYIFFIKKWDF-SDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHE 477
           A TWRGLLDY+F+IKKWD  S+    + L+ F+ +N IK RG LRMPP  EM  HGQPH 
Sbjct: 438 ANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKFRGFLRMPPGSEMTKHGQPHV 497

Query: 478 GEYGSDHLSMMCELELKI 495
           GEY SDHLSM+C++EL++
Sbjct: 498 GEYASDHLSMVCDIELQL 515

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/433 (63%), Positives = 346/433 (79%), Gaps = 1/433 (0%)

Query: 62  MIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNAL 121
           ++A+G+DPD P +LQFI RP+L ++ +E   GF F LMTYNCLAQALIRRKLFP  G+AL
Sbjct: 86  LLAQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSLMTYNCLAQALIRRKLFPEGGDAL 145

Query: 122 KWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAI 181
           KW +RS+VLLNEF HYN D++CLQE+D++QYQSFWKEEF KLGYE QF++  +KNHG+++
Sbjct: 146 KWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSV 205

Query: 182 VWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGS-SKRGII 240
           VWK+++F M D+ML+DYDKE SG +EPRTTT N+ L ++L F+KKV  ++P + +K GI+
Sbjct: 206 VWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGIL 265

Query: 241 VGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQP 300
           +GTTHLFWHPFGT+ERTRQCY++LNKMKEF+ R+N+LQ+ G    + WYPFFCGDFNSQP
Sbjct: 266 IGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQP 325

Query: 301 FDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFGDGQPEHPV 360
           FD+PYLS++SKP+ Y GR+KTVIECSTS+ FSK R           NIEKFG  QP+HPV
Sbjct: 326 FDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRDGEEGDDEEGGNIEKFGKDQPQHPV 385

Query: 361 PEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAE 420
           P+ + A +EQK LV  M  LHNSLDMR IS+YS GY  VH EN+G+DN  NEPEISNWA 
Sbjct: 386 PDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERNEPEISNWAH 445

Query: 421 TWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEY 480
            WRGLLDY+F+IK WDF+     + LE F+ EN IKIRG LRMPPAKE+P+HGQP EGEY
Sbjct: 446 IWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELPSHGQPFEGEY 505

Query: 481 GSDHLSMMCELEL 493
            SDHL M+CE+EL
Sbjct: 506 PSDHLCMLCEVEL 518

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  622 bits (1604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/438 (66%), Positives = 350/438 (79%), Gaps = 4/438 (0%)

Query: 62  MIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNAL 121
           M+A+G+DPD PP+L FI RP LSL+ +E   GF FKLMTYNCLAQALIRRKLFP SG+AL
Sbjct: 78  MLAQGVDPDCPPELHFIRRPFLSLHEAEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDAL 137

Query: 122 KWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAI 181
           KW++RS+VLLNEF +YNSDV+CLQE+D+IQ+QSFWK+EF KLGY+ Q++R+ TKNHG+AI
Sbjct: 138 KWYRRSKVLLNEFKYYNSDVICLQEIDHIQFQSFWKDEFSKLGYDGQYYRNATKNHGVAI 197

Query: 182 VWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKY--PGSSKRGI 239
           +W+R++F  VDKMLIDYDKE S ++  RTTT NVGL +AL F++KVL+      S K GI
Sbjct: 198 MWRRELFHQVDKMLIDYDKESSESISTRTTTNNVGLVLALKFSEKVLSNLGKKSSKKCGI 257

Query: 240 IVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQ 299
           ++GTTHLFWHPFGT+ERTRQCY++L KMKEFMHR+NVLQ++     + W+PFFCGDFNSQ
Sbjct: 258 LIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQ 317

Query: 300 PFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARX-XXXXXXXXXXNIEKFGDGQPEH 358
           PFDTPYLS++SKPV Y+ RAKTVI CSTSY FSK R            NIEK+G  QPE 
Sbjct: 318 PFDTPYLSMTSKPVHYRNRAKTVIGCSTSYKFSKVRDGEEGADDEEGGNIEKYGKDQPES 377

Query: 359 PVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNW 418
           PVPEKF A EEQ  LV+ MA LHNSLDMR IS+YSVGYK+VH ENAGLDN+  EPEISNW
Sbjct: 378 PVPEKFHANEEQSELVDKMAQLHNSLDMRAISLYSVGYKNVHPENAGLDNDRGEPEISNW 437

Query: 419 AETWRGLLDYIFFIKKWD-FSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHE 477
           A TWRGLLDY+F++KKWD  S+    E L  F+ EN +K RG LRMPP  EM  HGQPH 
Sbjct: 438 ANTWRGLLDYLFYVKKWDPQSNCQEVETLGDFEKENKVKCRGFLRMPPGNEMTKHGQPHV 497

Query: 478 GEYGSDHLSMMCELELKI 495
           GEY SDHLSM+C+LEL++
Sbjct: 498 GEYASDHLSMVCDLELQL 515

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/438 (67%), Positives = 347/438 (79%), Gaps = 4/438 (0%)

Query: 62  MIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNAL 121
           M+A G+DPD PP+L FI RP+LSL   E   GF FKLMTYNCLAQALIRRKLFP SG+AL
Sbjct: 77  MLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDAL 136

Query: 122 KWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAI 181
           KWF+RS+VLLNEF +YN+DV+CLQEVD+IQ+QSFWK +F K+GY+ Q+HR+ TKNHG+AI
Sbjct: 137 KWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAI 196

Query: 182 VWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKR--GI 239
           +W+R MF  VDKMLIDYDKE SG++  RTTT NVGL +AL F+K+VL+K    S +  GI
Sbjct: 197 IWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFSKEVLSKLGKKSSKKCGI 256

Query: 240 IVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQ 299
           ++GTTHLFWHPFGT+ERTRQCYV+L KMKEFMHR+NVLQ+      + W+PFFCGDFNSQ
Sbjct: 257 LIGTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQ 316

Query: 300 PFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARX-XXXXXXXXXXNIEKFGDGQPEH 358
           PFDTPYLS++SKPV YK RAKTVIECSTS+ FSK R            NIEKFG  QPE 
Sbjct: 317 PFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRDGEEGADDEEGGNIEKFGKDQPES 376

Query: 359 PVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNW 418
           PVPE F A +EQ  +V+ M  LHNSLDMR IS+YSVGYK VH ENAGLDN+  EPEISNW
Sbjct: 377 PVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNW 436

Query: 419 AETWRGLLDYIFFIKKWDF-SDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHE 477
           A TWRGLLDY+F+IKKWD  S++   E L  F+ +N IK RG LRMPPA EM  HGQPH 
Sbjct: 437 ANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHV 496

Query: 478 GEYGSDHLSMMCELELKI 495
           GEY SDHLSM+C+LEL++
Sbjct: 497 GEYPSDHLSMVCDLELQL 514

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/434 (64%), Positives = 336/434 (77%), Gaps = 1/434 (0%)

Query: 61  DMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNA 120
           +M+A+G+DPD PP+LQFI RP+L+L+  E   G  FKL+TYNCLAQALIRRKLFP SG++
Sbjct: 57  EMLAKGMDPDHPPELQFIKRPLLTLHEDEPIEGLSFKLLTYNCLAQALIRRKLFPDSGDS 116

Query: 121 LKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIA 180
           LKWF+RS+VL  EF HYN+DVLCLQE+DYIQYQ FWK+E +KLGY++QF++   KNHG++
Sbjct: 117 LKWFRRSKVLQYEFKHYNADVLCLQEIDYIQYQQFWKDELDKLGYDTQFYKQPCKNHGVS 176

Query: 181 IVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGII 240
           I WKR +F + D+MLIDYDKE SG +E RT T N GL +AL FT       P   K GI+
Sbjct: 177 IAWKRHLFQLTDRMLIDYDKESSGKIEKRTLTHNSGLILALKFTDAAKQSCPHIRKSGIL 236

Query: 241 VGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQP 300
           VGT+HLFWHPFGT+ERTRQCYV+L KMKEFM R+NVLQ+      + W PFFCGDFNSQP
Sbjct: 237 VGTSHLFWHPFGTYERTRQCYVVLKKMKEFMKRVNVLQNNNDGNLSHWVPFFCGDFNSQP 296

Query: 301 FDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARX-XXXXXXXXXXNIEKFGDGQPEHP 359
           FDTPYLS++SKPV Y GRAKTV+ECSTSYTFSK R            NIEKFG  QP+ P
Sbjct: 297 FDTPYLSMTSKPVEYTGRAKTVVECSTSYTFSKLRNGEEDAEDEEGGNIEKFGKDQPQTP 356

Query: 360 VPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWA 419
           VPE F AT EQ+ LVE M  LHNS+DMR IS+Y+VGY  VH EN+G+DN+  EPE+SNWA
Sbjct: 357 VPETFDATPEQQKLVEEMQELHNSIDMRAISLYAVGYGEVHPENSGIDNDRGEPEMSNWA 416

Query: 420 ETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGE 479
            TWRGLLDYI  I +WD SD+   + LE F+ EN +K+RGLLRMPPA EM +HGQPHEGE
Sbjct: 417 NTWRGLLDYILLITQWDSSDRKKVDSLETFEKENSLKLRGLLRMPPASEMSHHGQPHEGE 476

Query: 480 YGSDHLSMMCELEL 493
           Y SDHLSMMC +EL
Sbjct: 477 YASDHLSMMCTIEL 490

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/438 (66%), Positives = 348/438 (79%), Gaps = 4/438 (0%)

Query: 62  MIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNAL 121
           M+A+G+DPD PP+L FI RP L L+  E   GF FKLMTYNCLAQALIRRKLFP SG+AL
Sbjct: 78  MLAQGVDPDCPPELHFIKRPFLVLHEKEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDAL 137

Query: 122 KWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAI 181
           KW++RSRVLLNEF +Y +DV+CLQE+D+IQ+QSFWK+EF KLGY+ Q++R+ TKNHG+AI
Sbjct: 138 KWYRRSRVLLNEFKYYKADVICLQEIDHIQFQSFWKDEFNKLGYDGQYYRNSTKNHGVAI 197

Query: 182 VWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKR--GI 239
           +W+R+MF  VDKMLIDYDKE S  +  RTTT NVGL +AL F++KVL+    SS +  GI
Sbjct: 198 MWRREMFQQVDKMLIDYDKETSENISTRTTTNNVGLVLALKFSEKVLSNLSKSSSKKCGI 257

Query: 240 IVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQ 299
           ++GTTHLFWHPFGT+ERTRQCYV+L KMKEFMHR+NVLQ++     + W+PFFCGDFNSQ
Sbjct: 258 LIGTTHLFWHPFGTYERTRQCYVVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQ 317

Query: 300 PFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARX-XXXXXXXXXXNIEKFGDGQPEH 358
           PFDTPYLS++SKPV YK RAKTVIECSTS+ FSKAR            NIEK+G  QPE 
Sbjct: 318 PFDTPYLSMTSKPVHYKNRAKTVIECSTSFKFSKARDGDESADDEEGGNIEKYGKDQPES 377

Query: 359 PVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNW 418
           PVPE + A EEQ  LV+ MA LHNSLDMR IS+YSVGY++VH ENAGLDN+  EPEISNW
Sbjct: 378 PVPENYHANEEQIELVDKMAQLHNSLDMRAISLYSVGYRNVHPENAGLDNDRGEPEISNW 437

Query: 419 AETWRGLLDYIFFIKKWDF-SDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHE 477
           A TWRGLLDY+F++KKWD  S+    E L  F+  N +K RG LRMPP KEM  HGQPH 
Sbjct: 438 ANTWRGLLDYLFYVKKWDLRSNCQEVENLGDFEKVNEMKCRGFLRMPPGKEMTKHGQPHV 497

Query: 478 GEYGSDHLSMMCELELKI 495
           GEY SDHLSM+C+LEL++
Sbjct: 498 GEYASDHLSMVCDLELEL 515

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/437 (64%), Positives = 332/437 (75%), Gaps = 3/437 (0%)

Query: 61  DMIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNA 120
           +M+ RG+DPD PP+LQFI R ML L+  E   G   K+M+YNCLAQALIRRKLFP SG A
Sbjct: 57  EMLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEA 116

