Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0B01188g5.122ON59359331870.0
Kwal_33.155405.122ON56456426510.0
TDEL0E050805.122ON56356325260.0
ACL134C5.122ON58656325120.0
NDAI0C031105.122ON56456225120.0
KLLA0E16303g5.122ON56356325000.0
NCAS0D016605.122ON56456224970.0
Kpol_1010.485.122ON56356224930.0
CAGL0M07920g5.122ON56456224910.0
Skud_12.1105.122ON56356224890.0
SAKL0G14894g5.122ON56456224850.0
Suva_10.1285.122ON56356224850.0
YLR044C (PDC1)5.122ON56356224840.0
Smik_12.1065.122ON56356224800.0
SAKL0G10164gna 1ON56456224790.0
ZYRO0F01606g5.122ON56356224560.0
TPHA0H009505.122ON56356224490.0
NDAI0A01400na 2ON56356224400.0
Suva_10.227na 3ON56356224320.0
Skud_12.203na 3ON56356224280.0
TPHA0Q00120singletonON56356224250.0
TBLA0B075205.122ON56356224190.0
Ecym_24795.122ON56456224160.0
NCAS0A14630na 2ON56356324010.0
KAFR0E020205.122ON56456223990.0
AAL073Wna 1ON56356223970.0
YLR134W (PDC5)na 3ON56356223960.0
Smik_12.197na 3ON56356223850.0
Suva_7.369na 4ON56356223800.0
SAKL0F04334gsingletonON56456223790.0
TBLA0B10060singletonON56456223640.0
NDAI0A02510singletonON56356223480.0
YGR087C (PDC6)na 4ON56356223360.0
KLTH0D08272gsingletonON56356323350.0
KNAG0J01330singletonON56456223290.0
KAFR0E01520singletonON56356223270.0
TBLA0D02840singletonON56356223230.0
TBLA0E03070singletonON56356122970.0
KNAG0M012505.122ON56356222940.0
NCAS0A14240singletonON56556522890.0
KNAG0J01340singletonON56556522650.0
NDAI0D03270singletonON52152122170.0
Ecym_3185na 1ON56356220870.0
CAGL0G02937gna 4ON56456420870.0
SAKL0E04972g2.390ON61155919290.0
ZYRO0A08426g2.390ON58454616700.0
KLTH0E09702g2.390ON60755116530.0
Kwal_47.178782.390ON61055116320.0
YDL080C (THI3)2.390ON60955616140.0
Suva_4.1672.390ON62055616050.0
TDEL0G032102.390ON60656816030.0
KNAG0A059002.390ON62057915710.0
Skud_4.1752.390ON62055615690.0
Smik_4.1562.390ON62155615660.0
TPHA0G026202.390ON68859315470.0
NCAS0A040002.390ON62557415410.0
CAGL0L06842g2.390ON63858215390.0
NDAI0E017002.390ON62156415150.0
KAFR0F029902.390ON60855815090.0
TBLA0B088202.390ON63558714860.0
Ecym_60552.390ON59256113980.0
ADR254W2.390ON58155313640.0
Kpol_1046.92.390ON59856211831e-155
KLLA0F16962g2.390ON5785559071e-114
SAKL0G03036g5.456ON6376009041e-113
CAGL0A03102g5.456ON6496108871e-110
NCAS0A118305.456ON6376108551e-106
KAFR0E037305.456ON6356208441e-104
YDR380W (ARO10)5.456ON6356178401e-103
Skud_4.6515.456ON6356188291e-102
Suva_2.5545.456ON6356288241e-101
Smik_4.6495.456ON6356198191e-100
KLTH0F15510g5.456ON6256068161e-100
Kpol_1062.125.456ON6305948061e-98
ACR211W5.456ON6296088033e-98
ZYRO0G04378g5.456ON6136197997e-98
TBLA0A026705.456ON6406198001e-97
Kpol_440.45.456ON6366007912e-96
TPHA0J026805.456ON6486277782e-94
KNAG0C047905.456ON6376007764e-94
TDEL0D024505.456ON6756097776e-94
TBLA0A064205.456ON6386137617e-92
KLLA0E02707g5.456ON6315977554e-91
SAKL0D00220gsingletonON5775877436e-90
TPHA0E016005.456ON6516027278e-87
KLTH0D00418gsingletonON5615656772e-80
TDEL0C07020singletonON5605676613e-78
TDEL0F00150singletonON5605696605e-78
NDAI0A044505.456ON5615596362e-74
Skud_7.383na 4ON86921913e-17
YMR108W (ILV2)2.441ON6875122021e-15
CAGL0K03465g2.441ON6775221922e-14
Smik_13.2972.441ON6875121913e-14
TBLA0I014002.441ON7105241903e-14
KAFR0A005702.441ON6825271903e-14
TDEL0B055201.450ON5554901894e-14
KLLA0B12584g2.441ON6915231877e-14
NDAI0H023802.441ON6853201868e-14
TPHA0G024402.441ON6915151814e-13
NCAS0G039601.450ON5775131796e-13
NCAS0F015002.441ON6845271771e-12
TPHA0G028852.441ON6883281771e-12
Skud_13.2672.441ON6875131752e-12
Suva_13.2872.441ON6875141752e-12
NCAS0A043202.441ON6895141752e-12
Kpol_297.122.441ON6715271742e-12
ZYRO0E03454g1.450ON5494911733e-12
ZYRO0G19954g2.441ON7005321724e-12
SAKL0E03740g2.441ON6793111699e-12
TPHA0B039401.450ON5755331672e-11
KNAG0E023602.441ON6933521672e-11
NDAI0E020502.441ON6905121653e-11
Ecym_13601.450ON5445011643e-11
KNAG0A062502.441ON6803221644e-11
TDEL0A021602.441ON6825291636e-11
Kwal_26.75822.441ON6793011592e-10
AEL305C2.441ON6685161572e-10
Skud_5.761.450ON5604921554e-10
Ecym_61072.441ON6895251555e-10
KLTH0D04532g2.441ON6783011537e-10
YEL020C1.450ON5605111465e-09
SAKL0D10934g1.450ON5503331449e-09
AEL055C1.450ON5454781431e-08
KNAG0H015801.450ON5605131412e-08
Smik_5.871.450ON5604981402e-08
Kpol_1061.501.450ON5715021323e-07
Kwal_34.161161.450ON5535081224e-06
KLTH0H14102g1.450ON5515141224e-06
Suva_5.681.450ON5615021152e-05
KAFR0H028901.450ON560299970.004
NDAI0G005201.450ON575349870.058
CAGL0M03245g1.450ON562284860.089
Smik_10.1291.253ON1769112761.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0B01188g
         (593 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {...  1232   0.0  
Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR0...  1025   0.0  
TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.1...   977   0.0  
ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON} S...   972   0.0  
NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122    972   0.0  
KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]...   967   0.0  
NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {O...   966   0.0  
Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON} (1109...   964   0.0  
CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa] ...   964   0.0  
Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {...   963   0.0  
SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON} unip...   961   0.0  
Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {...   961   0.0  
YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON} ...   961   0.0  
Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {...   959   0.0  
SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {...   959   0.0  
ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {...   950   0.0  
TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.1...   947   0.0  
NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON}              944   0.0  
Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134...   941   0.0  
Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134...   939   0.0  
TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON}      938   0.0  
TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa] ...   936   0.0  
Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar t...   935   0.0  
NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa] ...   929   0.0  
KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.1...   928   0.0  
AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-synteni...   927   0.0  
YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor...   927   0.0  
Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134...   923   0.0  
Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON...   921   0.0  
SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {...   920   0.0  
TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa] ...   915   0.0  
NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {O...   909   0.0  
YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}  ...   904   0.0  
KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {...   904   0.0  
KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {...   901   0.0  
KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {O...   900   0.0  
TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {O...   899   0.0  
TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON}              889   0.0  
KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {...   888   0.0  
NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON}            886   0.0  
KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {...   877   0.0  
NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON}              858   0.0  
Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar t...   808   0.0  
CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {...   808   0.0  
SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} simila...   747   0.0  
ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {...   647   0.0  
KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} simila...   641   0.0  
Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080...   633   0.0  
YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}  ...   626   0.0  
Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON...   622   0.0  
TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {O...   622   0.0  
KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {O...   609   0.0  
Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON...   608   0.0  
Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON...   607   0.0  
TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {O...   600   0.0  
NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {O...   598   0.0  
CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} simil...   597   0.0  
NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390    588   0.0  
KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {O...   585   0.0  
TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON} Anc_2...   577   0.0  
Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}...   543   0.0  
ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic ...   530   0.0  
Kpol_1046.9 s1046 (18301..18855,18984..18992,19556..19693,19697....   460   e-155
KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]...   353   e-114
SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} simila...   352   e-113
CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} simila...   346   e-110
NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON} Anc_5...   333   e-106
KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {O...   329   e-104
YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}  ARO10Phe...   328   e-103
Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380...   323   e-102
Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W ...   322   e-101
Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380...   320   e-100
KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]...   318   e-100
Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {O...   315   1e-98
ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic ho...   313   3e-98
ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {...   312   7e-98
TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {O...   312   1e-97
Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..1137...   309   2e-96
TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5....   304   2e-94
KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {O...   303   4e-94
TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {O...   303   6e-94
TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa] ...   297   7e-92
KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} simila...   295   4e-91
SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON...   290   6e-90
TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {O...   284   8e-87
KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON...   265   2e-80
TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa] ...   259   3e-78
TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON}                258   5e-78
NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa] ...   249   2e-74
Skud_7.383 Chr7 complement(638760..638846,638850..638882,638886....    78   3e-17
YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}  ILV2Aceto...    82   1e-15
CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highl...    79   2e-14
Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108...    78   3e-14
TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.4...    78   3e-14
KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {O...    78   3e-14
TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {O...    77   4e-14
KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]...    77   7e-14
NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441     76   8e-14
TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {O...    74   4e-13
NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.4...    74   6e-13
NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.4...    73   1e-12
TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}     73   1e-12
Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108...    72   2e-12
Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108...    72   2e-12
NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {O...    72   2e-12
Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}...    72   2e-12
ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {...    71   3e-12
ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} high...    71   4e-12
SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly...    70   9e-12
TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.4...    69   2e-11
KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {O...    69   2e-11
NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {O...    68   3e-11
Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar t...    68   3e-11
KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {O...    68   4e-11
TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {O...    67   6e-11
Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W...    66   2e-10
AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON} Syn...    65   2e-10
Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}...    64   4e-10
Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}...    64   5e-10
KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly...    64   7e-10
YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON} P...    61   5e-09
SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} simila...    60   9e-09
AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON} S...    60   1e-08
KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {O...    59   2e-08
Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}...    59   2e-08
Kpol_1061.50 s1061 (141784..143499) [1716 bp, 571 aa] {ON} (1417...    55   3e-07
Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {...    52   4e-06
KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} simi...    52   4e-06
Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C (...    49   2e-05
KAFR0H02890 Chr8 complement(551945..553627) [1683 bp, 560 aa] {O...    42   0.004
NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {O...    38   0.058
CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa] ...    38   0.089
Smik_10.129 Chr10 complement(203537..208846) [5310 bp, 1769 aa] ...    34   1.6  

>KLTH0B01188g Chr2 complement(104224..106005) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 593

 Score = 1232 bits (3187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 593/593 (100%), Positives = 593/593 (100%)

Query: 1   MSDLILYCDFYKTRNLNSNRVSQNKPEITMSEITLGRYVFERLKQVDVTTVFGLPGDFNL 60
           MSDLILYCDFYKTRNLNSNRVSQNKPEITMSEITLGRYVFERLKQVDVTTVFGLPGDFNL
Sbjct: 1   MSDLILYCDFYKTRNLNSNRVSQNKPEITMSEITLGRYVFERLKQVDVTTVFGLPGDFNL 60

