Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0B05192gna 1ON1391397511e-104
Kwal_33.14763na 1ON1211101576e-14
KAFR0G012401.31ON55889710.38
TDEL0C005908.34ON160234619.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0B05192g
         (139 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0B05192g Chr2 complement(429511..429930) [420 bp, 139 aa] {O...   293   e-104
Kwal_33.14763 s33 (809470..809835) [366 bp, 121 aa] {ON} [contig...    65   6e-14
KAFR0G01240 Chr7 complement(280112..281788) [1677 bp, 558 aa] {O...    32   0.38 
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    28   9.5  

>KLTH0B05192g Chr2 complement(429511..429930) [420 bp, 139 aa] {ON}
           conserved hypothetical protein
          Length = 139

 Score =  293 bits (751), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 139/139 (100%), Positives = 139/139 (100%)

Query: 1   MSFELQILNDVLDWARAPGGPAGDYIHPSHVSLWSYPREKAFQVHEGNNNPSSARYGFDS 60
           MSFELQILNDVLDWARAPGGPAGDYIHPSHVSLWSYPREKAFQVHEGNNNPSSARYGFDS
Sbjct: 1   MSFELQILNDVLDWARAPGGPAGDYIHPSHVSLWSYPREKAFQVHEGNNNPSSARYGFDS 60

Query: 61  PYGGLVTLESLYKERVDSSGKNYKIESGTSVENFTRKRKFEASAEDDFFHLQKDIGVRER 120
           PYGGLVTLESLYKERVDSSGKNYKIESGTSVENFTRKRKFEASAEDDFFHLQKDIGVRER
Sbjct: 61  PYGGLVTLESLYKERVDSSGKNYKIESGTSVENFTRKRKFEASAEDDFFHLQKDIGVRER 120

Query: 121 SFKKPRGYACKNCCMYSHI 139
           SFKKPRGYACKNCCMYSHI
Sbjct: 121 SFKKPRGYACKNCCMYSHI 139

>Kwal_33.14763 s33 (809470..809835) [366 bp, 121 aa] {ON} [contig
           101] FULL
          Length = 121

 Score = 65.1 bits (157), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 60/110 (54%), Gaps = 6/110 (5%)

Query: 1   MSFELQILNDVLDWARAPGGPAGDY-IHPSHVSLWSYPREKAFQVHEGNNNPSSARYGFD 59
           MSF+L+ +N+VL+WA   G  A    +   H  LW+YP E      E N +PSS  Y F 
Sbjct: 1   MSFQLETMNEVLEWAVGHGEHASSTGLCRGH--LWAYPPEINKNSFEKNESPSSTLYNFV 58

Query: 60  SPYGGLVTLESLYKERVDSSGKNYKIESGT-SVENFTRKRKFEASAEDDF 108
           SP+GGLVTL  LY+   D   +    +S T S+ N +RKR ++   + D 
Sbjct: 59  SPHGGLVTLSHLYEMNEDD--EEITDDSSTDSIVNISRKRIYDNDQDTDL 106

>KAFR0G01240 Chr7 complement(280112..281788) [1677 bp, 558 aa] {ON}
           Anc_1.31 YDR518W
          Length = 558

 Score = 32.0 bits (71), Expect = 0.38,   Method: Composition-based stats.
 Identities = 22/89 (24%), Positives = 39/89 (43%), Gaps = 10/89 (11%)

Query: 29  SHVSLWSYPREKAFQVHEGNNNPSSARYGFDSPYGGLVTLESLYKERVD-SSGKNYKIES 87
           SH+++  YP  K  + H   N P          Y G  T++++ +  +D ++   +KIES
Sbjct: 106 SHLTIEKYPTLKVIKKHRLGNTPE---------YTGTRTVDAIVQFMLDQTTSAVHKIES 156

Query: 88  GTSVENFTRKRKFEASAEDDFFHLQKDIG 116
              +EN+ +  K      +    L K  G
Sbjct: 157 DEEMENYLQDVKLPVVVNNGLSELSKVFG 185

>TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON}
           Anc_8.34 YFL033C
          Length = 1602

 Score = 28.1 bits (61), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 17/34 (50%)

Query: 30  HVSLWSYPREKAFQVHEGNNNPSSARYGFDSPYG 63
           H+ L  +   +A  V    N PSSAR  F S YG
Sbjct: 832 HIKLTDFGLSRAGLVRRHQNVPSSARLSFSSTYG 865

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.418 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,909,882
Number of extensions: 724044
Number of successful extensions: 1907
Number of sequences better than 10.0: 9
Number of HSP's gapped: 1905
Number of HSP's successfully gapped: 9
Length of query: 139
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 41
Effective length of database: 42,244,131
Effective search space: 1732009371
Effective search space used: 1732009371
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 60 (27.7 bits)