Query: 121 LKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIA 180
           LKW++RSRVLLNEF HY+ DVLCLQE+DYIQYQSFWKEEF+KLGY SQFHR  +KNHG+ 
Sbjct: 117 LKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVC 176

Query: 181 IVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKV--LAKYPGSSKRG 238
           I+WK + F M D+MLID+D E SG +EPRTTT N  L +AL FT+KV  + K     K G
Sbjct: 177 IIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSG 236

Query: 239 IIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNS 298
           I+VGTTHLFWHPFGT+ERTRQCYV+LNKMKEFMHR+NVLQ+      + WYPFFCGDFNS
Sbjct: 237 ILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNS 296

Query: 299 QPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARXX-XXXXXXXXXNIEKFGDGQPE 357
           QPFD+PYLS++ KP+ Y  RAKTVIECSTS+ FSK R            NIEKFG  QP+
Sbjct: 297 QPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRESGEDAEDEEGGNIEKFGKDQPQ 356

Query: 358 HPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISN 417
            PVPEKF A +EQ  LV  M  LHNSLDMR +S+YSV Y  VH EN+GLDN   EPEISN
Sbjct: 357 TPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISN 416

Query: 418 WAETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHE 477
           WA TWRGLLDY+F I+ W+F D+   + LE F++ N IKIRGLLRMPP  EM  HGQPH 
Sbjct: 417 WAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHV 476

Query: 478 GEYGSDHLSMMCELELK 494
           GEY SDHL ++ E+EL+
Sbjct: 477 GEYPSDHLCLLSEVELR 493

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/426 (65%), Positives = 332/426 (77%), Gaps = 3/426 (0%)

Query: 71  FPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNALKWFKRSRVL 130
            PP+LQFI RP+L L+  E   GF F +MTYNCLAQALIRRKLFP SG+ALKW++RS+VL
Sbjct: 142 IPPELQFIKRPILYLHEEEPVQGFKFSMMTYNCLAQALIRRKLFPDSGDALKWYRRSKVL 201

Query: 131 LNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAIVWKRDMFTM 190
           LNEF +Y+ D++CLQEVD+IQYQSFWK EFEKLGY+SQ+HR G KNHG++I+W+R +FTM
Sbjct: 202 LNEFTYYSPDIICLQEVDHIQYQSFWKTEFEKLGYQSQYHRKGVKNHGVSIIWRRSLFTM 261

Query: 191 VDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPG--SSKRGIIVGTTHLFW 248
            DKMLI++DKE SG + PRTTT NVGL ++L FT +  A++    ++K GII+GTTHLFW
Sbjct: 262 TDKMLIEFDKESSGNVPPRTTTNNVGLILSLKFTPEAKAQFKNVETTKTGIIIGTTHLFW 321

Query: 249 HPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFDTPYLSV 308
           HPFGT+ERTRQCYV+LNKMKEFMHR+NVLQ+      + WYPFFCGDFNSQPFD+PYLS+
Sbjct: 322 HPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDRDLSHWYPFFCGDFNSQPFDSPYLSM 381

Query: 309 SSKPVTYKGRAKTVIECSTSYTFSKAR-XXXXXXXXXXXNIEKFGDGQPEHPVPEKFSAT 367
             KPV Y GRAKTVIECSTSY FSK R            NIEKFG  QP+ PVPE+F A 
Sbjct: 382 VRKPVEYSGRAKTVIECSTSYKFSKKRDGEEDVDDEEGGNIEKFGIDQPQTPVPEEFIAN 441

Query: 368 EEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAETWRGLLD 427
            EQ  LV+ M  LHNSL+MR IS+Y VGYK+VH ENA +DN   EPEISNWA TW GLLD
Sbjct: 442 GEQTILVKDMEKLHNSLNMRAISLYGVGYKNVHPENASIDNECGEPEISNWAHTWNGLLD 501

Query: 428 YIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEYGSDHLSM 487
           Y+ F+K+W FSD    E L+ F++ N ++IRG LRMPPA EM  HGQPH GEY SDHLSM
Sbjct: 502 YLLFVKEWTFSDCTKTETLKQFEESNSMRIRGFLRMPPANEMTKHGQPHVGEYPSDHLSM 561

Query: 488 MCELEL 493
           +C +EL
Sbjct: 562 LCSIEL 567

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/437 (63%), Positives = 339/437 (77%), Gaps = 5/437 (1%)

Query: 62  MIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNAL 121
           M+A GLDPD PP+LQFI RP+L+L+  E    F F LMTYNCLAQALIRRKLFP SG A+
Sbjct: 91  MLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAV 150

Query: 122 KWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAI 181
           KW++RSRVLLNEF +YN D++CLQE+D+IQ+QSFW+EEF+K+GY SQFHR  +KNHG+AI
Sbjct: 151 KWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAI 210

Query: 182 VWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYP---GSSKRG 238
           VWK ++F + D+MLID+DKE SG + PRT T N GL ++L ++  VLAKYP    ++K G
Sbjct: 211 VWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSG 270

Query: 239 IIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNS 298
           II+GTTHLFWHPFGT+ERTRQC+V+LNK+KEF  R+NVLQ+      + W  FFCGDFNS
Sbjct: 271 IIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNS 330

Query: 299 QPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARX--XXXXXXXXXXNIEKFGDGQP 356
           QPFDTPYLS++SKPV YK RAK VIECSTSYT+SK R             NIEKFG  QP
Sbjct: 331 QPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNGDDDEAEDEEGGNIEKFGKDQP 390

Query: 357 EHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEIS 416
           + PVP+ ++ T EQ  LV  M SLHNSL+M+  S+Y+VGYK VH EN+GLDN   EPEIS
Sbjct: 391 QTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEIS 450

Query: 417 NWAETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPH 476
           NWA +WRGLLDYIF++  WDFSD    E+ E F+ +N +K+RG LRMPPA EM  +GQPH
Sbjct: 451 NWAHSWRGLLDYIFYVDHWDFSDCKEVEDFEKFEKKNHMKLRGYLRMPPATEMSKYGQPH 510

Query: 477 EGEYGSDHLSMMCELEL 493
           +GEY SDHLSMMC++EL
Sbjct: 511 QGEYPSDHLSMMCKIEL 527

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/435 (63%), Positives = 331/435 (76%), Gaps = 6/435 (1%)

Query: 62  MIARGLDPDFPPDLQFIHRPMLSLNPSENANGFV-----FKLMTYNCLAQALIRRKLFPT 116
           +IA+G+DP  P DL+FI RPML++ P +++           +MTYNCLAQALIRR LFPT
Sbjct: 79  LIAQGIDPKLPADLRFIKRPMLAV-PRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPT 137

Query: 117 SGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKN 176
           SGNA+KWFKRS+VLLNEF +YN DVLCLQE+D +QY+SFWK EF KLGY  QFH + TKN
Sbjct: 138 SGNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKN 197

Query: 177 HGIAIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSK 236
           HG+ I WK D+F M DKMLIDYDKE +GA+EPRTTTKNVG+ ++L F KKVL KYP +  
Sbjct: 198 HGVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKV 257

Query: 237 RGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDF 296
            GII+GTTHLFWHPFGT+ERTRQCY++L K+KEF +RINVLQ++     + W  FFCGDF
Sbjct: 258 SGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDF 317

Query: 297 NSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFGDGQP 356
           NSQPFD PYLS++SKPV Y GRAKTVIECSTS+TFSK R           NIEKFG GQP
Sbjct: 318 NSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRDGDEGEGEEGGNIEKFGKGQP 377

Query: 357 EHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEIS 416
           E PVPE FS  EEQK L E+M +LHN +DMR IS+YS+ Y  VH EN+GLDN  NEPEIS
Sbjct: 378 ETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEIS 437

Query: 417 NWAETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPH 476
           NWA  WRGLLDY++++  WD  D    +EL  F+   G+++  LLR+PPAKEM  HGQPH
Sbjct: 438 NWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQPH 497

Query: 477 EGEYGSDHLSMMCEL 491
           EGEY SDHL M+ +L
Sbjct: 498 EGEYPSDHLCMIVKL 512

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/420 (62%), Positives = 325/420 (77%), Gaps = 1/420 (0%)

Query: 74  DLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNE 133
           D+ FI RP+L  N  E A GFVF++MTYNCLAQALIRRKLFPTSGNALKWFKRS+VLL+E
Sbjct: 84  DVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142

Query: 134 FMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAIVWKRDMFTMVDK 193
             +YN DV+CLQE+D+ QY+SFW +  +  GY S+FHR   KNHGIAIVW+R +F  VD+
Sbjct: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202

Query: 194 MLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGT 253
            LID+D+E SG +E RTTTKNVGL +AL +T ++  +YPGS++ GI+VGT+HLFWHPFGT
Sbjct: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWHPFGT 262

Query: 254 FERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKPV 313
           +ER RQCY++L++MK F+ R+ +L+       + W+PFFCGDFNSQPFD PYLS+ SKP+
Sbjct: 263 YERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKPI 322

Query: 314 TYKGRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFGDGQPEHPVPEKFSATEEQKGL 373
            Y+GRA+TVIECSTSY FS  R           NIEKFG GQPE PVP+ F  T EQ+ L
Sbjct: 323 IYEGRARTVIECSTSYKFSSLRDGCAADEEEGGNIEKFGAGQPETPVPDSFDGTPEQRAL 382

Query: 374 VESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAETWRGLLDYIFFIK 433
           V++M SLHN+LDMR IS+YS+ Y++VH ENAG+DNN  EPEISNWA  WRGLLDYI ++ 
Sbjct: 383 VDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMYVM 442

Query: 434 KWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEYGSDHLSMMCELEL 493
            WDFSD    +++  FQ    + +R LLR+PPA EMP+HGQPHEGEY SDHLS+MCELEL
Sbjct: 443 PWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCELEL 502

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/440 (61%), Positives = 326/440 (74%), Gaps = 9/440 (2%)

Query: 65  RGLDPDFPPDLQFIHRPMLSLNP----SENANGFVFKLMTYNCLAQALIRRKLFPTSGNA 120
           +G   D P +L+FI RPMLS++P        N     LMTYNCLAQALIRRKLFP SG A
Sbjct: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102

Query: 121 LKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIA 180
           LKW++RS+VLLN+F HY  DVLCLQEVD +Q+ SFW+ EFEKLGY +QFH+  TKNHG+A
Sbjct: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162

Query: 181 IVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGII 240
           +VW+  +FTM DKMLID+DKE SG + PRTTT N GL IAL FT++ L  +  + + GI+
Sbjct: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGIL 222

Query: 241 VGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQP 300
           VGTTHLFWHPFGTFERTRQCYV+LNKMKEFMHR+NVLQ++       W+PFFCGDFNSQP
Sbjct: 223 VGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQP 282

Query: 301 FDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKAR---XXXXXXXXXXXNIEKFGDGQPE 357
           +D PYLS++SKPV+Y GRA+TVIECSTSYTFSK R              NIE FG  QP 
Sbjct: 283 YDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRDGEDAAADEEEEGGNIEIFGKDQPH 342

Query: 358 HPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISN 417
           HPVP  F    EQ  LV  M +LHNSLDMR +S+YSVGY++VH ENAG DN   EPEISN
Sbjct: 343 HPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISN 402

Query: 418 WAETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPN--HGQP 475
           WA TW GLLDY+F++  WDF D+   + LE F+ ++G+ ++ LLRMP  +EM    HGQP
Sbjct: 403 WAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQP 462

Query: 476 HEGEYGSDHLSMMCELELKI 495
           H GEY SDHL+M+C+LEL +
Sbjct: 463 HTGEYPSDHLAMVCDLELAL 482

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 313/423 (73%), Gaps = 4/423 (0%)

Query: 74  DLQFIHRPMLSLNPSENAN-GFVFKLMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLN 132
           +L+FI RPML L  ++  + GF F LMTYNCLAQ+LIRR LFPTSG ALKW KRS VLL 
Sbjct: 68  NLEFIARPMLPLKVTQTVHKGFSFSLMTYNCLAQSLIRRSLFPTSGRALKWTKRSMVLLK 127

Query: 133 EFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAIVWKRDMFTMVD 192
           EF HYN+DVLCLQE+DY QY SFW      LGY S+FHR   K+HG+AI WK+D+F  +D
Sbjct: 128 EFKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHRMDNKSHGVAIFWKKDLFIWMD 187