Query: 61  RLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGMSCLITTFGVGELSALNGIAGSYAE 120
           RLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGMSCLITTFGVGELSALNGIAGSYAE
Sbjct: 61  RLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGMSCLITTFGVGELSALNGIAGSYAE 120

Query: 121 HVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDR 180
           HVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDR
Sbjct: 121 HVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDR 180

Query: 181 CIRTTYIRQRPVYLGLPSNFVDQMVPASLLDTPIDLALKPNDQQAEEEVISTLLEMIKDA 240
           CIRTTYIRQRPVYLGLPSNFVDQMVPASLLDTPIDLALKPNDQQAEEEVISTLLEMIKDA
Sbjct: 181 CIRTTYIRQRPVYLGLPSNFVDQMVPASLLDTPIDLALKPNDQQAEEEVISTLLEMIKDA 240

Query: 241 KNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPA 300
           KNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPA
Sbjct: 241 KNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPA 300

Query: 301 VKEAVESADLVLSVGALLSDFNTGSFSYSYKTKNVVEFHSDHIKIRNATFPGVQMKFVLQ 360
           VKEAVESADLVLSVGALLSDFNTGSFSYSYKTKNVVEFHSDHIKIRNATFPGVQMKFVLQ
Sbjct: 301 VKEAVESADLVLSVGALLSDFNTGSFSYSYKTKNVVEFHSDHIKIRNATFPGVQMKFVLQ 360

Query: 361 SLLNKVGAVVKDYKPVPVPELPAPNAAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTS 420
           SLLNKVGAVVKDYKPVPVPELPAPNAAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTS
Sbjct: 361 SLLNKVGAVVKDYKPVPVPELPAPNAAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTS 420

Query: 421 AFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTA 480
           AFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTA
Sbjct: 421 AFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTA 480

Query: 481 QEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYNEIQNWNHLDLLPTFGAKDYEAIR 540
           QEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYNEIQNWNHLDLLPTFGAKDYEAIR
Sbjct: 481 QEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYNEIQNWNHLDLLPTFGAKDYEAIR 540

Query: 541 VSTTGEWNKLAEDKDFNKNSKIRLIELMLPVMDAPESLVKQAQLTAATNAKSA 593
           VSTTGEWNKLAEDKDFNKNSKIRLIELMLPVMDAPESLVKQAQLTAATNAKSA
Sbjct: 541 VSTTGEWNKLAEDKDFNKNSKIRLIELMLPVMDAPESLVKQAQLTAATNAKSA 593

>Kwal_33.15540 s33 (1147974..1149668) [1695 bp, 564 aa] {ON} YLR044C
           (PDC1) - pyruvate decarboxylase [contig 290] FULL
          Length = 564

 Score = 1025 bits (2651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/564 (88%), Positives = 540/564 (95%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLGRY+FERL+QV+  T+FGLPGDFNLRLLDEIYE EGMRWAGN NELNA+YAADA
Sbjct: 1   MSEITLGRYLFERLRQVECNTIFGLPGDFNLRLLDEIYETEGMRWAGNANELNAAYAADA 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAMI+DLATAP+EIDRCIRTTY+RQRPVYLGLPSNFVDQMVPASL
Sbjct: 121 DFTVFHRMSANISETTAMISDLATAPAEIDRCIRTTYVRQRPVYLGLPSNFVDQMVPASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL+LKPND  AE+EV+ST+L++IK+AKNPVILADACASRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDLSLKPNDAAAEQEVVSTVLDLIKNAKNPVILADACASRHDVKAETKKLIDVTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVES+DL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSDHIKIRNATFPGVQMKFVLQ LL +VG VVKDYKPV +PE+P PNAAVD
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTQVGDVVKDYKPVAIPEIPGPNAAVD 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            STPLKQQWLWNQVG+FLQEGD+V+TETGTSAFGINQTHFPNNTYGISQVLWGSIG+ TG
Sbjct: 361 DSTPLKQQWLWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEELDK+KRVILF G+GSLQLT QEISTM+RW LKPYLFVLNN GYTIEKLI
Sbjct: 421 ATLGAAFAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNNGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HG  A+YNEIQ WNHLDLLPTFGAKDYE +RV+TTGEWNKLAED++FNKNSKIR+IE+ML
Sbjct: 481 HGEFAQYNEIQPWNHLDLLPTFGAKDYETVRVATTGEWNKLAEDQEFNKNSKIRMIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAKSA 593
           PVMDAPESLVKQAQLTAATNAKSA
Sbjct: 541 PVMDAPESLVKQAQLTAATNAKSA 564

>TDEL0E05080 Chr5 (936841..938532) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  977 bits (2526), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/563 (82%), Positives = 505/563 (89%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLGRY+FERLKQVD  T+FGLPGDFNL LLD+IYEV GMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YAR+KGM+ L+TTFGVGELSALNGIAGSYAEHVGVLHIVGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMAALVTTFGVGELSALNGIAGSYAEHVGVLHIVGVPSISSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAMITD+ +AP+EIDRCIRTTY+ QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSANISETTAMITDINSAPAEIDRCIRTTYVSQRPVYLGLPANLVDLKVPASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           LDTPIDL+LK ND +AE+EV+  +L +IK AKNPVILADAC SRHDVK ET+KLIDITQF
Sbjct: 181 LDTPIDLSLKANDAEAEQEVVDDVLALIKAAKNPVILADACCSRHDVKDETRKLIDITQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           PSFVTPMGKGSIDE++PRFGGVYVGTLSSP VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSD+IKIRNATFPGVQMKF LQ LL KVG V KDYKPV VP     NAA  
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLAKVGDVAKDYKPVQVPARTPENAATA 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            STPLKQQW+WNQVG+FLQEGD+V+TETGTSAFGINQ+HFPN TYGISQVLWGSIG+ TG
Sbjct: 361 DSTPLKQQWIWNQVGKFLQEGDVVITETGTSAFGINQSHFPNKTYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEE+D  KRVILF G+GSLQLT QEISTMVRW LKPYLFVLNN GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HG  A+YN+IQ W +LDLLPTFGAKDYE  RVSTTGEWNKL  D +FNKNSKIR+IE+ML
Sbjct: 481 HGEKAQYNDIQPWKNLDLLPTFGAKDYETHRVSTTGEWNKLTTDSEFNKNSKIRMIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAKS 592
           PVMDAP SLV QAQLTA+ NAK+
Sbjct: 541 PVMDAPSSLVAQAQLTASINAKN 563

>ACL134C Chr3 complement(117344..119104) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR044C
           (PDC1) and Non-syntenic homolog of Saccharomyces
           cerevisiae YLR134W (PDC5) and YGR087C (PDC6)
          Length = 586

 Score =  972 bits (2512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/563 (82%), Positives = 516/563 (91%)

Query: 29  TMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAAD 88
           TMSEITLGRY+FERL+Q++V T+FGLPGDFNL LLD+IYEVEGMRWAGN NELNA+YAAD
Sbjct: 22  TMSEITLGRYLFERLRQIEVQTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAAD 81

Query: 89  AYARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGN 148
            YAR+KGMSCLITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SAQAKQLLLHHTLGN
Sbjct: 82  GYARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGN 141

Query: 149 GDFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPAS 208
           GDFTVFHRMSANIS TTAMI+D+ +AP+EIDRCIRT YI QRPVYLGLP+N VD  VPAS
Sbjct: 142 GDFTVFHRMSANISGTTAMISDITSAPAEIDRCIRTCYITQRPVYLGLPANMVDLKVPAS 201

Query: 209 LLDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQ 268
           LL+TPIDL LKPND +AE EV+ T+LEMI  AKNPVIL+DACASRHDVKAET KLID+TQ
Sbjct: 202 LLETPIDLNLKPNDPEAEAEVVETVLEMIAAAKNPVILSDACASRHDVKAETMKLIDVTQ 261

Query: 269 FPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSY 328
           FP+FVTPMGKGSI E+HPRFGGVYVGTLSSP VKEAVESADLVLSVGALLSDFNTGSFSY
Sbjct: 262 FPAFVTPMGKGSIYEQHPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSY 321

Query: 329 SYKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAV 388
           SYKTKNVVEFHSDHIKIRNATFPGVQMK+VL+ L++ V  V+K Y PVPVP  PA N  +
Sbjct: 322 SYKTKNVVEFHSDHIKIRNATFPGVQMKYVLRKLVDNVAEVIKSYVPVPVPSKPANNEEI 381

Query: 389 DPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYAT 448
           D +TPLKQ+WLWNQVG+FL+EGD+V+TETGTSAFGINQTHFPNNTYGISQVLWGSIG+ T
Sbjct: 382 DSATPLKQEWLWNQVGKFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTT 441

Query: 449 GACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKL 508
           GACLGA  AAEELD ++RVILF G+GSLQLT QEISTMVRW LKPYLFVLNN GYTIE+L
Sbjct: 442 GACLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERL 501

Query: 509 IHGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELM 568
           IHG TA+YN+IQ W HL+LLPTFGAKDYEA+RVSTTGEW+ L +DK FN+NSKIR+IE+M
Sbjct: 502 IHGETAQYNDIQPWQHLNLLPTFGAKDYEAVRVSTTGEWDALTQDKAFNENSKIRMIEVM 561

Query: 569 LPVMDAPESLVKQAQLTAATNAK 591
           LPVMDAP +LVKQA+LTAATNAK
Sbjct: 562 LPVMDAPSNLVKQAELTAATNAK 584

>NDAI0C03110 Chr3 (707463..709157) [1695 bp, 564 aa] {ON} Anc_5.122
          Length = 564

 Score =  972 bits (2512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/562 (84%), Positives = 517/562 (91%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLGRY+FERL QVDV T+FGLPGDFNL LLD+IYE  GMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPSVS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAM+TD+ATAP+EIDRCIRTTY+ QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL+LK ND +AE EV++T+LE+IKDAKNPVILADACASRHDVKAETKKLIDITQF
Sbjct: 181 LETPIDLSLKANDVEAETEVVNTILELIKDAKNPVILADACASRHDVKAETKKLIDITQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           PSFVTPMGKGSIDE+HPRFGGVYVGTLSSPAVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSD+IKI+NATFPGVQMKF LQ LL  V    K YKPV VP  PA NAAVD
Sbjct: 301 YKTKNIVEFHSDYIKIKNATFPGVQMKFALQKLLGSVAEAAKGYKPVAVPAKPAANAAVD 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            +TPLKQ+W+WNQVG+FLQEGD+V+TETGTSAFGINQTHFPNNTYGISQVLWGSIG+ TG
Sbjct: 361 AATPLKQEWMWNQVGKFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           ACLGA  AAEE+D  KRVILF G+GSLQLT QEISTMVRWNLKPYLFVLNN GYTIEKLI
Sbjct: 421 ACLGAAFAAEEVDPKKRVILFIGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGPTA+YNEIQ+W+HL LLPTFGAKDYE  RV+TTGEW KL E+K+FN+NS+IRLIE+ML
Sbjct: 481 HGPTAQYNEIQSWDHLSLLPTFGAKDYENHRVATTGEWIKLTENKEFNQNSRIRLIEIML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP +LV QAQLTA  NAK
Sbjct: 541 PVMDAPSNLVAQAQLTAKINAK 562

>KLLA0E16303g Chr5 complement(1457903..1459594) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism
          Length = 563