Query: 193 KMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFG 252
           +MLI++D E SG +EPR TT NVG+ +ALGF+ KV   +PG+ K GIIVGT+HLFWHPFG
Sbjct: 188 QMLINFDNEDSGEIEPRKTTNNVGMILALGFSDKVKQSFPGTVKSGIIVGTSHLFWHPFG 247

Query: 253 TFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKP 312
           T+ERTRQCYV+LNKMKEF+HR+++ Q++  T    WYPFFCGDFNSQPFD PYLS++SKP
Sbjct: 248 TYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPFFCGDFNSQPFDAPYLSITSKP 307

Query: 313 VTYKGRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFGDGQPEHPVPEKFSATEEQKG 372
           V Y GRAKTVIECS +Y F                +   G+ +P  PVPE F  T E   
Sbjct: 308 VLYSGRAKTVIECSAAYKFPDLGAGARGANEDGGTV---GEDRPVDPVPESFQPTAEVSS 364

Query: 373 LVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAETWRGLLDYIFFI 432
           LV+ M  LHNSLDMR IS+Y+V YKHVH +NAGLDN   EPEISNWA TWRGLLDYI +I
Sbjct: 365 LVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLDNERGEPEISNWAYTWRGLLDYIMYI 424

Query: 433 KKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEYGSDHLSMMCELE 492
             W  S+    + LE+F+  + I ++ +LRMPPAKEM +HGQPH+GEY SDHL+MMC+LE
Sbjct: 425 TPWQASNNVEVDSLESFEKLSHITVQEMLRMPPAKEMSSHGQPHDGEYPSDHLAMMCKLE 484

Query: 493 LKI 495
           +++
Sbjct: 485 VEM 487

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  454 bits (1168), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 216/447 (48%), Positives = 295/447 (65%), Gaps = 30/447 (6%)

Query: 66  GLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNALKWFK 125
           G +PD P +LQFI RP+L+L+  +   G + K+MTYNCLAQ+LI+R LFP SG ALKW +
Sbjct: 61  GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR 120

Query: 126 RSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAIVWKR 185
           RS+VLLNE  +Y+SD+L LQE+D++Q++ +WK    KLGY+ +F++   K HG+ I WKR
Sbjct: 121 RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR 180

Query: 186 DMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTH 245
           ++F  V  + ID+D+  SG ++PRT TKNVGL IAL F  K         K+G+I+GTTH
Sbjct: 181 NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNK---DKSAIKKKGVIIGTTH 237

Query: 246 LFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFDTPY 305
           LFWH FGTFERTRQCYVM+++M +FM ++  ++         WYPFF GDFNSQP D PY
Sbjct: 238 LFWHLFGTFERTRQCYVMMDQMDKFMKKLGGIEK--------WYPFFTGDFNSQPKDAPY 289

Query: 306 LSVSSKPVTYKGRAKTVIECSTSYTFSKAR------------------XXXXXXXXXXXN 347
           +S++SKPV+++   K VIECS +Y +SK R                              
Sbjct: 290 VSITSKPVSFQNETKIVIECSAAYKYSKKRNGEEEEKNEGKEKQHEIDSSDSSDAETDEE 349

Query: 348 IEKFGDGQPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLD 407
            E+    QP +  P  F+ T EQ  LV  +A+LHNSL++R IS+YSVGY+ V  ENA ++
Sbjct: 350 KEEIIPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYIN 409

Query: 408 NNFNEPEISNWAETWRGLLDYIFFIKKWDF-SDKASPEELEAFQDENGIKIRGLLRMPPA 466
           N+  EPE+S WA  W GLLDYIFF++ WD  ++    + L+ F+ EN +K+RGLL+MP +
Sbjct: 410 NDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQS 469

Query: 467 KEMPNHGQPHEGEYGSDHLSMMCELEL 493
           KEM  H  P++GEY SDHL MM +LEL
Sbjct: 470 KEMCEHAIPYKGEYPSDHLCMMIQLEL 496

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  432 bits (1112), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 213/439 (48%), Positives = 286/439 (65%), Gaps = 14/439 (3%)

Query: 63  IARGLDPDFPPDLQFIHRPMLSLNPSENANG---FVFKLMTYNCLAQALIRRKLFPTSGN 119
           + +GLDPD PP+LQF  RP L+L+ +E  NG     F ++TYNCLAQ LI R +FP SGN
Sbjct: 42  MQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEFSILTYNCLAQGLIMRDMFPESGN 101

Query: 120 ALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGI 179
           ALKW +RS+ ++NE  +YN D++CLQE+D+   + FW  +F+ LGY  +F +   K HG+
Sbjct: 102 ALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFFKKEKKIHGV 161

Query: 180 AIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGI 239
            I W+  +F   D+  +D+D+  +G + PRT T+N+GL +AL F        P     GI
Sbjct: 162 VIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGLIVALQFLDNN-NNNPSRESHGI 220

Query: 240 IVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQ 299
           +V TTHLFWHPFGTFERTRQCY+ML++M +F+  +N  +  G T    WYPF  GDFNSQ
Sbjct: 221 VVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLN--EHSGITN---WYPFLTGDFNSQ 275

Query: 300 PFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARX----XXXXXXXXXXNIEKFGDGQ 355
           P D PY+S+++KP+ Y    +TVIECSTSYT+SK R                 E+F   Q
Sbjct: 276 PKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRNGDMDVNEKEQSDSEEDEEFIKKQ 335

Query: 356 PEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEI 415
           P  P P  F  T+EQ  LV ++  LHNSL  R IS+YSVGY++VH EN+ ++N   EPE 
Sbjct: 336 PTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISLYSVGYRNVHPENSFINNTRGEPEF 395

Query: 416 SNWAETWRGLLDYIFFIKKWDFSDKASP-EELEAFQDENGIKIRGLLRMPPAKEMPNHGQ 474
           S+W   W GLLDYIF+IK W+  DK    E LE F+  N +KI G L++P  KEM +H Q
Sbjct: 396 SSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFEKTNTLKILGFLKLPLRKEMAHHSQ 455

Query: 475 PHEGEYGSDHLSMMCELEL 493
           P+EGEY SDHL++MC+L+L
Sbjct: 456 PYEGEYPSDHLALMCKLQL 474

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  429 bits (1102), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 210/443 (47%), Positives = 289/443 (65%), Gaps = 18/443 (4%)

Query: 63  IARGLDPDFPPDLQFIHRPMLSL--NPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNA 120
           + +G DPD P +L FI RP+L L  +   N  GF F LMTYNCLAQA+IRR++F  SG A
Sbjct: 38  LIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPA 97

Query: 121 LKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFE-KLGYESQFHRHGTKNHGI 179
           LKWF+RS+VL+NE  +YN D+LCLQE+D  QY++FWK++ E  L   + +++   K+HG+
Sbjct: 98  LKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGV 157

Query: 180 AIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAK-YPG----- 233
            I WK+ +F  VD M++D+D   +  +  RT T+N+ + +AL F  + + K +P      
Sbjct: 158 LIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSF 217

Query: 234 -SSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFF 292
             +  G I+ TTHLFWHPFGTFERTRQCY++L KMK+F+  +NV +D   T    WYPF 
Sbjct: 218 DQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV-KDHLKTH---WYPFI 273

Query: 293 CGDFNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFG 352
           CGDFNS P D PYLS++SKP+ Y GR K VIECST+Y FSK R             EK  
Sbjct: 274 CGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEE--EKKL 331

Query: 353 DGQPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNE 412
             QP+  VP+ F+ T EQ  LV  + SLHN L +R  S+Y + YK V   N  ++N+  E
Sbjct: 332 INQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVNINNDRGE 391

Query: 413 PEISNWAETWRGLLDYIFFIKKWDFSDKASP--EELEAFQDENGIKIRGLLRMPPAKEMP 470
           PE ++WA++W G+LDYI ++  WD ++  S   E LE F+  N + I+GLL+MP  K+MP
Sbjct: 392 PEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLNKDMP 451

Query: 471 NHGQPHEGEYGSDHLSMMCELEL 493
            H QP E EY SDH+S++CE+E+
Sbjct: 452 FHTQPFEREYPSDHISILCEMEI 474

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  394 bits (1013), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 206/450 (45%), Positives = 277/450 (61%), Gaps = 36/450 (8%)

Query: 62  MIARGLDPDFP-PDLQFIHRPMLSLNPSENANGFV------------FKLMTYNCLAQAL 108
           +I++G DPDFP PDLQFI RP L +N  +N+ G               K+MTYN LAQ L
Sbjct: 63  LISQGKDPDFPTPDLQFIERPFLPIN-HDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTL 121

Query: 109 IRRKLFPTSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQ 168
           IRR  FP SG ALKW KRS+VL++E   Y  DV+ LQEVDY +  +FW+E F KLG++  
Sbjct: 122 IRRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVI 180

Query: 169 FHRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSG-ALEPRTTTKNVGLAIALGFTKKV 227
           F RH  K HG+ + W    F + +  ++DYD   +G  +  RT TKN+ L I+L F    
Sbjct: 181 FKRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYF---- 236

Query: 228 LAKYPGSSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENL 287
                 SS RGIIV  THLFWHPFG FER RQ Y++L K++E          K  ++ N 
Sbjct: 237 -KGITDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEI---------KACSKYNG 286

Query: 288 WYPFFCGDFNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARXXXXXXXXXXXN 347
           W+    GDFN++P + PYL+++ +P+  KG  + ++ECS +Y +SK R            
Sbjct: 287 WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGEESDQDDEEC 346

Query: 348 IEKF-GDG---QPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAEN 403
            EK  G+G   QP++P PE F+AT+E+K LV  + +LHNSL ++G+S+Y +GY  VH EN
Sbjct: 347 DEKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPEN 406

Query: 404 AGLDNNFNEPEISNWAETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRM 463
           A  + +  EP +SNWA TW GLLDYIF+I+     D    E L AF+  N +KI G LRM
Sbjct: 407 A--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRM 464

Query: 464 PPAKEMPNHGQPHEGEYGSDHLSMMCELEL 493
           P A+EMP H QP EGEY SDH+S+MC++ L
Sbjct: 465 PCAQEMPKHSQPFEGEYASDHISLMCQIRL 494

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  391 bits (1004), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 198/450 (44%), Positives = 279/450 (62%), Gaps = 35/450 (7%)

Query: 62  MIARGLDPDFP-PDLQFIHRPMLSLNPSENANGFV------------FKLMTYNCLAQAL 108
           +I++G DPDFP PDLQFI RP+L ++  +NAN F              K+MTYN LAQ L
Sbjct: 63  LISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTL 122

Query: 109 IRRKLFPTSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQ 168
           IRR  FP SG+ALKW KRS+VL++E   Y  D++ LQEVDY + + FW+E F KLG++  
Sbjct: 123 IRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLS 181

Query: 169 FHRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSG-ALEPRTTTKNVGLAIALGFTKKV 227
           F R+G K HG+ + W  + F + ++ ++DYD+  +G  +  RT TKN+ L ++L F    
Sbjct: 182 FRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDTR 241

Query: 228 LAKYPGSSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENL 287
            A     S  GI+V  THLFWHPFG FER RQ Y++L K++E          K   + + 
Sbjct: 242 NA-----STNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI---------KDFPKYHG 287

Query: 288 WYPFFCGDFNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARXXXXXXXXXXXN 347
           W+    GDFN++P + PYL+++SKP+T  G  + ++ECS +Y +SK R            
Sbjct: 288 WHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDDEDY 347

Query: 348 IEKFGD----GQPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAEN 403
            E         QP++P P+ F+AT+E+K LV  + +LHNSL ++GIS+Y +GY  VH EN
Sbjct: 348 DENSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPEN 407

Query: 404 AGLDNNFNEPEISNWAETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRM 463
           A  +    EPE+SNWA TW GLLDYIF+I+  D +     + L  F++ NG+ + G LRM
Sbjct: 408 A--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRM 465

Query: 464 PPAKEMPNHGQPHEGEYGSDHLSMMCELEL 493
           P  +EMP H QP EGEY SDH+S+MC++ L
Sbjct: 466 PCKQEMPKHSQPFEGEYASDHISLMCQIRL 495

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  382 bits (981), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 196/448 (43%), Positives = 274/448 (61%), Gaps = 33/448 (7%)