 Score =  967 bits (2500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/563 (82%), Positives = 510/563 (90%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLGRY+FERLKQV+V T+FGLPGDFNL LLD IYEV GMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGRYLFERLKQVEVQTIFGLPGDFNLSLLDNIYEVPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPSVS+QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMS+NISETTAMITD+ TAP+EIDRCIRTTY+ QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSSNISETTAMITDINTAPAEIDRCIRTTYVSQRPVYLGLPANLVDLTVPASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           LDTPIDL+LKPND +AEEEVI  +L++IK+AKNPVILADAC SRHD KAETKKLID+TQF
Sbjct: 181 LDTPIDLSLKPNDPEAEEEVIENVLQLIKEAKNPVILADACCSRHDAKAETKKLIDLTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSD+ KIR+ATFPGVQMKF LQ LL KV    K YKPVPVP  P  N AV 
Sbjct: 301 YKTKNIVEFHSDYTKIRSATFPGVQMKFALQKLLTKVADAAKGYKPVPVPSEPEHNEAVA 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            STPLKQ+W+W QVG+FL+EGD+V+TETGTSAFGINQTHFPNNTYGISQVLWGSIG+ TG
Sbjct: 361 DSTPLKQEWVWTQVGEFLREGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEE+D  KRVILF G+GSLQLT QEISTM+RW LKPYLFVLNN GYTIE+LI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HG TA+YN IQNW HL+LLPTFGAKDYEA+RVSTTGEWNKL  D+ F  N++IRLIE+ML
Sbjct: 481 HGETAQYNCIQNWQHLELLPTFGAKDYEAVRVSTTGEWNKLTTDEKFQDNTRIRLIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAKS 592
           P MDAP +LVKQAQLTAATNAK+
Sbjct: 541 PTMDAPSNLVKQAQLTAATNAKN 563

>NCAS0D01660 Chr4 complement(313684..315378) [1695 bp, 564 aa] {ON}
           Anc_5.122
          Length = 564

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/562 (81%), Positives = 514/562 (91%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLG+Y+FERL Q+DV T+FGLPGDFNL LLD+IYE+ GMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGKYLFERLNQIDVKTIFGLPGDFNLSLLDKIYEIPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YAR+KGMSCLITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAM+TD+ATAP+EIDRCIRTTY+ QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           LDTPIDL+LK ND +AE EVI T+L+++K AKNP+ILADACASRHDVKAET+KLIDITQF
Sbjct: 181 LDTPIDLSLKANDAEAEAEVIETILDLVKSAKNPIILADACASRHDVKAETRKLIDITQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           PSFVTPMGKGSIDE+HPRFGGVYVGTLSSPA+K++VESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSSPAIKQSVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKNVVEFHSD+IKI+NATFPGVQMKFVLQ LL  + A  K YKPV VP  PA N A  
Sbjct: 301 YKTKNVVEFHSDYIKIKNATFPGVQMKFVLQKLLTVIAAAAKGYKPVAVPAKPAANPATA 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            STPLKQ+WLWNQVG+FLQEGD+V++ETGTSAFGINQTHFPNNTYGISQVLWGSIG+ATG
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDVVISETGTSAFGINQTHFPNNTYGISQVLWGSIGFATG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
             LGA  AAEE+D  KRVILFTGEGSLQLT QEISTMVRWNLKPYLFVLNN GYTIE+LI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNDGYTIERLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HG  A+YN+IQNW HL+LLPTFGAKDYE  RVSTTGEW+KL  +K+FN+N++IR+IE+ML
Sbjct: 481 HGEKADYNDIQNWEHLNLLPTFGAKDYENHRVSTTGEWDKLTSNKEFNQNTRIRMIEIML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP +LV QA+LTA+ NAK
Sbjct: 541 PVMDAPSNLVAQAKLTASINAK 562

>Kpol_1010.48 s1010 (110999..112690) [1692 bp, 563 aa] {ON}
           (110999..112690) [1692 nt, 564 aa]
          Length = 563

 Score =  964 bits (2493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/562 (82%), Positives = 509/562 (90%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLGRY+FERLKQV V T+FGLPGDFNL LLD+IYEV GMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGM+CLITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSA ISETTAMITD+A AP+EIDRCIRTTYI QR VYLGLP+N VD MVPA L
Sbjct: 121 DFTVFHRMSACISETTAMITDIANAPAEIDRCIRTTYITQRTVYLGLPANMVDLMVPADL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L TPIDL+LKPND +AE EV+ T+L M+K+AKNP+ILADACASRHDVKAETK+LID TQF
Sbjct: 181 LKTPIDLSLKPNDPEAETEVLDTILAMVKEAKNPIILADACASRHDVKAETKQLIDTTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P FVTPMGKGSIDE+HPRFGGVYVGTLS P VK AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKAAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           Y+TKNVVEFHSDH KI+ A+FPGVQMKFVLQ L+ ++GA VKDYKPV  P LPA NA   
Sbjct: 301 YQTKNVVEFHSDHTKIKKASFPGVQMKFVLQKLVAQIGAAVKDYKPVAAPALPASNAECP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            STPLKQ+WLWNQVG+FLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIG+  G
Sbjct: 361 ASTPLKQEWLWNQVGKFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGFTGG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEE+D  KR I+F G+GSLQLT QEISTM+RWNLKPY+FVLNN GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNDGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGPTA+YNEIQNW HLD+LPTFGAKDYEAIRV+TTGE+NKL EDK FN+NSKIR+IE+ML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYEAIRVATTGEFNKLCEDKAFNENSKIRMIEIML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP +LV QA+LTA+ NAK
Sbjct: 541 PVMDAPSNLVAQAKLTASINAK 562

>CAGL0M07920g Chr13 complement(789467..791161) [1695 bp, 564 aa]
           {ON} highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 pyruvate decarboxylase or
           uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
          Length = 564

 Score =  964 bits (2491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/562 (82%), Positives = 510/562 (90%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLGRY+FERL QVDV T+FGLPGDFNL LLD+IYEVEGMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGRYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAM+TD+ATAP+EIDRCIRTTYI QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYITQRPVYLGLPANLVDLKVPAKL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL+LKPND +AE EV+ T+LE+IK AKNPVILADACASRHDVKAETKKLID TQF
Sbjct: 181 LETPIDLSLKPNDPEAETEVVDTVLELIKAAKNPVILADACASRHDVKAETKKLIDATQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           PSFVTPMGKGSIDE+HPRFGGVYVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSD+IKIRNATFPGVQMKF LQ LLN V   +K YKPVPVP     N + D
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLNAVPEAIKGYKPVPVPARVPENKSCD 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
           P+TPLKQ+W+WNQV +FLQEGD+V+TETGTSAFGINQT FPNN YGISQVLWGSIG+ TG
Sbjct: 361 PATPLKQEWMWNQVSKFLQEGDVVITETGTSAFGINQTPFPNNAYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           ACLGA  AAEE+D  KRVILF G+GSLQLT QEISTM+RW LKPYLFVLNN GYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HG  A YN+IQNW+HL LLPTFGAKDYE  RV+TTGEW+KL +DK+FNKNSKIR+IE+ML
Sbjct: 481 HGEKAGYNDIQNWDHLALLPTFGAKDYENHRVATTGEWDKLTQDKEFNKNSKIRMIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP SL++QA+LTA+ NAK
Sbjct: 541 PVMDAPTSLIEQAKLTASINAK 562

>Skud_12.110 Chr12 complement(217239..218930) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  963 bits (2489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/562 (81%), Positives = 510/562 (90%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSE+TLG+Y+FERLKQV+V TVFGLPGDFNL LLD+IYEVEGMRWAGN NELNA+YAAD 
Sbjct: 1   MSELTLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAMITD+ATAP+EIDRCIRTTY+ QRPVYLGLP+N VD  V A L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVDAKL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           LDTPID++LKPND ++E+EVI T++ ++KDAKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LDTPIDMSLKPNDAESEKEVIDTIMALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTPMGKGSIDE+HPR+GGVYVGTLS PAVKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPAVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSDHIKIRNATFPGVQMKFVLQ LL  +    K YKPV VP     NAAV 
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPAGTPANAAVA 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            STPLKQ+W+WNQ+G FLQEGD+V+ ETGTSAFGINQT FPNNTYGISQVLWGSIG+ TG
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEE+D  KRVILF G+GSLQLT QEISTM+RW LKPYLF+LNN GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFILNNDGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGP A+YNEIQNW+HL LLPTFGAKDYE  RV+TTGEW+KL +DK FN NSKIR+IE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PV DAP++LV+QA+LTAATNAK
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAK 562

>SAKL0G14894g Chr7 (1275005..1276699) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAF0 Saccharomyces kluyveri PDC12 Pyruvate
           decarboxylase
          Length = 564

 Score =  961 bits (2485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/562 (83%), Positives = 523/562 (93%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLGRY+FERL QV+V T+FGLPGDFNL LLD+IYEV GMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGRYLFERLNQVEVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPSVS+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTA +TD+ATAP+EIDRCIRTTY+ QRPVYLGLP+N VD MVPASL
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           LDTPIDL+LKPND +AE EV++T+LE+IKDAKNPVILADACASRH+VK+ETK+LIDITQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNTVLELIKDAKNPVILADACASRHNVKSETKQLIDITQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTP+GKGSIDE+HPRFGGVYVGTLS+  VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSD+IKIRNATFPGVQMKF LQ LL++VG VVKDYKPV VP  P PN A D
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSQVGEVVKDYKPVAVPAKPTPNPACD 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
           PSTPLKQ+W+WNQVG+FLQEGD+V+TETGTSAFGINQTHFPNNTYGISQVLWGSIG+ TG
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           ACLGA  AAEELDK+KRVILF G+GSLQLT QEISTM+RW LKPYLFVLNN GYTIE+LI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HG  A+YNEIQ W +LDLLPTFGAKDYE  RV+TTGEW+KLA+D+ FNKNS+IR++E+ML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP +LVKQAQLTA+ NAK
Sbjct: 541 PVMDAPSNLVKQAQLTASINAK 562

>Suva_10.128 Chr10 complement(233880..235571) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  961 bits (2485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/562 (81%), Positives = 510/562 (90%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLG+Y+FERL QV+V TVFGLPGDFNL LLD+IYEVEGMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGKYLFERLNQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAMITD+ATAP+EIDRCIRTTY+ QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPID++LKPND ++E+EVI T+L ++KDAKNP+ILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDMSLKPNDAESEKEVIDTILALVKDAKNPIILADACCSRHDVKAETKKLIDLTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           PSFVTPMGKGSIDEKHPR+GGVYVGTLS P VK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEKHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSDH+KIRNATFPGVQMKFVLQ LL  V    K YKPV VP     NAAV 
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTVADAAKGYKPVAVPAPTPANAAVP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            STPLKQ+W+WNQ+G+FLQEGD+V+ ETGTSAFGINQ  FPNNTYGISQVLWGSIG+ TG
Sbjct: 361 ASTPLKQEWMWNQLGEFLQEGDVVIAETGTSAFGINQVAFPNNTYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEE+D  KRVILF G+GSLQLT QEISTM+RW LKPYLFVLNN GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGP A+YNEIQNW+HL LLPTFGAKDYE  RV+TTGEW+KL +DK FN+NSKIR+IE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNENSKIRMIEIML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PV DAP++LV+QA+LTAATNAK
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAK 562

>YLR044C Chr12 complement(232390..234081) [1692 bp, 563 aa] {ON}
           PDC1Major of three pyruvate decarboxylase isozymes, key
           enzyme in alcoholic fermentation, decarboxylates
           pyruvate to acetaldehyde; subject to glucose-, ethanol-,
           and autoregulation; involved in amino acid catabolism
          Length = 563