Query: 62  MIARGLDPDFP-PDLQFIHRPML----SLNPSENANGFVF-------KLMTYNCLAQALI 109
           +I++G DPDFP PDLQFI RP L     ++     +G          ++MTYN LAQ LI
Sbjct: 65  LISQGKDPDFPTPDLQFIERPFLHVYREVSQDSKTSGMQVPPSSLDVQIMTYNTLAQTLI 124

Query: 110 RRKLFPTSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQF 169
           RR  FP SG+ALKW KRS+VL++E   Y  D++ LQEVDY +   FW E F KLG+ S F
Sbjct: 125 RRDFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNEL-GFWHENFHKLGFGSTF 183

Query: 170 HRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSG-ALEPRTTTKNVGLAIALGFTKKVL 228
            RH  K HG+ + W  + F   ++ ++DYD   +G A+  RT TKN+ L ++L      +
Sbjct: 184 RRHEGKTHGLMVAWNNEKFQQDNEWMLDYDTILAGNAISARTRTKNIALIVSLS-----V 238

Query: 229 AKYPGSSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLW 288
                 S  G+IV  THLFWHPFG FER RQ +++L K++E          K   +   W
Sbjct: 239 KNMTNLSTSGVIVANTHLFWHPFGVFERLRQSFLVLKKIEEI---------KTCPKYYGW 289

Query: 289 YPFFCGDFNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARXXXXXXXXXXXNI 348
           +    GDFN++P + PY++++ +P+T  G A+ + ECS +Y +SK R           + 
Sbjct: 290 HSLLMGDFNTEPEEPPYMAITRRPLTLTGSARAMTECSLAYRYSKMRNGEESDQDEECDE 349

Query: 349 EKFGDGQ---PEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAG 405
           E  G+GQ   P++P P+ F AT+EQK LV  + +LHNSL ++GIS+Y + Y  VH +N+ 
Sbjct: 350 ESTGEGQHDQPQNPKPKYFVATKEQKNLVNQLVALHNSLHVKGISLYGLSYGKVHPDNS- 408

Query: 406 LDNNFNEPEISNWAETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPP 465
              N  EPE+SNWA TW GLLDYIF+I++ D    +  E ++ F+D+N +KI G LRMP 
Sbjct: 409 -KENHGEPELSNWANTWCGLLDYIFYIERNDNVSSSKDEPVKNFEDQNNVKIIGYLRMPR 467

Query: 466 AKEMPNHGQPHEGEYGSDHLSMMCELEL 493
           A+EMP H QP EGEY SDH+S+MC+L L
Sbjct: 468 AEEMPKHSQPFEGEYASDHISLMCQLRL 495

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  382 bits (980), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 198/443 (44%), Positives = 271/443 (61%), Gaps = 30/443 (6%)

Query: 62  MIARGLDPDFP-PDLQFIHRPMLSL-------NPSENANGFVFKLMTYNCLAQALIRRKL 113
           +I++G DPDFP PDLQFI RP L L       +     N    K+MTYN LAQ LIRR  
Sbjct: 65  LISQGKDPDFPTPDLQFIKRPFLHLHHEIAQGSTESTPNSLDVKIMTYNTLAQTLIRRNF 124

Query: 114 FPTSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHG 173
           FP SG+ALKW KRS+VL++E   Y  D++ LQEVDY + + FW+E F KLG++  F RH 
Sbjct: 125 FPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNELK-FWQENFRKLGFDLTFKRHD 183

Query: 174 TKNHGIAIVWKRDMFTMVDKMLIDYDKEPSG-ALEPRTTTKNVGLAIALGFTKKVLAKYP 232
            K HG+ I W    F + ++ ++DYD   +G A+  RT TKN+ L  +L      L    
Sbjct: 184 GKTHGLLIAWNSGKFQLENEWMLDYDNILAGNAIPARTRTKNIALIASLR-----LKNIS 238

Query: 233 GSSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFF 292
             S  G+IV  THLFWHPFG FER RQ Y++L K++E          K   + N W+   
Sbjct: 239 DPSTDGVIVANTHLFWHPFGVFERLRQSYLVLAKIQEI---------KACPKYNGWHSVL 289

Query: 293 CGDFNSQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKF- 351
            GDFN++P + PYL+++ KPV   G A+ + ECS +Y +SK R             E+  
Sbjct: 290 MGDFNTEPEEPPYLAITRKPVALTGSARVMAECSLAYRYSKKRNGEEGGQDDEECDEQSR 349

Query: 352 GDG---QPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDN 408
           G+G   QP++P P+ F+AT EQK LV+ + +LHNSL +RG+S+Y +GY  V  EN+   N
Sbjct: 350 GEGRFNQPQNPKPKSFTATSEQKALVDQLVALHNSLHVRGVSLYGLGYGKVQPENSHESN 409

Query: 409 NFNEPEISNWAETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKE 468
              EPE+SNWA +W GLLDYIF+I+  D         ++ F+++N +++ G L+MP AKE
Sbjct: 410 G--EPELSNWANSWCGLLDYIFYIEHSDEHSAHDQNPVDDFENKNNLRVMGYLKMPRAKE 467

Query: 469 MPNHGQPHEGEYGSDHLSMMCEL 491
           MP H QP EGEY SDH+S+MC+L
Sbjct: 468 MPKHSQPFEGEYASDHVSLMCQL 490

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  372 bits (954), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 191/434 (44%), Positives = 269/434 (61%), Gaps = 23/434 (5%)

Query: 77  FIHRPMLSL-NPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFM 135
           FI R +L L N  E  N    K+MTYN L+Q+LIRR+++P + +A+KW  RS+V+LNE  
Sbjct: 53  FIKRAILQLPNVEELDNSVDLKIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVILNEIK 112

Query: 136 HYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHR--HGTKNHGIAIVWKRDMFTMVDK 193
           +YN D++C QEVD IQ+  FW  E  KLGYE +F++   G K HG+AI W+ ++F   D 
Sbjct: 113 YYNCDIMCFQEVDVIQWDKFWLPELSKLGYEGEFYKDFRGPKVHGVAIFWRSNLFEQFDV 172

Query: 194 MLIDYDKEPSG-ALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFG 252
           + I++D   +G A+   T T NVGL +AL F K   AK+    + GI++GTTHLFWHPFG
Sbjct: 173 IKINFDDIVAGNAISKTTRTWNVGLIVALKF-KSSNAKF----RSGIVIGTTHLFWHPFG 227

Query: 253 TFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKP 312
           TFERTRQ  ++L K ++ +  +N          N W P   GDFNSQP D PYLS++SKP
Sbjct: 228 TFERTRQLAILLKKFRKLIDNLNTECGHINEMSNRWLPILTGDFNSQPCDMPYLSITSKP 287

Query: 313 VTYKGRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKFGD-----------GQPEHPVP 361
           V+  G AKTVIECST+Y FS+ R           + E+                P  P P
Sbjct: 288 VSASGEAKTVIECSTAYKFSRRRSGSINSSEEVDHNEETQSEKEVEEEEDEESNPIDPRP 347

Query: 362 EKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAET 421
             F AT EQK L+  +  +HNS++++  S++ + YK VH+   GL N  NEPE+S+ +  
Sbjct: 348 SHFEATSEQKDLIAKLEKVHNSINLKATSLFGIAYKKVHS--IGL-NCKNEPELSHTSIF 404

Query: 422 WRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEYG 481
           W GLLDYIF ++ W+  +K     LE F+    ++++GLL+MP  KE+P + QPH+G+Y 
Sbjct: 405 WTGLLDYIFILEPWNEVEKTDWGSLEDFEKRMSLRVKGLLKMPEMKELPKNVQPHQGQYP 464

Query: 482 SDHLSMMCELELKI 495
           SDHLSM+C+L ++I
Sbjct: 465 SDHLSMICDLNVRI 478

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  362 bits (929), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 186/447 (41%), Positives = 261/447 (58%), Gaps = 34/447 (7%)

Query: 61  DMIARGLDPDFPPDLQFIHRPMLSLNPSEN-ANGFVFKLMTYNCLAQALIRRKLFPTSGN 119
           ++++RGLDPDFP + QFI RP+L +   +N   G    +MTYNCLAQ LIRR++FP SG 
Sbjct: 44  ELLSRGLDPDFPAECQFIERPILLVPHGDNYERGLPLSIMTYNCLAQTLIRREMFPESGP 103

Query: 120 ALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGI 179
           ALKWF RS+VLL+E  HYN+D+ CLQE+D +QY  FW EE  K GY++ +    +K+HG+
Sbjct: 104 ALKWFVRSKVLLHEIKHYNADICCLQEIDDVQYDLFWSEELPKFGYKTIYFHQDSKSHGV 163

Query: 180 AIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAK--YPGSSKR 237
            I WK ++F +   M I++DKE    ++PRT T NVGL +AL FT    A+     +S+ 
Sbjct: 164 MIAWKEELFQLESHMNIEFDKEAPAGIQPRTRTNNVGLLVALAFTDAFRARNNRIRTSRS 223

Query: 238 GIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFN 297
           G+I+GT HLFWHPFGT++RTRQC V+  K+ EF            T +  +   F GDFN
Sbjct: 224 GVIIGTFHLFWHPFGTYDRTRQCLVIKKKILEF----------AGTVKGDYCKMFTGDFN 273

Query: 298 SQPFDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARXXXXXXXXXXXNIEKF------ 351
           SQP   PYL ++        + +T IE ST+Y +S+ R             E+       
Sbjct: 274 SQPNSVPYLVLTQPRAQLNTQQRTSIEASTAYRYSERRNLGKEYSMEEEEEEEEEEEKRE 333

Query: 352 -----GDGQPEHPVPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGL 406
                G      P P++F +TEEQ+ LV ++    N + +   S+YS+GY  V   +   
Sbjct: 334 YEYDQGTDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVPLCATSLYSIGYHTVDPTHIA- 392

Query: 407 DNNFNEPEISNWAETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPA 466
             + +EPE+S+W+  W GLLDYIF++ +        P     F+  N I I G L+MP  
Sbjct: 393 --DHHEPELSSWSTKWAGLLDYIFYVNQ-------RPSTPATFETANNIAIAGYLQMPTH 443

Query: 467 KEMPNHGQPHEGEYGSDHLSMMCELEL 493
            +M NH QP+ GEY SDH+SMMC LE+
Sbjct: 444 AQMHNHSQPYTGEYPSDHISMMCALEI 470

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  345 bits (884), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 188/435 (43%), Positives = 262/435 (60%), Gaps = 27/435 (6%)

Query: 77  FIHRPMLSL---NPSENANGFV-FKLMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLN 132
           FI RP+L +         +G+V  K+MTYN LAQ LIRR  FP + +A+KW +RS+VL+ 
Sbjct: 43  FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQVLIQ 102

Query: 133 EFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAIVWKRDMF--TM 190
           E  +Y++DV+CLQE D IQ+  FW EEF++LGY+  F     K HG+AIVWK  MF  T 
Sbjct: 103 ELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMFEDTP 162

Query: 191 VDKMLIDYDKEPSG-ALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWH 249
           +DK+ +  D   +G  +   T T+ V LA+AL             + R II  TTHLFWH
Sbjct: 163 LDKLPLCLDDYVAGDDIAATTGTRTVALAVALRLKHH-------KTSRPIIFSTTHLFWH 215

Query: 250 PFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFDTPYLSVS 309
            FGTFERTRQ +V+L+++ +F+ ++    D    +    Y FF GDFNSQP D PYLS++
Sbjct: 216 LFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDAPYLSLT 272

Query: 310 SKPVTYKGRAKTVIECSTSYTFSKARXX-----XXXXXXXXXNIEKFGD--GQPEHPVPE 362
            KPV  KGRAK++IECS SY +SK R                + E   D   +P+ P P 
Sbjct: 273 DKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVEDETNRPQDPRPY 332

Query: 363 KFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAG-LDNNFN-EPEISNWAE 420
            + A  EQ   V+ + +LHN + ++G+S+Y +GY  VH EN+     + N EP++S+ A 
Sbjct: 333 TYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQLSHRAL 392

Query: 421 TWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGEY 480
            W GLLDYIF I +W   +     +L+A + + GIKI G LRMP  +EM +H +PHE EY
Sbjct: 393 HWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTEPHENEY 451