 Score =  961 bits (2484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/562 (81%), Positives = 508/562 (90%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLG+Y+FERLKQV+V TVFGLPGDFNL LLD+IYEVEGMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAMITD+ATAP+EIDRCIRTTY+ QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L TPID++LKPND ++E+EVI T+L ++KDAKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LQTPIDMSLKPNDAESEKEVIDTILALVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTPMGKGSIDE+HPR+GGVYVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSDH+KIRNATFPGVQMKFVLQ LL  +    K YKPV VP     NAAV 
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTTIADAAKGYKPVAVPARTPANAAVP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            STPLKQ+W+WNQ+G FLQEGD+V+ ETGTSAFGINQT FPNNTYGISQVLWGSIG+ TG
Sbjct: 361 ASTPLKQEWMWNQLGNFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEE+D  KRVILF G+GSLQLT QEISTM+RW LKPYLFVLNN GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGP A+YNEIQ W+HL LLPTFGAKDYE  RV+TTGEW+KL +DK FN NSKIR+IE+ML
Sbjct: 481 HGPKAQYNEIQGWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEIML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PV DAP++LV+QA+LTAATNAK
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAK 562

>Smik_12.106 Chr12 complement(213431..215122) [1692 bp, 563 aa] {ON}
           YLR044C (REAL)
          Length = 563

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/562 (81%), Positives = 509/562 (90%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLG+Y+FERLKQV+V TVFGLPGDFNL LLD+IYEVEGMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGKYLFERLKQVNVNTVFGLPGDFNLSLLDKIYEVEGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAMITD+ATAP+EIDRCIRTTY+ QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLNVPAKL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPID++LK ND ++E+EVI T+L ++KDAKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDMSLKANDAESEKEVIDTILSLVKDAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTPMGKGSIDE+HPR+GGVYVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSDH+KIRNATFPGVQMKFVLQ LL  +    K YKPV VP     NAAV 
Sbjct: 301 YKTKNIVEFHSDHMKIRNATFPGVQMKFVLQKLLTVIADAAKGYKPVAVPANTPANAAVP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            STPLKQ+W+WNQ+G FLQEGD+V+ ETGTSAFGINQT FPNNTYGISQVLWGSIG+ TG
Sbjct: 361 ASTPLKQEWMWNQLGSFLQEGDVVIAETGTSAFGINQTTFPNNTYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEE+D  KRVILF G+GSLQLT QEISTM+RW LKPYLFVLNN GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGP A+YNEIQNW+HL LLPTFGAKDYE  RV+TTGEW+KL +DK FN NSKIR+IE+ML
Sbjct: 481 HGPKAQYNEIQNWDHLSLLPTFGAKDYETHRVATTGEWDKLTQDKSFNDNSKIRMIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PV DAP++LV+QA+LTAATNAK
Sbjct: 541 PVFDAPQNLVEQAKLTAATNAK 562

>SAKL0G10164g Chr7 complement(867445..869139) [1695 bp, 564 aa] {ON}
           uniprot|Q6W9G6 Saccharomyces kluyveri PDC11 Pyruvate
           decarboxylase
          Length = 564

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/562 (83%), Positives = 522/562 (92%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLG Y+FERL QVDV T+FGLPGDFNL LLD+IYEV GMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGLYLFERLNQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPSVS+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTA +TD+ATAP+EIDRCIRTTY+ QRPVYLGLP+N VD MVPASL
Sbjct: 121 DFTVFHRMSANISETTAWVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLMVPASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           LDTPIDL+LKPND +AE EV++++LE+IKDAKNP+ILADACASRHDVK ETK+LIDITQF
Sbjct: 181 LDTPIDLSLKPNDPEAEAEVVNSVLELIKDAKNPIILADACASRHDVKPETKQLIDITQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTP+GKGSIDE+HPRFGGVYVGTLS+  VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRFGGVYVGTLSNDDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSD+IKIRNATFPGVQMKF LQ LL+++GAVVKDYKPV VP  P PN A D
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFALQKLLSEIGAVVKDYKPVAVPPKPTPNPACD 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
           PSTPLKQ+W+WNQVG+FLQEGD+V+TETGTSAFGINQTHFPNNTYGISQVLWGSIG+ TG
Sbjct: 361 PSTPLKQEWVWNQVGRFLQEGDVVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           ACLGA  AAEELDK+KRVILF G+GSLQLT QEISTM+RW L+PYLFVLNN GYTIE+LI
Sbjct: 421 ACLGAACAAEELDKNKRVILFIGDGSLQLTVQEISTMIRWGLRPYLFVLNNDGYTIERLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HG  A+YNEIQ W +LDLLPTFGAKDYE  RV+TTGEW+KLA+D+ FNKNS+IR++E+ML
Sbjct: 481 HGENAQYNEIQPWKNLDLLPTFGAKDYETYRVATTGEWDKLAQDEAFNKNSRIRMVEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP +LVKQAQLTA+ NAK
Sbjct: 541 PVMDAPSNLVKQAQLTASINAK 562

>ZYRO0F01606g Chr6 complement(130346..132037) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/562 (81%), Positives = 503/562 (89%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLGRY+FERLKQVD  T+FG+PGDFNL LLD++YEV+G+RWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGRYLFERLKQVDTNTIFGVPGDFNLSLLDKVYEVQGLRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YAR+KG++ LITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVS+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGLAALITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAM+TD+  AP+EIDRCIR  Y+ QRPVYLGLP+N VDQ VPASL
Sbjct: 121 DFTVFHRMSANISETTAMLTDITAAPAEIDRCIRVAYVNQRPVYLGLPANLVDQKVPASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL+LK ND +AE EV+ T+LE+IK+AKNPVILADAC SRHDVKAETKKLID+TQF
Sbjct: 181 LNTPIDLSLKENDPEAETEVVDTVLELIKEAKNPVILADACCSRHDVKAETKKLIDLTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           PSFVTPMGKGSIDE++PRFGGVYVGTLSSP VKEAVESADLVLSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSSPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKNVVEFHSDHIKIRNATFPGVQMKFVL+ LL  V   VK+YKP PVP  P+PNA V 
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLKKLLQAVPEAVKNYKPGPVPAPPSPNAEVA 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            ST LKQ+WLW QVG FL+EGD+V+TETGTSAFGINQTHFPN TYGISQVLWGSIGY TG
Sbjct: 361 DSTTLKQEWLWRQVGSFLREGDVVITETGTSAFGINQTHFPNQTYGISQVLWGSIGYTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           + LGA  AAEE+D  KRVILF G+GSLQLT QEISTM+RW LKPYLFVLNN GYTIE+LI
Sbjct: 421 STLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HG TAEYN IQ W HL+LL TFGAKDYE  RVST GEWNKL +D  FN+NS+IR+IE+ML
Sbjct: 481 HGETAEYNCIQPWKHLELLNTFGAKDYENHRVSTVGEWNKLTQDPKFNENSRIRMIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
            VMDAP SLV QAQLTAATNAK
Sbjct: 541 EVMDAPSSLVAQAQLTAATNAK 562

>TPHA0H00950 Chr8 (199181..200872) [1692 bp, 563 aa] {ON} Anc_5.122
           YLR044C
          Length = 563

 Score =  947 bits (2449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/562 (80%), Positives = 505/562 (89%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MS+ITLG+Y+FERLKQV   T+FGLPGDFNL LLD+IYEV GMRWAGNCNELNA+YAAD 
Sbjct: 1   MSQITLGKYLFERLKQVQCQTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGM+CLITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSA ISETT+MITD+A+A +EIDRCI+ TYI QR VYLGLP+N VD MVPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL+LKPND  AE EV+  +LE+IKDAKNP+ILADACASRHDVKAETK LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDATQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           PSFVTPMGKGSIDE+HPRFGGVYVGTLS P VK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           Y TKN+VEFHSDHIKIR A+FPGVQMKFVL+ L+ +VG+VVK YKPV +P     N A  
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVVKGYKPVAIPAPVPANPATP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
             TPLKQ+WLWNQVG+FL+EGDIVLTETGTSAFGINQTHFP NTYGISQVLWGSIG+  G
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEE+D  KR I+F G+GSLQLT QEISTM+RWNLKPY+FVLNN GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGPTA+YNEIQNW HLD+LPTFGAKDYE IRV+TTGEW+KLA DK FN+NSKIR+IE+ML
Sbjct: 481 HGPTAQYNEIQNWKHLDILPTFGAKDYETIRVATTGEWDKLASDKAFNENSKIRMIEIML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP +L+ QA+LTAATNAK
Sbjct: 541 PVMDAPSNLIAQAKLTAATNAK 562

>NDAI0A01400 Chr1 (313925..315616) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  944 bits (2440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/562 (82%), Positives = 508/562 (90%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLGRY+FERL QV+V T+FGLPGDFNL LLD+IYE  GMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGRYLFERLSQVNVNTIFGLPGDFNLSLLDKIYETPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAM+TD+ATAP+EIDRCIRTTY+ QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL+LKPND +AE EV+  +L +IK+AKNPVILADAC SRHDVK ET+KLIDITQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVLEEVLSLIKNAKNPVILADACCSRHDVKVETRKLIDITQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           PSFVTPMGKGSIDE++PRFGGVYVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSDHIKIRNATFPGVQMKFVLQ LL  V A VK YKPVPVP     N  V 
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFVLQKLLKSVPAAVKGYKPVPVPAGIPANKKVA 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            STPLKQ+W+WNQVG+FLQEGDIV+TETGTSAFGINQTHFPNNTYGISQVLWGSIG+ TG
Sbjct: 361 DSTPLKQEWMWNQVGKFLQEGDIVITETGTSAFGINQTHFPNNTYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEE+D  +RVILF G+GSLQLT QEISTMVRWNLKPYLF+LNN GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKRRVILFIGDGSLQLTVQEISTMVRWNLKPYLFILNNNGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGPTA+YNEIQ+W HL LL TFGAKDYE  RV+TTGEWNKL E+K+FN NS+IR+IE+ML
Sbjct: 481 HGPTAQYNEIQSWEHLKLLETFGAKDYENHRVATTGEWNKLCENKEFNVNSRIRVIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP+SL+KQ +LTA  NA+
Sbjct: 541 PVMDAPQSLIKQGELTAQINAR 562

>Suva_10.227 Chr10 (419251..420942) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  941 bits (2432), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/562 (80%), Positives = 502/562 (89%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLG+Y+FERL QVD  TVFGLPGDFNL LLD++YEVEGMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGKYLFERLSQVDCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAMITD+A AP+EIDRCIRTT+  QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPID+ALKPND +AE EV+ T++EMI+DAKNPVILADACASRHDVKAETKKLID+TQF
Sbjct: 181 LETPIDMALKPNDAEAEAEVVRTVIEMIQDAKNPVILADACASRHDVKAETKKLIDLTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTPMGKGSIDE+HPR+GGVYVGTLS P VK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGSIDEQHPRYGGVYVGTLSKPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           Y+TKN+VEFHSDHIKIRNATFPGVQMKF LQ LL+ +  VVKDYKPV VP     N A+ 
Sbjct: 301 YRTKNIVEFHSDHIKIRNATFPGVQMKFALQRLLSAIPEVVKDYKPVAVPARTPANKALP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            STP+KQ+W+WNQ+  FLQEGDIV+ ETGTSAFGINQT FP + Y I QVLWGSIG+  G
Sbjct: 361 ASTPMKQEWMWNQLSTFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA MAAEE+D  KRVILF G+GSLQLT QEISTM+RW LKPY+FVLNN GYTIEKLI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGP AEYNE+Q W+HL LLPTFGAKDYE  RV TTGEW+KL +DK+F  NS+IR+IE+ML
Sbjct: 481 HGPHAEYNEVQPWDHLALLPTFGAKDYETHRVVTTGEWDKLTQDKEFQDNSRIRMIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PV DAP++LVKQAQLTAATNAK
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAK 562