Query: 481 GSDHLSMMCELELKI 495
            SDHL+MMC++ L +
Sbjct: 452 PSDHLAMMCDISLPL 466

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 82.8 bits (203), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 95/225 (42%), Gaps = 33/225 (14%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQS 154
           F L++YN L Q     K++      AL W  R   L +E + Y +D++CLQEV+   Y+ 
Sbjct: 398 FTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDIICLQEVESKTYEE 457

Query: 155 FWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYD----- 199
           FW    EK GY   FH          +   K  G  I +K   FT V K  ID+      
Sbjct: 458 FWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKDAIDFSSVWMK 517

Query: 200 ----KEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFE 255
               +     L       NV L I L   +         +   + V TTHL W P     
Sbjct: 518 HKKFQRTEDYLNRAMNKDNVALIIKLRHER---------TGEHVWVVTTHLHWDPHFNDV 568

Query: 256 RTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPF-FCGDFNSQ 299
           +T Q  VML+ +++ + +   +   G+ Q+    P   CGDFNSQ
Sbjct: 569 KTFQVAVMLDYIEKLLKQHGGV---GSPQDKKKIPLVICGDFNSQ 610

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 101/234 (43%), Gaps = 26/234 (11%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L ++ + Y+ D++CLQEV+   ++ 
Sbjct: 435 FTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRAKLRDQILSYSCDIMCLQEVEARTFED 494

Query: 155 FWKEEFEKLGYESQF----------HRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSG 204
           FW    EK GY   F          HR   K  G  + +KR  F ++ K  +D+      
Sbjct: 495 FWLPLLEKHGYSGSFHAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEVDFSSTWMK 554

Query: 205 ALEPRTTTKNVGLA-----IALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFERTRQ 259
             + + T   +  A     IAL F  + +A     S   I V TTHL W P     +T Q
Sbjct: 555 HEKFQRTEDFLNRAMNKDNIALYFKLQHIA-----SGEHIWVATTHLHWDPKFNDVKTFQ 609

Query: 260 CYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKPV 313
             V+L+ ++  + + N  QD             CGDFNS      Y  +SS  V
Sbjct: 610 VGVLLDHLQTLIRQDNPRQDVKKAPV-----IICGDFNSYIDSAVYELLSSGSV 658

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 80.1 bits (196), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 72/256 (28%), Positives = 107/256 (41%), Gaps = 45/256 (17%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L  + + Y+SDVLCLQEV+   ++ 
Sbjct: 499 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYSSDVLCLQEVESKTFED 558

Query: 155 FWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSG 204
           +W    EK GY   FH          +   K  G  I +KRD F MV++  +D+    SG
Sbjct: 559 YWVPLLEKHGYTGVFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKMVNRDSMDF----SG 614

Query: 205 A-------------LEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPF 251
           A             L       NV L + L            SS   I V TTHL W P 
Sbjct: 615 AWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHV---------SSGDTIWVVTTHLHWDPK 665

Query: 252 GTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSK 311
               +T Q  V+L+ ++  +        +   +++      CGDFNS      Y++ +  
Sbjct: 666 FNDVKTFQVGVLLDHLETLLKEDTTHNSRQDIKKSPV--LICGDFNS------YINSAVY 717

Query: 312 PVTYKGRAKTVIECST 327
            +   GR +   E S+
Sbjct: 718 ELISTGRVQAHQEGSS 733

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 95/225 (42%), Gaps = 33/225 (14%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQS 154
           F L++YN L Q     K++      AL W  R   L  E + Y +DV+CLQEV+   Y+ 
Sbjct: 445 FTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKEEVLSYQTDVICLQEVESKTYEE 504

Query: 155 FWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYD----- 199
           FW    EK GY   FH          +   K  G  I +K   F+ + K  ID+      
Sbjct: 505 FWLPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFKDAIDFSSVWMK 564

Query: 200 ----KEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFE 255
               +     L       N+ L + L   K  L      S   + V TTHL W P     
Sbjct: 565 HKKFQRTEDYLNRAMNKDNIALIVKL---KHEL------SGEHVWVVTTHLHWDPHFNDV 615

Query: 256 RTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPF-FCGDFNSQ 299
           +T Q  V+L+ +++ + + +   + G  QE    P   CGDFNSQ
Sbjct: 616 KTFQVGVLLDYIEKLLKQQS---NIGNPQEKKKVPLIICGDFNSQ 657

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 105/257 (40%), Gaps = 39/257 (15%)

Query: 71  FPPDLQFIH-----RPMLSLNPSENANGFV--------FKLMTYNCLAQALIRRKLFP-T 116
            P D +FI       P    +  E+AN  V        F +++YN L Q     K++  T
Sbjct: 428 LPADRKFIEINTDGEPTREFDSLESANTAVEAGLLKKSFTILSYNTLCQHYATPKMYRYT 487

Query: 117 SGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFH------ 170
              AL+W  R   L  + + Y  D+LCLQEV+   Y+ FW    EK GY   FH      
Sbjct: 488 PSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYEDFWAPLLEKNGYTGYFHCKTRAK 547

Query: 171 ----RHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKK 226
               +   K  G  + +K+  F ++ K  +D+    SGA +     +     +     K 
Sbjct: 548 TMQAKDSKKVDGCCVFYKKSKFKLITKEALDF----SGAWQKHKRFQRTEDYLNRAMNKD 603

Query: 227 VLAKYPG----SSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGA 282
            +A Y       S   + V TTHL W P     +T Q  V+L+ M+  +   N  QD   
Sbjct: 604 NVAIYMKLQHVQSGEYLWVVTTHLHWDPKFNDVKTFQVGVLLDHMESIIKEENPKQDVKK 663

Query: 283 TQENLWYP-FFCGDFNS 298
                 +P    GDFNS
Sbjct: 664 ------FPIIITGDFNS 674

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/239 (28%), Positives = 98/239 (41%), Gaps = 33/239 (13%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQS 154
           F L++YN L Q     K++  T   AL W  R   L  + + + +DV+CLQEV+   ++ 
Sbjct: 399 FTLLSYNTLCQHYATPKMYRYTPSWALSWDYRRDKLKEQIISFQADVVCLQEVECKTFED 458

Query: 155 FWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYD----- 199
           FW    +K GY   FH          +   K  G  + +K   F +V K  +D+      
Sbjct: 459 FWAPFLQKHGYTGVFHAKTRARTMQSKDSKKVDGCCVFYKNSEFKLVFKDAVDFSSVWMK 518

Query: 200 ----KEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFE 255
               +     L       NV L + L   K         +   I V TTHL W P     
Sbjct: 519 HKKFQRTEDYLNRAMNKDNVALFVKLQHLK---------TNEQIWVTTTHLHWDPQFNDV 569

Query: 256 RTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPF-FCGDFNSQPFDTPYLSVSSKPV 313
           +T Q  V+L+ M++ +   N +   G  QE    P   CGDFNSQ     Y   SS  V
Sbjct: 570 KTFQVGVLLDYMEKLLRDQNGV---GNNQEMKKVPLVICGDFNSQLDSAVYELFSSGTV 625

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 93/218 (42%), Gaps = 19/218 (8%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQS 154
           F L++YN L       K++  T   AL W  R   L  + + +++DV+CLQEV+ + Y+ 
Sbjct: 454 FTLLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKEQLLDFDTDVICLQEVETLTYEE 513

Query: 155 FWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSG 204
           +W    EK  Y   FH          +   K  G AI +K+D F +V +  ID+      
Sbjct: 514 YWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQDSIDFSSAWRS 573

Query: 205 ALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFERTRQCYVML 264
             +   T   +  A+       +      ++   + V TTHL W P     +T Q  VML
Sbjct: 574 HKKFHRTEDYLNRAMNKDNVALIAELKHLNTNENVWVVTTHLHWDPQFNDVKTFQVGVML 633

Query: 265 NKMKEFM---HRINVLQDKGATQENLWYPFFCGDFNSQ 299
           + ++  +   H +N   D             CGDFNSQ
Sbjct: 634 DYLETLIKQHHHVNNNNDIKKIPM-----VICGDFNSQ 666

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/225 (28%), Positives = 92/225 (40%), Gaps = 33/225 (14%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L  + + YN+D++CLQEV+   Y+ 
Sbjct: 408 FTILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCLQEVECKTYED 467

Query: 155 FWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYD----- 199
           FW     + GY   FH          +   K  G    +K   F ++ K  +D+      
Sbjct: 468 FWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKEAVDFSSVWMK 527

Query: 200 ----KEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFE 255
               +     L       NV L + L   K         S   +   TTHL W P     
Sbjct: 528 HKKFQRTEDYLNRAMNKDNVALVVKLQHIK---------SGEHVWAATTHLHWDPQFNDV 578

Query: 256 RTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYP-FFCGDFNSQ 299
           +T Q  V+L+ M++ +   N   +   TQE    P   CGDFNSQ
Sbjct: 579 KTFQVGVLLDYMEKVIKEQNNCNN---TQELKKVPVVICGDFNSQ 620

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 95/228 (41%), Gaps = 39/228 (17%)

Query: 95  VFKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQ 153
            F +++YN L Q     K++  T   AL W  R   L  + + Y+SDVLCLQEV+   ++
Sbjct: 536 TFSVLSYNTLCQHYATPKMYRYTPSWALTWDYRRSKLKEQILSYDSDVLCLQEVESKTFE 595

Query: 154 SFWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPS 203
            +W    +K GY   F+          +   K  G  I +KRD F +V K  +D+    S
Sbjct: 596 DYWVPLLDKHGYTGIFYAKARAKTMHSKDSKKVDGCCIFFKRDQFKLVTKDAMDF----S 651

Query: 204 GA-------------LEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHP 250
           GA             L       NV L + L            SS   I V TTHL W P
Sbjct: 652 GAWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHV---------SSGDTIWVVTTHLHWDP 702

Query: 251 FGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNS 298
                +T Q  V+L+ ++  +        +   +++      CGDFNS
Sbjct: 703 KFNDVKTFQVGVLLDHLESLLKEDTTHNSRQDIKKSPV--LICGDFNS 748

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 100/246 (40%), Gaps = 42/246 (17%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L  + +++N+D++CLQEV+   ++ 
Sbjct: 538 FTMLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFED 597

Query: 155 FWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYD----- 199
           FW+   EK GY   FH          +   K  G    +K   F M+ K  +D+      
Sbjct: 598 FWQPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMK 657

Query: 200 ----KEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFE 255
               +     L       NV + + L   +         S   + + TTHL W P     
Sbjct: 658 HKKFQRTEDYLNRAMNKDNVAIVMKLQHIQ---------SGEIMWLVTTHLHWDPKFNDV 708

Query: 256 RTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPF-FCGDFNSQPFDTPYLSVSSKPVT 314
           +T Q  V+L+ M+  +   N  QD         YP   CGD NS      YLS S   + 
Sbjct: 709 KTFQVGVLLDHMETLLKEQNPKQDVKK------YPLVICGDLNS------YLSSSVYELF 756

Query: 315 YKGRAK 320
             GR +
Sbjct: 757 STGRVQ 762

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 93/218 (42%), Gaps = 24/218 (11%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L  + + Y SD+LCLQEV+   ++ 
Sbjct: 569 FTILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKTFEE 628

Query: 155 FWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSG 204
           FW    EK  Y+  FH          +   K  G  I +K+  F ++ K  +D+    SG
Sbjct: 629 FWGPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDF----SG 684

Query: 205 ALEPRTTTKNVGLAIALGFTKKVLAKY----PGSSKRGIIVGTTHLFWHPFGTFERTRQC 260
                   +     +     K  +A Y      +S   + V TTHL W P     +T Q 
Sbjct: 685 TWMKHKKFQRTEDYLNRAMNKDNVALYMKLQSITSGETVWVVTTHLHWDPKFNDVKTFQV 744

Query: 261 YVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNS 298
            ++L+ M+  +   N  QD    + N+     CGD NS
Sbjct: 745 GILLDHMETLLKEENPKQD--VKKANV---VICGDLNS 777

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 73.6 bits (179), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 99/239 (41%), Gaps = 33/239 (13%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQS 154
           F L++YN L Q     K++  T   AL W  R   L  + ++Y++D++CLQEV+   Y+ 
Sbjct: 410 FTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYED 469

Query: 155 FWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYD----- 199
           FW     + GY   FH          +   K  G  + ++   F ++ K  +D+      
Sbjct: 470 FWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWMK 529