>Skud_12.203 Chr12 (393390..395081) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  939 bits (2428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/562 (80%), Positives = 502/562 (89%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLG+Y+FERL QV+  TVFGLPGDFNL LLD++YEVEGMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKHLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAMITD+A+APSEIDRCIRTT+  QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIASAPSEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           LDTPID++LKPND +AE EV+ T++EMIKDAKNPVILADACASRHDVKAETKKLI++TQF
Sbjct: 181 LDTPIDMSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P FVTPMGKG+IDE+HPR+GGVYVGTLS P VK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PIFVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKNVVEFHSDHIKIRNATFPGVQMKF LQ LLN +  VVKDYKPV VP     N A  
Sbjct: 301 YKTKNVVEFHSDHIKIRNATFPGVQMKFTLQKLLNAIPEVVKDYKPVAVPARVPINKATP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            +T +KQ+W+WNQ+G FLQEGDIV+ ETGTSAFGINQT FP + Y I QVLWGSIG+  G
Sbjct: 361 ANTSMKQEWMWNQLGNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA MAAEELD  KRVILF G+GSLQLT QEISTM+RW LKPY+FVLNN GYTIEKLI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGP AEYNE+Q+W+HL LLPTFGA+DYE  R++TTGEW+KL +DKDF  NS+IR+IE+ML
Sbjct: 481 HGPHAEYNEVQSWDHLSLLPTFGARDYETHRITTTGEWDKLTQDKDFQDNSRIRMIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PV DAP++LVKQAQLTAATNAK
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAK 562

>TPHA0Q00120 Chr17 complement(8844..10535) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  938 bits (2425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/562 (80%), Positives = 502/562 (89%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MS+ITLG+Y+FERLKQV   T+FGLPGDFNL LLD+IYEV GMRWAGNCNELNA+YAAD 
Sbjct: 1   MSQITLGKYLFERLKQVQCNTIFGLPGDFNLSLLDKIYEVPGMRWAGNCNELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGM+CLITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSAQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSA ISETT+MITD+A+A +EIDRCI+ TYI QR VYLGLP+N VD MVPA +
Sbjct: 121 DFTVFHRMSACISETTSMITDIASAQAEIDRCIKATYISQRTVYLGLPANMVDLMVPADV 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL+LKPND  AE EV+  +LE+IKDAKNP+ILADACASRHDVKAETK LID TQF
Sbjct: 181 LNTPIDLSLKPNDVDAETEVLGAILELIKDAKNPIILADACASRHDVKAETKALIDTTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           PSFVTPMGKGSIDE+HPRFGGVYVGTLS P VK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQHPRFGGVYVGTLSRPEVKKAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           Y TKN+VEFHSDHIKIR A+FPGVQMKFVL+ L+ +VG+V+K YKPV +P     N A  
Sbjct: 301 YNTKNIVEFHSDHIKIRKASFPGVQMKFVLEKLVAQVGSVIKGYKPVAIPAPVPANPATP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
             TPLKQ+WLWNQVG+FL+EGDIVLTETGTSAFGINQTHFP NTYGISQVLWGSIG+  G
Sbjct: 361 AETPLKQEWLWNQVGKFLKEGDIVLTETGTSAFGINQTHFPTNTYGISQVLWGSIGFTGG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEE+D  KR I+F G+GSLQLT QEISTM+RWNLKPY+FVLNN GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPKKRTIVFIGDGSLQLTVQEISTMIRWNLKPYIFVLNNNGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGPTAEYNEIQNW HLD+L TFGAKDYE  RV+TTGEW+KLA D+ FN+NSKIRLIE+ML
Sbjct: 481 HGPTAEYNEIQNWKHLDILSTFGAKDYENHRVATTGEWDKLASDRAFNENSKIRLIEIML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP +L+ QA+LT ATNAK
Sbjct: 541 PVMDAPSNLIAQAKLTEATNAK 562

>TBLA0B07520 Chr2 complement(1789035..1790726) [1692 bp, 563 aa]
           {ON} Anc_5.122 YLR044C
          Length = 563

 Score =  936 bits (2419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/562 (79%), Positives = 505/562 (89%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           M+EITLG+Y+FERL QV V T+FGLPGDFNL LLD+IYEV GMRWAGN NELNA+YAAD 
Sbjct: 1   MAEITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGM+CLITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLSSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSA ISETTAMITD+ATAP+EIDRCIRTTY++QR VYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSAEISETTAMITDIATAPAEIDRCIRTTYVKQRTVYLGLPANLVDLTVPASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL+LKPND +AE EVI T+LE++++AKNP+I+ADAC SRHDVK+ET++LI+ TQF
Sbjct: 181 LETPIDLSLKPNDAEAENEVIETVLELVREAKNPIIIADACCSRHDVKSETEELINATQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           PSF TPMGKGSI+E+HPRFGGVYVGTLS P VK AVESADLVLSVGALLSDFNTGSFSY+
Sbjct: 241 PSFTTPMGKGSINERHPRFGGVYVGTLSRPEVKAAVESADLVLSVGALLSDFNTGSFSYA 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSDHIK++NATFPGVQMKFVLQ L++K+GA +K YKPV VP     N  V 
Sbjct: 301 YKTKNIVEFHSDHIKVKNATFPGVQMKFVLQKLVSKIGAAIKGYKPVAVPAGIPANKEVP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            +TPLKQ+WLWNQ+G FLQEGDIVLTETGTSAFGINQT FP +TYGISQVLWGSIG+  G
Sbjct: 361 ANTPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
             LGA  AAEE++ +KR ILF G+GSLQLT QEIST++RWNLKPYLFVLNN GYTIEKLI
Sbjct: 421 CVLGAAFAAEEINPNKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGPTA+YNEIQ WNHL +LPTFGAKDYEA+RV+TTGEW KL  DK F KNSKIR+IE+ML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEALRVATTGEWIKLTTDKAFQKNSKIRMIEIML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP +LV QA+LTAATNAK
Sbjct: 541 PVMDAPSNLVAQAKLTAATNAK 562

>Ecym_2479 Chr2 (938295..939989) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii ACL134C
          Length = 564

 Score =  935 bits (2416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/562 (80%), Positives = 511/562 (90%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEIT+G Y+F+RLKQV+V T+FGLPGDFNL LLD+IYEV GMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITIGHYLFQRLKQVEVQTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARLKGMSCVITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISE+TAMITD+ATA  EIDRCIRT YI QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSANISESTAMITDVATAAREIDRCIRTCYISQRPVYLGLPANLVDAKVPASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPID +LKPND +AE EV+ T+LEMI ++KNPVIL+DACASRHDVK ETK+LID+TQF
Sbjct: 181 LETPIDFSLKPNDAEAENEVVGTVLEMIANSKNPVILSDACASRHDVKEETKRLIDVTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTPMGKGSIDE+HPRFGGVYVGTLSSP VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSSPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSDH K+RNATFPGVQMKFVL+ L++ VG V K+Y PVPVP  P   + VD
Sbjct: 301 YKTKNIVEFHSDHTKVRNATFPGVQMKFVLKKLVDVVGDVAKNYVPVPVPTQPVHGSDVD 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
           P+TPL+Q+W+W +V +FL+EGD+V+TETGTSAFGINQTHFPN+TYGISQVLWGSIG+ TG
Sbjct: 361 PATPLRQEWIWREVARFLREGDVVITETGTSAFGINQTHFPNDTYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           ACLGA  AAEE+D  KRVILF G+GSLQLT QEISTM+RW LKPYLFVLNN GYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HG TA+YN+IQ W+HL LLPTFGAKDYEA+RVST GEW +L +DK F++NSKIR+IE+ML
Sbjct: 481 HGETAQYNDIQPWDHLKLLPTFGAKDYEAVRVSTAGEWQQLTQDKAFSENSKIRMIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP +LVKQAQLTAATNAK
Sbjct: 541 PVMDAPSNLVKQAQLTAATNAK 562

>NCAS0A14630 Chr1 complement(2878338..2880029) [1692 bp, 563 aa]
           {ON} 
          Length = 563

 Score =  929 bits (2401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/563 (79%), Positives = 500/563 (88%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLGRY+FERLKQV+V T+FGLPGDFNL LLD+IYEV GMRWAGN NELNASYAAD 
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNASYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YAR+KGM+CLITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMS+NISETTAM+TDLA A SEIDRCIRTTY+ QR VYLGLP+N  D  V ASL
Sbjct: 121 DFTVFHRMSSNISETTAMVTDLANATSEIDRCIRTTYVTQRTVYLGLPANMFDLKVKASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           LDTPIDL+LKPND  AE EV+ T+L ++KDAKNP+ILADAC SRHDVKAETKKLIDITQF
Sbjct: 181 LDTPIDLSLKPNDAAAENEVVETILSLVKDAKNPIILADACCSRHDVKAETKKLIDITQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           PSFVTPMGKGSIDE++PR+GGVYVGTLS+P VK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PSFVTPMGKGSIDEQNPRYGGVYVGTLSNPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKNVVEFHSDHIKI++ATFPGVQMKFVLQ LL  + +V K YKPV VP  PAPN    
Sbjct: 301 YKTKNVVEFHSDHIKIKSATFPGVQMKFVLQKLLKVIPSVAKGYKPVAVPGRPAPNKPSP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            +TP+KQ+W+WN++ +F QEGD+++TETGTSAFGINQT FP N YGISQVLWGSIG+ATG
Sbjct: 361 ANTPMKQEWMWNELAKFFQEGDVIITETGTSAFGINQTPFPKNAYGISQVLWGSIGFATG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
             LGA  AAEE+D  KRVILFTGEGSLQLT QEISTMVRWNLKPYLFVLNN GYTIE+LI
Sbjct: 421 CTLGAAFAAEEIDPKKRVILFTGEGSLQLTVQEISTMVRWNLKPYLFVLNNAGYTIERLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HG  A YN+IQ WNHL+LL TFGAKDYE  RVSTTGEW KL  +KDFN+NS+IRLIE+ML
Sbjct: 481 HGEKAGYNDIQPWNHLNLLETFGAKDYENHRVSTTGEWEKLTTNKDFNQNSRIRLIEIML 540

Query: 570 PVMDAPESLVKQAQLTAATNAKS 592
            VMDAP +LV QAQLTA+ NAK+
Sbjct: 541 EVMDAPSNLVAQAQLTASINAKN 563

>KAFR0E02020 Chr5 (400911..402605) [1695 bp, 564 aa] {ON} Anc_5.122
           YLR044C
          Length = 564

 Score =  928 bits (2399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/562 (79%), Positives = 499/562 (88%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           M+EITLG+Y+FERL QVDV T+FGLPGDFNL LLD+IYEV GMRWAGN NELNA+YAAD 
Sbjct: 1   MAEITLGKYLFERLAQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAM+TD+ATAP+EIDRCIRTTY+ QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIATAPAEIDRCIRTTYVTQRPVYLGLPANLVDLKVPAKL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL+LKPND +AE+EV+ T+L +IKDAKNPVIL+DACASRHDVKAETK+LID TQF
Sbjct: 181 LETPIDLSLKPNDAEAEKEVVDTILSLIKDAKNPVILSDACASRHDVKAETKQLIDATQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+F TPMGKGSIDE+HPRFGGVYVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRFGGVYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN++EFHSD+ KIRNATFPGVQMKFVL+ LL  V    K YKPV VP     N A D
Sbjct: 301 YKTKNIIEFHSDYTKIRNATFPGVQMKFVLRKLLASVADAAKGYKPVAVPARVPENKACD 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
           PSTPL Q+W+WNQ  +F QEGD+++TETGTSAFGINQ+ FPNN+ GISQVLWGSIG+  G
Sbjct: 361 PSTPLAQEWMWNQCAKFFQEGDVIITETGTSAFGINQSLFPNNSVGISQVLWGSIGFTGG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEE+D  KRVILF G+GSLQLT QEISTM+RWNLKPYLFVLNN GYTIE+LI
Sbjct: 421 AVLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNDGYTIERLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HG  A YN+IQNW HL LL TFGAKDYE  RV+TTGEW+ L  DK+FNKNS+IR+IE+ML
Sbjct: 481 HGEKAGYNDIQNWKHLMLLETFGAKDYENHRVATTGEWDALMGDKEFNKNSRIRMIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP +LV+QA++TAATNAK
Sbjct: 541 PVMDAPSNLVQQAKITAATNAK 562