Query: 200 ----KEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFE 255
               +     L       NV L + L   K         S   +   TTHL W P     
Sbjct: 530 HKKFQRTEDYLNRAMNKDNVALLVKLQHLK---------SGEHVWAATTHLHWDPQFNDV 580

Query: 256 RTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYP-FFCGDFNSQPFDTPYLSVSSKPV 313
           +T Q  V+L+ M++ +   +   +   +QE    P   CGDFNSQ     Y  +S+  V
Sbjct: 581 KTFQVGVLLDHMEKVIKEHSGYNN---SQELKKVPVIICGDFNSQVDSAVYELLSTGSV 636

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 72.8 bits (177), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 93/224 (41%), Gaps = 33/224 (14%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L ++ + + SDV+CLQEV+   Y+ 
Sbjct: 452 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICLQEVESKSYEE 511

Query: 155 FWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYD----- 199
           FW    +K GY   F+          +   K  G  I +K   F ++ K  +D+      
Sbjct: 512 FWLPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKDSVDFSGVWMK 571

Query: 200 ----KEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFE 255
               +     L       NV L + L   K         S   + V TTHL W P     
Sbjct: 572 HKKFQRTEDYLNRAMNKDNVALYMKLEHIK---------SGESVWVVTTHLHWDPQFNDV 622

Query: 256 RTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYP-FFCGDFNS 298
           +T Q  ++L+ ++E +   N   +  + QE    P   CGD NS
Sbjct: 623 KTFQVGILLDHLEELLKDNN---NASSKQEIRKCPVIICGDLNS 663

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/234 (28%), Positives = 94/234 (40%), Gaps = 51/234 (21%)

Query: 95  VFKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQ 153
            F +++YN L Q     K++  T   AL W  R   L  + + Y+SD+LCLQEV+   ++
Sbjct: 504 TFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFE 563

Query: 154 SFWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPS 203
            +W    +K GY   FH          +   K  G  I +KRD F ++ K  +D+    S
Sbjct: 564 EYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDF----S 619

Query: 204 GA-------------LEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHP 250
           GA             L       NV L + L             S   I   TTHL W P
Sbjct: 620 GAWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHI---------PSGDTIWAVTTHLHWDP 670

Query: 251 FGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLW-----YP-FFCGDFNS 298
                +T Q  V+L+ ++  +        K  T  N       +P   CGDFNS
Sbjct: 671 KFNDVKTFQVGVLLDHLETLL--------KEETSHNFRQDIKKFPVLICGDFNS 716

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 96/239 (40%), Gaps = 37/239 (15%)

Query: 86  NPSENANGFV----FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSD 140
           N ++N N  V    F +M+YN L Q     K++  T   AL W  R + L  E M Y +D
Sbjct: 510 NATDNLNKEVAKRSFTIMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTD 569

Query: 141 VLCLQEVDYIQYQSFWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTM 190
           ++CLQEV+   Y+  W     K GY   FH          +   K  G  + +K   F +
Sbjct: 570 IVCLQEVEAKTYEEHWAPLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKL 629

Query: 191 VDKMLIDYD---------KEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIV 241
             K  +D+          +     L       NV + I L   K         S   + +
Sbjct: 630 QFKDEVDFSSTWMKHKKFQRTEDYLNRAMNKDNVVIYIKLNHLK---------SGESVWI 680

Query: 242 GTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYP-FFCGDFNSQ 299
            TTHL W P     +T Q  ++++ ++E    I       + Q+    P   CGDFNSQ
Sbjct: 681 ATTHLHWDPQFNDVKTFQVGILMDHLEEL---IKEHGSPSSRQDPKKSPVIICGDFNSQ 736

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 93/231 (40%), Gaps = 45/231 (19%)

Query: 95  VFKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQ 153
            F +++YN L Q     K++  T   AL W  R   L  + + Y+SD+LCLQEV+   ++
Sbjct: 506 TFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFE 565

Query: 154 SFWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPS 203
            +W    +K GY   FH          +   K  G  I +K+D F ++ K  +D+    S
Sbjct: 566 DYWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDF----S 621

Query: 204 GA-------------LEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHP 250
           GA             L       NV L + L             S   I   TTHL W P
Sbjct: 622 GAWMKHKKFQRTEDYLNRAMNKDNVALFLKLQHI---------PSGDTIWAVTTHLHWDP 672

Query: 251 FGTFERTRQCYVMLNKMKEFMHRI---NVLQDKGATQENLWYPFFCGDFNS 298
                +T Q  V+L+ ++  +      N  QD   +         CGDFNS
Sbjct: 673 KFNDVKTFQVGVLLDHLETLLREETTHNFRQDIKKSPV-----LICGDFNS 718

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 97/239 (40%), Gaps = 33/239 (13%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L  + + Y +DV+CLQEV+   ++ 
Sbjct: 464 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMTDVICLQEVEAKTFEE 523

Query: 155 FWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYD----- 199
           +W    +K GY   FH          +   K  G  + ++ + F +  K  +D+      
Sbjct: 524 YWAPLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYKDAVDFSGVWQK 583

Query: 200 ----KEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFE 255
               +     L       NV + + L   K         S   + + TTHL W P     
Sbjct: 584 HKKFQRTEDYLNRAMNKDNVAIYLKLQHIK---------SGESVWIVTTHLHWDPQFNDV 634

Query: 256 RTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYP-FFCGDFNSQPFDTPYLSVSSKPV 313
           +T Q  V+++ ++  +   +  Q K   QE    P   CGD NS+     Y  +S+  V
Sbjct: 635 KTFQVGVLMDHIENLLKEQSNAQSK---QEAKKCPVILCGDLNSEIHSAVYELLSTGRV 690

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 60/224 (26%), Positives = 89/224 (39%), Gaps = 33/224 (14%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQS 154
           F +++YN L Q     K++  T    L W  R   L N+ +   SDV+CLQEV+   Y+ 
Sbjct: 540 FTVLSYNTLCQHYATPKMYRYTPSWVLSWDTRREQLKNQILGIQSDVICLQEVEAQTYED 599

Query: 155 FWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYD----- 199
           FW    +K GY   FH          +   K  G  I +K   F +  +  +D+      
Sbjct: 600 FWLPLLQKRGYLGIFHAKTRAKTMQSKDSKKVDGCCIFYKESEFKLQHQESVDFSGVWMK 659

Query: 200 ----KEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFE 255
               +     L       NV L + L            +S   + V TTHL W P     
Sbjct: 660 HKKFQRTEDYLNRAMNKDNVALFVKLEHI---------NSGESVWVVTTHLHWDPQFNDV 710

Query: 256 RTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYP-FFCGDFNS 298
           +T Q  V+L+ ++  +   N   +  + QE    P   CGD NS
Sbjct: 711 KTFQVGVLLDHLESLLKDYN---NASSKQEIRKCPVIICGDLNS 751

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 57/223 (25%), Positives = 91/223 (40%), Gaps = 31/223 (13%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQS 154
           F +++YN L Q     K++  T   AL W  R   L ++ + + SD+LCLQEV+   Y  
Sbjct: 564 FTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRDKLKDQILSFKSDILCLQEVESRTYDD 623

Query: 155 FWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYD----- 199
           FW+   +K GY+  FH          +   K  G  I +K   F ++ K  +D+      
Sbjct: 624 FWEPLLQKHGYKGIFHAKTRAKTMQTKDSKKVDGCCIFYKESEFKVLFKEAVDFSGIWMK 683

Query: 200 ----KEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFE 255
               +     L       NV + + L   K         S     + TTHL W P     
Sbjct: 684 HKNFQRTEDYLNRAMNKDNVAIYMKLQHIK---------SGEVTWIVTTHLHWDPQFNDV 734

Query: 256 RTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNS 298
           +T Q  V+L+ ++  +   + +  K   ++       CGD NS
Sbjct: 735 KTFQVGVLLDHLESLLKEHSNIHSKQDVKK--CPIIICGDLNS 775

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 67.0 bits (162), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 94/218 (43%), Gaps = 24/218 (11%)

Query: 96  FKLMTYNCLAQALIRRKLFP-TSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQS 154
           F L++YN L Q     K++  T   AL W  R   L ++ + Y SD+LCLQEV+   ++ 
Sbjct: 526 FTLLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSYQSDILCLQEVESKTFEE 585

Query: 155 FWKEEFEKLGYESQFH----------RHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSG 204
           FW    EK  Y+  FH          +   K  G  I +K+  F ++ K  +D+    SG
Sbjct: 586 FWSPLLEKYDYQGIFHIKTRAKTMQSKDSKKVDGCCIFFKKSKFKLLFKEAMDF----SG 641

Query: 205 ALEPRTTTKNVGLAIALGFTKKVLAKY----PGSSKRGIIVGTTHLFWHPFGTFERTRQC 260
                   +     +     K  +A Y      +S   + V TTHL W P     +T Q 
Sbjct: 642 TWMKHKKFQRTEDYLNRAMNKDNVALYLKLQSLTSGESVWVVTTHLHWDPKFNDVKTFQV 701

Query: 261 YVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNS 298
            ++L+ M+  +   N  QD    + N+     CGD NS
Sbjct: 702 GILLDHMEALLKEENPKQD--VKKANV---VICGDLNS 734

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 106/237 (44%), Gaps = 41/237 (17%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNE-FMHYNSDVLCLQEVDYIQYQ 153
           F ++TYN L+   +  +++    +  K W  R R+L +E F  Y SD++CLQE+    Y 
Sbjct: 34  FTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDYN 93

Query: 154 SFWKEE-FEKLGYESQFH-----RHGTK----NHGIAIVWKRDMF-------TMVDKMLI 196
            FWK++   ++ Y S F      ++ TK      G+ I +  D F         ++ ++ 
Sbjct: 94  EFWKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLNDLVG 153

Query: 197 DYDKEPSGALEPRTTTKNVGLAIALG-------------FTKKVLAKYPGSSKRGIIVGT 243
            +D++    L     T   G    +G                 V+ ++   SK  I+V  
Sbjct: 154 TFDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLRHR-ESKSIIVVIN 212

Query: 244 THLFWHPFGTFERTR--QCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNS 298
           THL+W     ++  +  QC +++ K++  +  + ++  +G T  N+    F GDFNS
Sbjct: 213 THLYW----KYDEVKLVQCLIIMRKLQRIIKGL-LMGIEGVTYSNV-KILFSGDFNS 263

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 63/280 (22%), Positives = 113/280 (40%), Gaps = 54/280 (19%)

Query: 63  IARGLDPDFPPD----LQFIHRPMLSLNPSENANGFV----FKLMTYNCLAQALIRRKLF 114
           + R L P   P      + I+R +L +     + G      F L+TYN L+   +  +++
Sbjct: 1   MPRRLLPTMAPSKALPARMINRQLLPVYSGSASAGCRSERRFNLLTYNMLSPYYMWPQVY 60

Query: 115 PTSGNALK-WFKRSRVLLNEFMH-YNSDVLCLQEVDYIQYQSFWKEEFE-KLGYESQF-- 169
                  K W  R ++L  E  H Y++D+LCLQE+    Y+ FW+++ + ++ +ESQ+  
Sbjct: 61  TYVPEPFKKWEYRHKLLEYELFHKYHADILCLQELTGKDYEKFWRKQMKRRMNFESQYAQ 120

Query: 170 -------HRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPSGALEPR----------TTT 212
                   R   +  G+   +  D F  V   L +Y  +  G L P             T
Sbjct: 121 KPPPAYWKRSQEEMDGVGTFYNADKFEHVATDL-EYLSDTLGVLTPTEKEWMAQTQVEVT 179

Query: 213 KNVGLAIALGFTKKVLAKY------------PGSSKRGIIVGTTHLFWHPFGTFERTR-- 258
              G  +     K VL +             P  S    +V  T L+W     ++  +  
Sbjct: 180 DATGHVVEKQSLKTVLTQRNQVCLFVTLLHKPTGSL--FVVVNTQLYWK----YDEVKLA 233

Query: 259 QCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNS 298
           QC++++ ++K  + R+   +D   +   +      GD NS
Sbjct: 234 QCFIIMRRLKAIVKRLLTRKDTSYSNIKV---LLSGDLNS 270

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 66/127 (51%), Gaps = 13/127 (10%)

Query: 79  HRPMLSLNP--SENANGFVFKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFM 135
            R ++++N   S + N   F L+TYN L+Q+ +  +++       K W  R ++L  E +
Sbjct: 3   QRKLINVNNTISNSTNLSSFTLLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEIL 62

Query: 136 H-YNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFH-----RHGTKN----HGIAIVWKR 185
             YN+D++CLQE+    Y+ +W+++  K    S F      ++ TK      G+ I +  
Sbjct: 63  KLYNADIICLQELTSRDYEYYWRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFYNL 122

Query: 186 DMFTMVD 192
           DMF ++D
Sbjct: 123 DMFELID 129

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 55/253 (21%), Positives = 102/253 (40%), Gaps = 40/253 (15%)

Query: 78  IHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFM- 135
           I +P  +L  ++N     F  ++YN L+   +  +++       K W  R  +L  E + 
Sbjct: 29  IQQPHQTLPAAKNP---TFTFLSYNMLSPHYMWPQVYTYVPQEYKDWKYRHNLLEKEILD 85

Query: 136 HYNSDVLCLQEVDYIQYQSFWKEEFEK-LGYESQFHRHGTKNH---------GIAIVWKR 185
            Y SD++C+QE+  I Y SFW++   K   Y S+F      N+         G+ I +  
Sbjct: 86  KYRSDIMCVQELTTIDYYSFWRDSLRKGFNYGSRFIAKNPPNYWTKSLVEMDGVGIFYNL 145

Query: 186 DMFTMVDKMLID-------YDKEPSGALEPRTTTKNVG------------LAIALGFTKK 226
           DMF  +    I+       +D++    +  +  T   G            LA++      
Sbjct: 146 DMFDYIGSRSINLNDLASTFDRKELDYMAAKEITILNGNGDVTGKESLYELALSKNQVCL 205

Query: 227 VLAKYPGSSKRGIIVGTTHLFWHPFGTFERTR--QCYVMLNKMKEFMHRINVLQDKGATQ 284
            +      SK   ++  THL+W     +E  +  QC +++ K+ + ++ +    +     
Sbjct: 206 FVMVEHKISKDVFVIINTHLYW----KYEEVKLTQCMIIMRKLAKIVNELLFNAESRDMN 261

Query: 285 ENLWYPFFCGDFN 297
            N     F GD N
Sbjct: 262 YNKVKILFSGDLN 274

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 98/242 (40%), Gaps = 40/242 (16%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YNSDVLCLQEVDYIQYQ 153
           F  MTYN L+   +  +++       K W  R R+L  E ++ Y +D++C+QE+    Y 
Sbjct: 34  FTFMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIMCVQELTCKDYD 93

Query: 154 SFWKEEFE-KLGYESQF---------HRHGTKNHGIAIVWKRDMFTMVDKMLI------- 196
            FWK  F+ K+ Y S F          R   +  G+ I +  D F  +    I       
Sbjct: 94  GFWKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEHISTTSIYLNDLIG 153

Query: 197 -------DYDKE-----PSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTT 244
                  +Y K       +GA EP      + +          ++     ++   +V  T
Sbjct: 154 LFNISELNYLKSTIITLTNGAGEPVDKDSLLNVLHGRNQVSLFVSLMHKETRTLFVVINT 213

Query: 245 HLFWHPFGTFERTR--QCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFD 302
           HL+W     ++  +  QC  ++ K+   +  + ++  +G T   +    F GD NS P D
Sbjct: 214 HLYW----KYDEVKLCQCLTIMRKLHRVIKSL-LMGREGVTYSKVKI-LFAGDLNSAP-D 266

Query: 303 TP 304
           +P
Sbjct: 267 SP 268

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 103/244 (42%), Gaps = 40/244 (16%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YNSDVLCLQEVDYIQYQ 153
           F LMTYN L+   +  +++       K W  R R+L  E ++ Y +D++C+QE+    Y+
Sbjct: 30  FTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQELTCKDYE 89

Query: 154 SFWKEEFE-KLGYESQF---------HRHGTKNHGIAI--------------VWKRDMFT 189
            FWK  F+ K+ Y S +          R   +  G+ I              ++  D+  
Sbjct: 90  GFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTSSIYLNDLIG 149

Query: 190 MVDKMLIDYDKE-----PSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTT 244
           + +   ++Y K       +GA EP      + +          ++     ++   +V  T
Sbjct: 150 LFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLLHKETRTLFVVVNT 209

Query: 245 HLFWHPFGTFERTR--QCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFD 302
           HL+W     ++  +  QC  ++ K+   +  + ++  +G T   +    F GD NS P D
Sbjct: 210 HLYW----KYDEVKLCQCLTIMRKLHRVIKSL-LMGMEGVTYSKV-KILFAGDLNSAP-D 262

Query: 303 TPYL 306
           +P +
Sbjct: 263 SPVI 266

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 93/236 (39%), Gaps = 37/236 (15%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNE-FMHYNSDVLCLQEVDYIQYQ 153
           F L+TYN L+   +  +++       K W  R R+L +E F  Y +D++CLQE+    Y 
Sbjct: 30  FTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQELTTKDYH 89

Query: 154 SFWKEEF-EKLGYESQF---------HRHGTKNHGIAIVWKRDMFTMVDKMLIDYDKEPS 203
           +FW ++  E L Y S F          R   +  G+ I +  D F  +    I Y  +  
Sbjct: 90  NFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSSI-YLNDVL 148

Query: 204 GALEPR----------TTTKNVGLAIALGFTKKVL----------AKYPGSSKRGIIVGT 243
           G    R          T T   G AI       +L          +     +    +V  
Sbjct: 149 GIFNVRELKYMKETMITLTNGAGEAIGKDNLMNILQGRNQVCLFVSLRHKDTNTVFVVIN 208

Query: 244 THLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQ 299
           THL+W       +  QC  ++ K++  +  + ++  +G T   +    F GD NS 
Sbjct: 209 THLYWKYDEV--KLSQCLTIMRKLERIIKSL-LMGVEGVTYSKV-KILFSGDLNSN 260

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 97/234 (41%), Gaps = 35/234 (14%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNE-FMHYNSDVLCLQEVDYIQYQ 153
             ++TYN L+   +  +++    +  K W  R ++L  E F  + +D+LCLQE+    Y 
Sbjct: 30  LSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADILCLQELTTEDYN 89

Query: 154 SFWKEEFE-KLGYESQFHRHGTKNHGIA-----------------------IVWKRDMFT 189
            FW+++ + +L Y S F       +  A                       +++  D  +
Sbjct: 90  QFWRKQMKRRLSYGSNFISKPPPKYWTAGLQEMDGVGTFYNTEKLEFISSTVIYLNDFLS 149

Query: 190 MVDKMLIDY-----DKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTT 244
           M  K  +D+       + +GA +P TT   + + +        +      +K  I+V  T
Sbjct: 150 MFSKRELDWMSRRQITQTNGANDPVTTRSLLSILLDRNQVCLFVCLREKDTKSLIVVVNT 209

Query: 245 HLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNS 298
           HL+W       +  QC  ++ K+K+ ++++    + G T   +      GD NS
Sbjct: 210 HLYWKYDEV--KLSQCLTIMRKLKQVINKLTTTLE-GVTYSQI-KIILGGDLNS 259

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 93/234 (39%), Gaps = 35/234 (14%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFM-HYNSDVLCLQEVDYIQYQ 153
           F L+TYN L+ A +  +++       K W  R  +L  E +  Y +D++C+QE+    YQ
Sbjct: 39  FTLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKADIMCIQEMTKRDYQ 98

Query: 154 SFWK----------EEFEKLGYESQFHRHGTKNHGIAIVWKRDMFTMV-------DKMLI 196
            FW            EF        + R   +  G+AI + R MF  V       ++ML 
Sbjct: 99  QFWSPIASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVSSKGIYLNQMLD 158

Query: 197 DYDKE------------PSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTT 244
            ++                GA  P   T  +            ++    S+    +V  T
Sbjct: 159 AFNDHELEYLGQKKLGLTDGAGNPTGETNLLNFLKLKNQVSLFVSLQHKSTGMYFVVINT 218

Query: 245 HLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNS 298
           HL+W  +   + T QC V++ ++ + +   ++L+D     +      F GD NS
Sbjct: 219 HLYWK-YDEVKLT-QCMVIMRELSQIID--DLLKDVPDVTKEKVKIIFTGDLNS 268

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 54/243 (22%), Positives = 98/243 (40%), Gaps = 53/243 (21%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YNSDVLCLQEVDYIQYQ 153
           F  MTYN L+   +  +++    +  K W  R ++L  E ++ Y +D++CLQE+    Y 
Sbjct: 29  FTFMTYNMLSPHYMWPQVYTYVPDEYKDWNYRHKLLEKEILNSYRADIMCLQELTASDYH 88

Query: 154 SFWKEEFEK-LGYESQF---------HRHGTKNHGIAIVWKRDMFTMVDKM--------- 194
            +W+E  ++   Y S+F          +      G+ I +  + F  +            
Sbjct: 89  QYWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDYISSTSIHLNDLIG 148

Query: 195 ----------------LIDYDKEPSG---ALEPRTTTKNVGLAIALGFTKKVLAKYPGSS 235
                           L D    P G    LE   +   VGL +AL        K+  ++
Sbjct: 149 SFDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQVGLFVAL--------KHKDTN 200

Query: 236 KRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGD 295
              +++  THL+W  +   + T QC +++ K+ + +   ++L  +  T  N     F GD
Sbjct: 201 TIFVVIN-THLYW-KYDEVKLT-QCLIIMRKLAKIIR--DLLVGEHGTTYNKMKVVFAGD 255

Query: 296 FNS 298
            NS
Sbjct: 256 LNS 258

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 57/246 (23%), Positives = 98/246 (39%), Gaps = 54/246 (21%)

Query: 93  GFVFKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YNSDVLCLQEVDYI 150
           G  F L+TYN L+   +  +++    +  K W  R  +L +E +  Y +DV+CLQE+ + 
Sbjct: 34  GHKFTLLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLEDELLRTYKADVMCLQELTWE 93

Query: 151 QYQSFWKEEFEK-LGYESQF---------HRHGTKNHGIAIVWKRDMFTMVDKM------ 194
            Y S+WK  F K L Y S+F          +   +  G  I +  D F  +         
Sbjct: 94  DYLSYWKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGIFFNLDKFEYISSTRLFLND 153

Query: 195 -------------------LIDYDKEPSGALEPRTTTKN---VGLAIALGFTKKVLAKYP 232
                              L D    P G        KN   V L ++L   +       
Sbjct: 154 VVNTFEEHELNYMKRKIVKLTDGAGNPVGEETLYEILKNRNQVCLFVSLKHKE------- 206

Query: 233 GSSKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFF 292
             +    +V  THL+W  +   + T QC +++ K+ + ++ + +  D   +++ +   F 
Sbjct: 207 --TNNVFVVINTHLYWK-YDEVKLT-QCMIIMRKLSQIINELLIGADPSLSKDVI---FI 259

Query: 293 CGDFNS 298
            GD NS
Sbjct: 260 TGDLNS 265

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/239 (22%), Positives = 104/239 (43%), Gaps = 39/239 (16%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YNSDVLCLQEVDYIQYQ 153
           F ++TYN L+   +  +++    +  K W  R ++L  E M  Y +D++CLQE+ +  Y 
Sbjct: 48  FTMLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDYI 107

Query: 154 SFWKEEF-EKLGYESQF-------HRHGTKNH--GIAIVWKRDMFTMV------------ 191
           S+WK +  EK+ Y S+F       +   TK    G  I + ++ F  +            
Sbjct: 108 SYWKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTKLFLNDVVG 167

Query: 192 --DKMLIDYDKE-----PSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTT 244
             ++  I+Y K+       GA +P  T     +A         ++    ++    +V  T
Sbjct: 168 TFEEHEIEYMKKKIVTLTDGAGKPTGTNNLFTVATTRNQVCLFVSLRHKATNTVFVVINT 227

Query: 245 HLFWHPFGTFERTRQCYVMLNKMKEFMHRINV-----LQDKGATQENLWYPFFCGDFNS 298
           HL+W  +   + T QC +++ K+   ++ + +     + D     +++    F GD NS
Sbjct: 228 HLYWK-YDEVKLT-QCMIIMRKLSHIINELLIGSNAKIVDNSTISKDV-KIIFSGDLNS 283