>AAL073W Chr1 (216809..218500) [1692 bp, 563 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR087C (PDC6) and
           YLR134W (PDC5)
          Length = 563

 Score =  927 bits (2397), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/562 (78%), Positives = 505/562 (89%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLGRY+FERLKQV+V T+FG+PGDFNL LLD++YEV+GMRWAGN NELNASYAAD 
Sbjct: 1   MSEITLGRYLFERLKQVEVRTIFGVPGDFNLSLLDKVYEVDGMRWAGNANELNASYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YAR+K +SCL+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS SAQAKQLLLHHTLGNG
Sbjct: 61  YARVKKISCLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSAQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANIS+TTA+ITD+++AP+EIDRCIR  Y+ QRPVYLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSANISDTTAVITDISSAPAEIDRCIRACYVHQRPVYLGLPANMVDLTVPASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+T IDL+LKPND +AEEEV+ST+LE++ +AK+PVIL+DACASRHDVK ETK+LID+TQF
Sbjct: 181 LNTEIDLSLKPNDPEAEEEVVSTVLELVANAKHPVILSDACASRHDVKQETKQLIDVTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTPMGKGSIDE+HPRFGGVYVGTLS+P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEQHPRFGGVYVGTLSAPDVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSDH KIR+ATFPG++MK VLQ+L+ ++G   K Y+P PVP   APN   D
Sbjct: 301 YKTKNIVEFHSDHTKIRSATFPGIKMKTVLQNLVKRIGEAAKGYQPSPVPTYAAPNEDAD 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
           P TPLKQ+WLWNQV  FL+EGDIV+TETGT+AFGINQT FP++T GISQVLWGSIG+ TG
Sbjct: 361 PKTPLKQEWLWNQVSSFLKEGDIVITETGTAAFGINQTRFPSSTIGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           ACLGA  AAEE+D +KRVILF G+GSLQLT QEISTMVRW LKPYLFVLNN GYTIE+LI
Sbjct: 421 ACLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HG TA+YN IQ W HLDLLPTFGAKDYE  RV+TTGEW  L E ++FNKNS IR+IE+ML
Sbjct: 481 HGETAQYNCIQPWKHLDLLPTFGAKDYETHRVATTGEWRALTEKQEFNKNSSIRMIEIML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
            VMDAP SL+KQA+LTAATNA+
Sbjct: 541 DVMDAPSSLIKQAKLTAATNAQ 562

>YLR134W Chr12 (410723..412414) [1692 bp, 563 aa] {ON}  PDC5Minor
           isoform of pyruvate decarboxylase, key enzyme in
           alcoholic fermentation, decarboxylates pyruvate to
           acetaldehyde, regulation is glucose- and
           ethanol-dependent, repressed by thiamine, involved in
           amino acid catabolism
          Length = 563

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/562 (79%), Positives = 499/562 (88%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLG+Y+FERL QV+  TVFGLPGDFNL LLD++YEV+GMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGKYLFERLSQVNCNTVFGLPGDFNLSLLDKLYEVKGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAMITD+A AP+EIDRCIRTTY  QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMITDIANAPAEIDRCIRTTYTTQRPVYLGLPANLVDLNVPAKL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL+LKPND +AE EV+ T++E+IKDAKNPVILADACASRHDVKAETKKL+D+TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVVELIKDAKNPVILADACASRHDVKAETKKLMDLTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P +VTPMGKG+IDE+HPR+GGVYVGTLS P VK+AVESADL+LS+GALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKKAVESADLILSIGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSDHIKIRNATFPGVQMKF LQ LL+ +  VVKDYKPV VP       +  
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLDAIPEVVKDYKPVAVPARVPITKSTP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            +TP+KQ+W+WN +G FL+EGDIV+ ETGTSAFGINQT FP + Y I QVLWGSIG+  G
Sbjct: 361 ANTPMKQEWMWNHLGNFLREGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA MAAEELD  KRVILF G+GSLQLT QEISTM+RW LKPY+FVLNN GYTIEKLI
Sbjct: 421 ALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGP AEYNEIQ W+HL LLPTFGA++YE  RV+TTGEW KL +DKDF  NSKIR+IE+ML
Sbjct: 481 HGPHAEYNEIQGWDHLALLPTFGARNYETHRVATTGEWEKLTQDKDFQDNSKIRMIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PV DAP++LVKQAQLTAATNAK
Sbjct: 541 PVFDAPQNLVKQAQLTAATNAK 562

>Smik_12.197 Chr12 (392030..393721) [1692 bp, 563 aa] {ON} YLR134W
           (REAL)
          Length = 563

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/562 (78%), Positives = 497/562 (88%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLG+Y+FERL QV   TVFGLPGDFNL LLD++YEVEGMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGKYLFERLSQVKCNTVFGLPGDFNLSLLDKLYEVEGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKG++C+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARIKGIACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAM+TD+A AP+EIDRCIRTT+  QRPVYLGLP+N VD  VPA L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIANAPAEIDRCIRTTFTTQRPVYLGLPANLVDLNVPAKL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL+LKPND +AE EV+ T++EMIKDAKNPVILADACASRHDVKAETKKLI++TQF
Sbjct: 181 LETPIDLSLKPNDAEAEAEVVRTVIEMIKDAKNPVILADACASRHDVKAETKKLIELTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P +VTPMGKG+IDE+HPR+GGVYVGTLS P VKE VE+ADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PVYVTPMGKGAIDEQHPRYGGVYVGTLSRPEVKEGVENADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSDHIKIRNATFPGVQMKF LQ LL  + AVVKDYKPV VP     N    
Sbjct: 301 YKTKNIVEFHSDHIKIRNATFPGVQMKFALQKLLGAIPAVVKDYKPVAVPARVPLNKPSP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            +TP+KQ+W+WNQ+  FLQEGDIV+ ETGTSAFGINQT FP + Y I QVLWGSIG+  G
Sbjct: 361 ANTPMKQEWMWNQLSNFLQEGDIVIAETGTSAFGINQTTFPTDVYAIVQVLWGSIGFTVG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA MAAEE+D  KRVILF G+GSLQLT QEISTM+RW LKPY+FVLNN GYTIEKLI
Sbjct: 421 ALLGATMAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLKPYIFVLNNNGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGP A+YNEIQ W+HL LLPTFGAKDYE  R++TTGEW+KL +DKDF  NS+IRLIE+ML
Sbjct: 481 HGPYADYNEIQGWDHLALLPTFGAKDYENHRIATTGEWDKLTQDKDFQDNSRIRLIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PV DAPE+LV+QAQLTA+ NAK
Sbjct: 541 PVFDAPENLVQQAQLTASINAK 562

>Suva_7.369 Chr7 complement(627739..629430) [1692 bp, 563 aa] {ON}
           YLR134W (REAL)
          Length = 563

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/562 (79%), Positives = 503/562 (89%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLGRY+FERLKQV+V T+FGLPGDFNL LLD+IYEV+G+RWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGRYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKG+S LITTFGVGELSALNGIAGSYAEHVGVLH+VGVPSVSAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSALITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSAQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMS NISETT+MITD+ATAPSEIDR IRTT++ QRP YLGLP+N VD  VPASL
Sbjct: 121 DFTVFHRMSTNISETTSMITDIATAPSEIDRLIRTTFVTQRPSYLGLPANLVDLKVPASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+ PIDL+LKPND +AE+EVI T+LE+I+ +KNP+IL+DACASRH VK ET+KLID+TQF
Sbjct: 181 LNKPIDLSLKPNDPEAEKEVIDTVLELIQKSKNPIILSDACASRHHVKKETQKLIDLTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTP+GKGSIDE+HPR+GGVYVGTLS P VK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKPDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKNVVEFHSD+IK++NATFPGVQMKF LQ LL+ + +V+K YK VPVP   APN  V 
Sbjct: 301 YKTKNVVEFHSDYIKVKNATFPGVQMKFALQKLLSVIPSVIKSYKAVPVPTKTAPNKEVA 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            STPLKQ+WLWN++ +FLQEGD++++ETGTSAFGINQT FP + YGISQVLWGSIG+ TG
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIVSETGTSAFGINQTSFPKDAYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEELD ++RVILF G+GSLQLT QEISTMVRW LKPYLFVLNN GYTIEKLI
Sbjct: 421 ATLGAAFAAEELDPNRRVILFIGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGP AEYNEIQ W+HL LLPTFGAK YE  +V+TTGEW+KL  D +F KNS IRLIEL L
Sbjct: 481 HGPYAEYNEIQTWDHLALLPTFGAKKYENHKVATTGEWDKLTHDPEFQKNSVIRLIELKL 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PV DAPESL+KQA+LTAATNAK
Sbjct: 541 PVFDAPESLIKQAELTAATNAK 562

>SAKL0F04334g Chr6 complement(347639..349333) [1695 bp, 564 aa] {ON}
           uniprot|Q6XAE9 Saccharomyces kluyveri PDC13 Pyruvate
           decarboxylase
          Length = 564

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/562 (78%), Positives = 500/562 (88%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLGRY+FERLKQV V T+FGLPGDFNL LLD+IYEV G+RWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGRYLFERLKQVQVQTIFGLPGDFNLSLLDKIYEVPGLRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YAR+KGMSC++TTFGVGELSALNGIAGSYAEHVGVLH+VGVPSVS+QA+QLLLHHTLGNG
Sbjct: 61  YARVKGMSCIVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVSSQAQQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMS+ ISETTA+ITD+  AP EIDRCI+ TY +QRPVYLGLP+N VD  V ASL
Sbjct: 121 DFTVFHRMSSEISETTAVITDIKDAPKEIDRCIKVTYSKQRPVYLGLPANLVDLKVSASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           LDTPIDL++ PND  AE+EV+ T+L M+  AKNPVILADAC +RHDVK ETKKLID+TQF
Sbjct: 181 LDTPIDLSMTPNDADAEDEVVETVLAMVSKAKNPVILADACCTRHDVKRETKKLIDLTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTPMGKGSIDE HPRFGGVYVGTLS P VKEAVESADLVLSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDEDHPRFGGVYVGTLSDPEVKEAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSD+ K+RNATFPGVQMK VLQ LL+KV      YKPVPVP+    N  V+
Sbjct: 301 YKTKNIVEFHSDYTKVRNATFPGVQMKLVLQKLLSKVSDAASGYKPVPVPKGTRSNPGVE 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            STPLKQ+W+WN +  +L+EGD+V+TETGTSAFGINQ+ FPN+TYGISQVLWGSIGY+ G
Sbjct: 361 SSTPLKQEWIWNHISDWLEEGDVVITETGTSAFGINQSRFPNSTYGISQVLWGSIGYSVG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           +CLGA  AAEELDK++RVILF G+GSLQLT QEISTMVRW LKPYLFVLNN GYTIE+LI
Sbjct: 421 SCLGAAFAAEELDKNRRVILFVGDGSLQLTVQEISTMVRWGLKPYLFVLNNDGYTIERLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HG TA+YN++Q W HL+LLPTFGAKDY++IR+STTGE+ KL ED+ F++NSKIRLIE+ML
Sbjct: 481 HGETAQYNDVQPWLHLNLLPTFGAKDYDSIRISTTGEFLKLTEDQAFSRNSKIRLIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP +LVKQAQLTAATNAK
Sbjct: 541 PVMDAPSTLVKQAQLTAATNAK 562