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/249 (21%), Positives = 101/249 (40%), Gaps = 42/249 (16%)

Query: 85  LNPSENANGFV---FKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFM-HYNS 139
           L+ S NA+  +   F L+TYN L+ + +  +++    +  K W  R ++L +E +  Y +
Sbjct: 16  LSASRNASKLINDKFTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKA 75

Query: 140 DVLCLQEVDYIQYQSFWKEEF-EKLGYESQF---------HRHGTKNHGIAIVWKRDMFT 189
           D++CLQE+    Y   WK      +GY S+F          R   +  G+ I +    F 
Sbjct: 76  DIMCLQEMTSRDYNENWKRLLGSGIGYGSKFIAKSPPLYWEREVDEIDGVGIFYNLKKFD 135

Query: 190 MV-------DKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGI--- 239
            +       ++ L  +       L  +      G  + +G  K +L    G ++  +   
Sbjct: 136 FISSSGIYLNQFLNVFSSTELEYLHSKRLVLTDGAGVPIG-EKNLLDVISGKNQVCLFVS 194

Query: 240 ----------IVGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWY 289
                     +V  THL+W  +   + T QC +++ ++ + +  +     KG        
Sbjct: 195 LKHKETGEMFVVINTHLYWK-YDEVKLT-QCMIIMRELSKIIDELV----KGVDDPGKVK 248

Query: 290 PFFCGDFNS 298
             F GD NS
Sbjct: 249 ILFTGDLNS 257

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 54/249 (21%), Positives = 101/249 (40%), Gaps = 45/249 (18%)

Query: 86  NPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFM-HYNSDVLC 143
           N  +N+   +F L++YN L+ + +  +++       K W  R ++L  E +  Y +D++C
Sbjct: 12  NVLKNSAKPLFTLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMC 71

Query: 144 LQEVDYIQYQSFWKEEFE-KLGYESQF---------HRHGTKNHGIAIVWKRDMFTMV-- 191
           LQE+    Y +FWK+  +  + Y S +          R   +  G+ I +  D F  +  
Sbjct: 72  LQELTSEDYSNFWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFEFISR 131

Query: 192 -----DKMLIDYDKEPSGALEPRTTTKNVGLAIALG--------FTKKVLAKYPG----S 234
                +++L  +       LE +  T   G    +G         +K  +A +       
Sbjct: 132 SGIYLNQLLGVFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVALFVSLKHKE 191

Query: 235 SKRGIIVGTTHLFWHPFGTFERTRQCYVMLNKMKEFM--HRI---NVLQDKGATQENLWY 289
           +    +V  THL+W       +  QC +++ ++   +  H +   NV  DK         
Sbjct: 192 TGNVFVVINTHLYWKYDDV--KLTQCMIIMRELARIIEKHLVGLENVTDDKIKI------ 243

Query: 290 PFFCGDFNS 298
             F GD NS
Sbjct: 244 -LFTGDLNS 251

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/235 (21%), Positives = 100/235 (42%), Gaps = 40/235 (17%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFM-HYNSDVLCLQEVDYIQYQ 153
           F +++YN L+ + +  +++    +  K W  R  +L  E +  Y +D++C+QE+    Y 
Sbjct: 30  FTVLSYNMLSPSYMWPQVYTYVPDQYKDWNYRHTLLELELLDKYKADIMCVQEMTKRDYI 89

Query: 154 SFWKEEF-EKLGYESQF---------HRHGTKNHGIAIVWKRDMFTMV-------DKMLI 196
            +W+ +    +GY S+F          RH     G+AI +    F  +       ++ L 
Sbjct: 90  DYWQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQKFDFISSSGIYLNEFLD 149

Query: 197 DYDKEPSGALEPRTTTKNVGLAIALG-------------FTKKVLAKYPGSSKRGIIVGT 243
            ++ E    L+ +T     G  I +               +  V  K+  + +  II+  
Sbjct: 150 VFNPEELQYLKEKTLELTDGAGIKIDEKTLFEILSVKNQVSLFVCLKHKETGQVFIIIN- 208

Query: 244 THLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNS 298
           THL+W       +  QC +++ ++ + +  +  LQD   ++  +    F GD NS
Sbjct: 209 THLYWKYDEV--KLSQCIIIMRELSKIIDEL--LQDVRHSKVKI---IFAGDLNS 256

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/242 (20%), Positives = 103/242 (42%), Gaps = 41/242 (16%)

Query: 91  ANGFVFKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YNSDVLCLQEVD 148
           +N     ++TYN L+   +  +++    +  K W  R ++L  E +  Y +D++CLQE+ 
Sbjct: 17  SNPAKLSVLTYNMLSPYYMWPQVYTYVPDEYKKWNYRHKLLQKEILGLYRADIMCLQELT 76

Query: 149 YIQYQSFW-KEEFEKLGYESQF---------HRHGTKNHGIAIVWKRDMFTMVDKMLI-- 196
            + YQ +W K   EK  Y S++          R  ++  G+ + +  + F  +    I  
Sbjct: 77  SLDYQQYWNKVLMEKYNYGSKYIAKPPPKYWERSLSEMDGVGVFYDLNKFDYISSTGIYL 136

Query: 197 -----DYDKEPSGALEPRTTTKNVG---------LAIALGFTKKV---LAKYPGSSKRGI 239
                 +D +    LE +      G         L+  L    +V   ++    ++   +
Sbjct: 137 NDLFGTFDLKEQNYLEHKMLQLTDGQGNPMEKMTLSDVLKGRNQVCMFVSLRHKATNTFL 196

Query: 240 IVGTTHLFWHPFGTFERTR--QCYVMLNKMKEFMHRINV-LQDKGATQENLWYPFFCGDF 296
           IV  THL+W     ++  +  QC +++ ++ + +  + + +QD    +  +    F GD 
Sbjct: 197 IVINTHLYW----KYDEVKLAQCMIIMRRLSKIIKDLLIGVQDTTYNKVKI---IFAGDM 249

Query: 297 NS 298
           NS
Sbjct: 250 NS 251

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 47/235 (20%), Positives = 100/235 (42%), Gaps = 38/235 (16%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YNSDVLCLQEVDYIQYQ 153
           F L+TYN L+ + +  +++       K W  R R+L  E ++ + +D++CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCLQEMTARDYE 86

Query: 154 SFWKEEF-EKLGYESQFHRHGTKNH---------GIAIVWKRDMFTMV-------DKMLI 196
            +W +     + Y S+F       +         G++I +    F  +       +++L 
Sbjct: 87  DYWHDSIGVDVNYGSKFISKTPPKYWKKPVKDMDGVSIFYNLAKFDFISSSGIYLNQLLN 146

Query: 197 DYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGI-------------IVGT 243
            +++     L  +  T   G +  +G    +L    G ++  +             +V  
Sbjct: 147 VFNQRELKYLYNKKVTLTDGASNVIG-EDSLLDVLKGKNQVCLFVSLRHKETGTIFVVLN 205

Query: 244 THLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNS 298
           THL+W  +   + T QC +++ ++ + + ++     KG  +  +    F GD NS
Sbjct: 206 THLYWK-YDEVKLT-QCMIIMRELSKIIKQLLPGDVKGQERVKI---LFTGDLNS 255

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 46/235 (19%), Positives = 100/235 (42%), Gaps = 38/235 (16%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YNSDVLCLQEVDYIQYQ 153
           F L+TYN L+ + +  +++       K W  R ++L  E ++ + +D++CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLEKELLNSFKADIMCLQEMTRRDYE 86

Query: 154 SFWKEEF-EKLGYESQFHRHGTKNH---------GIAIVWKRDMFTMV-------DKMLI 196
            +W +     + Y S+F       +         G++I +  D F  +       +++L 
Sbjct: 87  DYWHDSIGVNINYGSKFISKTPPKYWKKPLEDMDGVSIFYNLDKFDFISSSGIYLNQLLN 146

Query: 197 DYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGI-------------IVGT 243
            +++     L  +      G +  +G    +L    G ++  +             +V  
Sbjct: 147 VFNERELKYLYNKRVILTDGASNVVG-EDSLLDVLKGKNQVCLFVSLKHKETDTIFVVLN 205

Query: 244 THLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNS 298
           THL+W  +   + T QC +++ ++ + + ++     KG  +  +    F GD NS
Sbjct: 206 THLYW-KYDEVKLT-QCMIIMRELSKIIEQLLPGDAKGRGKVKI---LFTGDLNS 255

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YNSDVLCLQEVDYIQYQ 153
           F L+TYN L+ + +  +++       K W  R ++L  E ++ + +D++CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFKADIMCLQEMTARDYE 86

Query: 154 SFWKEEF-EKLGYESQF 169
            +W++     + Y S+F
Sbjct: 87  DYWRDYIGVDINYGSKF 103

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 37.4 bits (85), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 47/235 (20%), Positives = 100/235 (42%), Gaps = 38/235 (16%)

Query: 96  FKLMTYNCLAQALIRRKLFPTSGNALK-WFKRSRVLLNEFMH-YNSDVLCLQEVDYIQYQ 153
           F L+TYN L+ + +  +++       K W  R ++L  E +  + +D++CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCLQEMTTRDYE 86

Query: 154 SFWKEEF-EKLGYESQFHRHGTKNH---------GIAIVWKRDMFTMV-------DKMLI 196
           ++W       + Y S+F       +         G++I +  + F  +       +++L 
Sbjct: 87  NYWHNSIGVDINYGSKFISKTPPKYWEKPVKDMDGVSIFYNLEKFDYISSSGIYLNQLLN 146

Query: 197 DYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGI-------------IVGT 243
            +++     L  +  T   G +  +G    +L    G ++  +             +V  
Sbjct: 147 VFNERELKYLYNKKVTLTDGASNVIG-EDSLLDVLKGKNQVCLFVSLKHKETNTIFVVLN 205

Query: 244 THLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNS 298
           THL+W  +   + T QC +++ ++ + + ++  L      QE +    F GD NS
Sbjct: 206 THLYW-KYDEVKLT-QCMIIMRELSKIIKQL--LPGDANAQEKV-KILFTGDLNS 255

>CAGL0I04708g Chr9 (422462..423145) [684 bp, 227 aa] {ON} highly
           similar to uniprot|P38075 Saccharomyces cerevisiae
           YBR035c PDX3
          Length = 227

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 32/71 (45%), Gaps = 8/71 (11%)

Query: 348 IEKFGDGQ--PEHPVPEK--FSATEEQKGLVESMASLHNSLDMRGISIYS----VGYKHV 399
           +E F D +  P   +PE   FS+ E   G V S   L   LD RG +IYS     G  H 
Sbjct: 39  VEWFDDAKNDPRETLPEAITFSSAELPSGRVSSRVLLFKELDHRGFTIYSNWKTSGKAHD 98

Query: 400 HAENAGLDNNF 410
            A N  +  NF
Sbjct: 99  IATNPNVAINF 109

>Skud_10.354 Chr10 (626154..627809) [1656 bp, 551 aa] {ON} YJR131W
           (REAL)
          Length = 551

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 255 ERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFD 302
           E T  CY M N+    +    V+ ++G T++N W+    GDF  +P D
Sbjct: 382 ELTHTCYQMYNQTPSGLAPEIVVFNEGNTEQNGWWQSSSGDFFVKPLD 429

>Suva_9.189 Chr9 complement(313656..313979) [324 bp, 107 aa] {ON}
           YIL014C-A (REAL)
          Length = 107

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 12/63 (19%), Positives = 26/63 (41%)

Query: 94  FVFKLMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQ 153
           ++  +   + + + L+  KL PT  NA +W        ++F +      C +  D   + 
Sbjct: 43  YILNVSAIDGIMETLVETKLVPTLENATQWVSDMSAYWSQFEYGEEPTYCPKSFDLNDFY 102

Query: 154 SFW 156
            +W
Sbjct: 103 EYW 105

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,110,215
Number of extensions: 2181456
Number of successful extensions: 4664
Number of sequences better than 10.0: 75
Number of HSP's gapped: 4617
Number of HSP's successfully gapped: 75
Length of query: 495
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 381
Effective length of database: 40,409,475
Effective search space: 15396009975
Effective search space used: 15396009975
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)