>TBLA0B10060 Chr2 complement(2418979..2420673) [1695 bp, 564 aa]
           {ON} 
          Length = 564

 Score =  915 bits (2364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/562 (78%), Positives = 500/562 (88%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MS+ITLG+Y+FERL QV V T+FGLPGDFNL LLD+IYEV GMRWAGN NELNA+YAAD 
Sbjct: 1   MSQITLGKYLFERLNQVKVQTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGM+CLITTFGVGELSALNGIAGSYAEHVGVLH+VGVPSV++QAK+LLLHHTLGNG
Sbjct: 61  YARIKGMACLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSVASQAKKLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DF  FHRMSA ISETTAMITD+A AP+EIDRCIRTTY+ QR VYLGLP+N VD MVPASL
Sbjct: 121 DFDAFHRMSAEISETTAMITDIANAPAEIDRCIRTTYVTQRTVYLGLPANLVDLMVPASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDLALKPN  ++E EVI T+L+M+K+AKNP+I+ADACASRH+VK ET++LIDITQF
Sbjct: 181 LETPIDLALKPNCPESESEVIETILDMVKNAKNPIIIADACASRHNVKKETEQLIDITQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+F TPMGKGSI+EKHPRFGGVYVGTLS P +K+AVESADL+LSVGALLSDFNTGSFSY+
Sbjct: 241 PAFTTPMGKGSINEKHPRFGGVYVGTLSRPEIKQAVESADLILSVGALLSDFNTGSFSYA 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           Y+TKN+VEFHSDH+KI+NATF GVQMKFVL+ L+ K+G  +KDYKPV VP     N  V 
Sbjct: 301 YQTKNIVEFHSDHMKIKNATFQGVQMKFVLEKLIAKIGDYIKDYKPVAVPAAVPANKPVP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
             TPLKQ+WLWNQ+G FLQEGDIVLTETGTSAFGINQT FP +TYGISQVLWGSIG+  G
Sbjct: 361 AETPLKQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTTFPKDTYGISQVLWGSIGFTGG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
             LGA  AAEE++  KR ILF G+GSLQLT QEIST++RWNLKPYLFVLNN GYTIEKLI
Sbjct: 421 CVLGAAFAAEEINPDKRTILFIGDGSLQLTVQEISTLIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGPTA+YNEIQ WNHL +LPTFGAKDYEA+RV+TTGEW+KL  DK FNKNSKIR+IE+ML
Sbjct: 481 HGPTAQYNEIQGWNHLQILPTFGAKDYEAVRVATTGEWDKLTTDKAFNKNSKIRMIEIML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP +LV QAQLTAA NAK
Sbjct: 541 PVMDAPSNLVAQAQLTAAINAK 562

>NDAI0A02510 Chr1 complement(562483..564174) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  909 bits (2348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/562 (75%), Positives = 487/562 (86%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLGRY+FERL QV V T+FGLPGDFNL LLD++YEV GMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKVYEVAGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLH+VG PS ++QAK LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTTSQAKGLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMS+NISETTAM+TD+  AP+EIDRCIRTTYI QRPVYLG+P+NF D  VPA+L
Sbjct: 121 DFTVFHRMSSNISETTAMLTDITAAPAEIDRCIRTTYIAQRPVYLGIPANFFDLKVPANL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL+L  N+ +AE+E +  +LE++K +KNP+I+ DACASRHDVKAET KLI++TQF
Sbjct: 181 LNTPIDLSLHENEPEAEKEALGMVLELVKKSKNPIIVVDACASRHDVKAETNKLIELTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTPMGKG+I+E+HPR+GGVYVGTLS P VKEAVESADL+LS+GALLSDFNTGSFSYS
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGTLSRPEVKEAVESADLILSIGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           Y TK+VVEFHSD+++I+ ATFPGVQMKF+L  L   +   V+ YKP PVP     NA + 
Sbjct: 301 YDTKSVVEFHSDYVRIKKATFPGVQMKFLLDKLNYIIPNYVQSYKPRPVPTRVPDNAPIG 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
           PST LKQ WLWNQ+ +FL+EGDIV+ ETGTS FGIN+T FP N   ISQVLWGSIG+ATG
Sbjct: 361 PSTSLKQAWLWNQLSKFLKEGDIVIVETGTSGFGINETTFPKNVTCISQVLWGSIGFATG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
             LGA MAAEELD  +RVILFTG+GSLQLT QEISTM+RWNLKPYLFVLNNKGYTIEKLI
Sbjct: 421 CTLGATMAAEELDPKRRVILFTGDGSLQLTVQEISTMIRWNLKPYLFVLNNKGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGPTA YNEIQ+W HL LL TFGAKDYE  RVSTTG WN++  DK FN+NSKIR+IE+ML
Sbjct: 481 HGPTAAYNEIQHWEHLKLLETFGAKDYENYRVSTTGAWNEMTGDKKFNENSKIRMIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAPESL+KQ +LTA  N+K
Sbjct: 541 PVMDAPESLIKQGELTAQINSK 562

>YGR087C Chr7 complement(651290..652981) [1692 bp, 563 aa] {ON}
           PDC6Minor isoform of pyruvate decarboxylase,
           decarboxylates pyruvate to acetaldehyde, involved in
           amino acid catabolism; transcription is glucose- and
           ethanol-dependent, and is strongly induced during sulfur
           limitation
          Length = 563

 Score =  904 bits (2336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/562 (77%), Positives = 498/562 (88%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLG+Y+FERLKQV+V T+FGLPGDFNL LLD+IYEV+G+RWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLSLLDKIYEVDGLRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKG+S L+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+SAQAKQLLLHHTLGNG
Sbjct: 61  YARIKGLSVLVTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISAQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETT+MITD+ATAPSEIDR IRTT+I QRP YLGLP+N VD  VP SL
Sbjct: 121 DFTVFHRMSANISETTSMITDIATAPSEIDRLIRTTFITQRPSYLGLPANLVDLKVPGSL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+ PIDL+LKPND +AE+EVI T+LE+I+++KNPVIL+DACASRH+VK ET+KLID+TQF
Sbjct: 181 LEKPIDLSLKPNDPEAEKEVIDTVLELIQNSKNPVILSDACASRHNVKKETQKLIDLTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTP+GKGSIDE+HPR+GGVYVGTLS   VK+AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDEQHPRYGGVYVGTLSKQDVKQAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKNVVEFHSD++K++NATF GVQMKF LQ+LL  +  VVK YK VPVP     N  V 
Sbjct: 301 YKTKNVVEFHSDYVKVKNATFLGVQMKFALQNLLKVIPDVVKGYKSVPVPTKTPANKGVP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            STPLKQ+WLWN++ +FLQEGD++++ETGTSAFGINQT FP + YGISQVLWGSIG+ TG
Sbjct: 361 ASTPLKQEWLWNELSKFLQEGDVIISETGTSAFGINQTIFPKDAYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEE+D +KRVILF G+GSLQLT QEISTM+RW LKPYLFVLNN GYTIEKLI
Sbjct: 421 ATLGAAFAAEEIDPNKRVILFIGDGSLQLTVQEISTMIRWGLKPYLFVLNNDGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGP AEYNEIQ W+HL LLP FGAK YE  +++TTGEW+ L  D +F KNS IRLIEL L
Sbjct: 481 HGPHAEYNEIQTWDHLALLPAFGAKKYENHKIATTGEWDALTTDSEFQKNSVIRLIELKL 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PV DAPESL+KQAQLTAATNAK
Sbjct: 541 PVFDAPESLIKQAQLTAATNAK 562

>KLTH0D08272g Chr4 complement(695296..696987) [1692 bp, 563 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044C PDC1 Major of three pyruvate
           decarboxylase isozymes key enzyme in alcoholic
           fermentation decarboxylates pyruvate to acetaldehyde
           subject to glucose- ethanol- and autoregulation involved
           in amino acid catabolism and to YLR134W uniprot|P16467
           Saccharomyces cerevisiae YLR134W PDC5 Minor isoform of
           pyruvate decarboxylase, key enzyme in alcoholic
           fermentation, decarboxylates pyruvate to acetaldehyde,
           regulation is glucose- and ethanol-dependent, repressed
           by thiamine, involved in amino acid catabolism
          Length = 563

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/563 (76%), Positives = 493/563 (87%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MS ITLGRY+FERL+QV+  T+FGLPGDFNLRLLDEIYEVEGMRWAGN NELNA+YAAD 
Sbjct: 1   MSSITLGRYLFERLRQVECFTIFGLPGDFNLRLLDEIYEVEGMRWAGNTNELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YAR+KG++CLITTFGVGELSALNG+ GSYAEHVGVLH+VGVPS+++QAKQ LLHHTLG+G
Sbjct: 61  YARLKGIACLITTFGVGELSALNGVVGSYAEHVGVLHVVGVPSLASQAKQQLLHHTLGDG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DF VFHRMSANIS+TTAM+TDLATAP EIDRCIRTTY+ QRPVYLGLP+N V+QMV   L
Sbjct: 121 DFAVFHRMSANISQTTAMVTDLATAPQEIDRCIRTTYVTQRPVYLGLPANIVNQMVDRRL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           LDTPIDL+L+PND+  EEEV++ +L +++ A+NP+ILADAC SRHD K E  +L D TQF
Sbjct: 181 LDTPIDLSLEPNDEDTEEEVLTQVLALVQKAQNPIILADACCSRHDAKKEAWQLTDATQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P FVTPMGKGS+ EKHPRFGGVYVGTLSSP VK AVE+ADL+LS+GALLSDFNTGSFSYS
Sbjct: 241 PCFVTPMGKGSVPEKHPRFGGVYVGTLSSPDVKSAVEAADLILSLGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           Y T+NVVEFHSDH K+RNA FP V MKFVLQ L+ ++ A ++ Y P PVP  PA NA   
Sbjct: 301 YGTRNVVEFHSDHTKVRNAIFPRVGMKFVLQKLIQRIPAAIQHYSPRPVPTRPARNAPTP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
             TPL Q+WLW Q+G+FL+EGD+V+TETGTSAFGINQT FPNNTYGISQVLWGSIG+ TG
Sbjct: 361 RDTPLTQEWLWTQIGEFLREGDVVVTETGTSAFGINQTRFPNNTYGISQVLWGSIGFTTG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA MAAEELDK+KRVILF G+GSLQLT QEIS+MVRW L+PYLFV NN GYTIEKLI
Sbjct: 421 ATLGAAMAAEELDKNKRVILFIGDGSLQLTVQEISSMVRWGLRPYLFVPNNDGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGPTA+YNEIQNW+HL LLPTFGA DYEA+RV+TTGEW+ L  D  FN+NS+IRL+E+ML
Sbjct: 481 HGPTAQYNEIQNWHHLRLLPTFGATDYEAVRVATTGEWDALTNDPAFNRNSRIRLVEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAKS 592
            VMDAP SLV+QAQLTAATNA++
Sbjct: 541 EVMDAPSSLVRQAQLTAATNAQN 563

>KNAG0J01330 Chr10 complement(240650..242344) [1695 bp, 564 aa] {ON}
           
          Length = 564

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/562 (76%), Positives = 494/562 (87%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MS ++LG Y+FERLKQV V T+FGLPGDFNL LLD+IY++ GMRW GN NELNASYAAD 
Sbjct: 1   MSTVSLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDIPGMRWVGNANELNASYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGM+CL+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS  +QAK LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTLSQAKGLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DF VFHRMSA ISETTA+ITDL+ A SEIDRCIRTTY++QR VYLG+P+N  D  +P SL
Sbjct: 121 DFDVFHRMSAEISETTAVITDLSKAASEIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           LDTPIDL+LK N+ ++E EV+ T+L+++  AKNP+ILADACASRHDVK ET++LID TQF
Sbjct: 181 LDTPIDLSLKANNPESESEVLDTILDLVSKAKNPIILADACASRHDVKKETQQLIDATQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTPMGKGSIDE HPR+GG+YVGTLSSPAVK+AVESADLVLSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGSIDETHPRYGGIYVGTLSSPAVKKAVESADLVLSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           Y+TKN+VEFHSDHIKIRNA FP +QMK +LQ L+ ++  V+ +Y PV VP     NAAVD
Sbjct: 301 YQTKNIVEFHSDHIKIRNALFPDMQMKSILQKLITQIKPVIANYSPVAVPARAPANAAVD 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
           PSTPLKQ+W+W ++G FLQEGDIV+TETGTSAFGIN T FP NT GISQVLWGSIG+  G
Sbjct: 361 PSTPLKQEWMWKELGNFLQEGDIVITETGTSAFGINGTTFPKNTVGISQVLWGSIGFTGG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEE+D ++RVILF G+GSLQLT QEIST ++WNLKPYLF+LNN GYTIEKLI
Sbjct: 421 AVLGAAFAAEEIDPNRRVILFIGDGSLQLTVQEISTCIKWNLKPYLFILNNNGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGPTA+YNEIQ+W HL LLPTFGAKDYEA+R++T GEWNKL +DK+FNKNS+IRLIE+ML
Sbjct: 481 HGPTAQYNEIQSWEHLQLLPTFGAKDYEAVRIATVGEWNKLTQDKEFNKNSRIRLIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAPESL+KQ QLTAA NAK
Sbjct: 541 PVMDAPESLIKQGQLTAAINAK 562

>KAFR0E01520 Chr5 complement(306988..308679) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/562 (76%), Positives = 493/562 (87%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLGRY+FERL QVDV T+FGLPGDFNL LLD+IYEV GMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGRYLFERLSQVDVKTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHH+LGNG
Sbjct: 61  YARIKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHSLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTA++TD+ATA +EIDRCI+TTYI QRPVYLG+P+N  D  +PA L
Sbjct: 121 DFTVFHRMSANISETTAVLTDIATAAAEIDRCIKTTYITQRPVYLGIPANMFDFKLPAKL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL+LKPND +AE+EVI  +L ++K AKNPVIL+DACASRH+V+ ET++LID TQF
Sbjct: 181 LETPIDLSLKPNDPEAEDEVIDAILSLVKAAKNPVILSDACASRHNVRKETRQLIDATQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+F TPMGKGSIDE+HPR+GGVYVGTLS P VK+AVES+DL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFTTPMGKGSIDEQHPRYGGVYVGTLSRPEVKKAVESSDLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKNVVEFHSD+ KI+NATFPGVQMKFVLQ L   +   VK YKP+PVP     N    
Sbjct: 301 YKTKNVVEFHSDYTKIKNATFPGVQMKFVLQKLSKVIDQTVKGYKPIPVPAKVPSNKPCS 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
           PSTPL Q+W+WNQ  +F QEGDI++TETGT+AFGINQ+ FP +  GISQVLWGSIG+  G
Sbjct: 361 PSTPLSQEWMWNQASKFFQEGDIIITETGTAAFGINQSEFPTHAVGISQVLWGSIGFTGG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEELD ++RVILF G+GSLQLT QEISTM+RWNL+PYLFVLNN GYTIEKLI
Sbjct: 421 AVLGAAFAAEELDINRRVILFIGDGSLQLTVQEISTMIRWNLRPYLFVLNNNGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HG  A+YNEIQNW HL LL TFGAKDYE  R++TTGEW+ L  +KDFNKNS+IRLIE+ML
Sbjct: 481 HGENAQYNEIQNWKHLKLLETFGAKDYENHRIATTGEWDALLSNKDFNKNSRIRLIEIML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP +LV+QA++TAATNA+
Sbjct: 541 PVMDAPSNLVQQAKITAATNAQ 562

>TBLA0D02840 Chr4 complement(694649..696340) [1692 bp, 563 aa] {ON}
           Anc_2.390 YDL080C
          Length = 563

 Score =  899 bits (2323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/562 (75%), Positives = 491/562 (87%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MS++TLGRY+FERL Q+ + T+FGLPGDFNL LLD+IYE+ GMRW GN NELNA+YAAD 
Sbjct: 1   MSQVTLGRYLFERLNQIKIQTIFGLPGDFNLPLLDKIYEIPGMRWVGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+ AQAK+LLLHHTLG+G
Sbjct: 61  YARIKGMSCMITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSLEAQAKKLLLHHTLGDG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DF  F+RMS+ ISET  MI D+ TAP+EIDRCI+T Y+ QRPVYLGLP N V+ MVP SL
Sbjct: 121 DFNAFYRMSSEISETAVMIKDVTTAPAEIDRCIKTAYVMQRPVYLGLPVNLVNAMVPVSL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L TPIDL+L+PND  +E EVI T+LEM+K AKNP+I+ADACASRHDVKAET+KLIDITQF
Sbjct: 181 LQTPIDLSLRPNDADSESEVIQTILEMVKQAKNPIIIADACASRHDVKAETEKLIDITQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           PSFVTPMGKGSI+E+HPRFGGVYVGTL+ P VK+AVESADL+LS+GALLSDFNTGSFSY+
Sbjct: 241 PSFVTPMGKGSINEQHPRFGGVYVGTLTRPEVKKAVESADLILSIGALLSDFNTGSFSYN 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           Y+TKNV+EFHSDH KI+NA + G+QMKFVL  L+ K+G VVK+YKPV VP     N    
Sbjct: 301 YETKNVIEFHSDHTKIKNAVYEGIQMKFVLSKLITKIGEVVKNYKPVAVPAPILANPKTS 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
           P TPL+Q+WLWNQ+G FLQEGDIVLTETGTSAFGINQT+FP NTYGISQVLWGSIG+  G
Sbjct: 361 PETPLRQEWLWNQLGNFLQEGDIVLTETGTSAFGINQTYFPKNTYGISQVLWGSIGFTGG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
             LGA  AAEE+D  KRV+LF G+GSLQLT QEISTMV WNLKPYLFVLNN GYTIE+LI
Sbjct: 421 CVLGAAFAAEEIDPKKRVVLFIGDGSLQLTVQEISTMVNWNLKPYLFVLNNDGYTIERLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGPTA+YNEIQ WN+L+LL TFGAKDY+A+RV+TTGEWN L ++ +FN+NSKIR+IE+ML
Sbjct: 481 HGPTAQYNEIQPWNNLELLSTFGAKDYQAVRVATTGEWNILTQNPEFNQNSKIRMIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           P MDAP +L+ QA+LTA+ NAK
Sbjct: 541 PTMDAPSNLISQAELTASINAK 562

>TBLA0E03070 Chr5 (771183..772874) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/561 (75%), Positives = 483/561 (86%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEITLG+Y+FERLKQV+V T+FGLPGDFNL LLD+IYEV GMRWAGN NELNA+YAAD 
Sbjct: 1   MSEITLGKYLFERLKQVNVNTIFGLPGDFNLALLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS ++QAK+LLLHHTLGNG
Sbjct: 61  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTTSQAKKLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DF VFHRMS  ISETTAMITDL+ A S+ID CIR TY  QRPVYLG+P+N  D  +PA L
Sbjct: 121 DFDVFHRMSTEISETTAMITDLSKAASQIDNCIRVTYTTQRPVYLGIPANMFDFTLPAKL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPI++ L PN+Q++E+EV+ T+L M+K AKNPVI+ADAC SRH+VKAET+KLID TQF
Sbjct: 181 LETPINMKLSPNNQESEDEVVETILRMVKGAKNPVIIADACCSRHNVKAETEKLIDATQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+F TPMGKGSI+E HPRFGGVYVGTL+ P VK+AVESADL+LSVGALLSDFNTG+FSY 
Sbjct: 241 PAFTTPMGKGSINEHHPRFGGVYVGTLTRPEVKKAVESADLILSVGALLSDFNTGTFSYD 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           Y+TKN+VEFHSDHIKI+NATF GVQMKFVL  L+ ++G  VKDYKPVPVP     N    
Sbjct: 301 YETKNIVEFHSDHIKIKNATFQGVQMKFVLDRLIKEIGDYVKDYKPVPVPAGIPDNKPCP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
             TPL+Q+WLWNQ+G FLQEGDIVLTETGTSAFGIN T FP NTYGI+QVLWGSIG+  G
Sbjct: 361 DETPLQQEWLWNQLGNFLQEGDIVLTETGTSAFGINHTKFPKNTYGINQVLWGSIGFTGG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
             LGA  AAEE+D  KRV LF G+GSLQLT QEISTM+RWNLKPYLFVLNN GYTIEKLI
Sbjct: 421 CVLGAAFAAEEIDPKKRVHLFIGDGSLQLTVQEISTMIRWNLKPYLFVLNNNGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGPTA+YNEIQ W+HL +LPTFGA DYEAIRV+T GEWNKL  D  FNKNSKIR+IE+ML
Sbjct: 481 HGPTAQYNEIQGWDHLSILPTFGATDYEAIRVATIGEWNKLTTDDKFNKNSKIRMIEIML 540

Query: 570 PVMDAPESLVKQAQLTAATNA 590
           PVMDAP +L+ Q +LT A NA
Sbjct: 541 PVMDAPSNLIAQGKLTEAINA 561

>KNAG0M01250 Chr13 complement(229749..231440) [1692 bp, 563 aa] {ON}
           Anc_5.122 YLR044C
          Length = 563

 Score =  888 bits (2294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/562 (75%), Positives = 488/562 (86%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           M ++TLGRY+FERL QVDV T+FGLPGDFNL LLD+IYEV GMRWAGN NELNA+YAAD 
Sbjct: 1   MPDLTLGRYLFERLYQVDVKTIFGLPGDFNLSLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YAR+KGM+C+ITTFGVGELSALNGIAGSYAEHVGVLH+VGVPS+S+QAKQLLLHHTLGNG
Sbjct: 61  YARVKGMACIITTFGVGELSALNGIAGSYAEHVGVLHVVGVPSISSQAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMSANISETTAM+TD+ TAP+EIDRCIRTTY+ QRPVYLGLP+N VD  VP  L
Sbjct: 121 DFTVFHRMSANISETTAMVTDIGTAPAEIDRCIRTTYVTQRPVYLGLPANLVDLPVPTHL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL LKPNDQ+AE EVI T+LE+I++A NPVILADACA RHDVK ET KLID+TQF
Sbjct: 181 LETPIDLTLKPNDQEAENEVIETVLELIEEASNPVILADACAGRHDVKVETNKLIDMTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTPMGKG+IDE++PRFGGVYVGTLS+  V+ AVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPMGKGTIDERNPRFGGVYVGTLSNENVRNAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           YKTKN+VEFHSD+IKIRNATFPGVQMKFVL  LL  VG+ VK Y PVP+P    PN    
Sbjct: 301 YKTKNIVEFHSDYIKIRNATFPGVQMKFVLNKLLAVVGSAVKGYTPVPLPPRLTPNEPCP 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
           P T L+Q+W+WN+V +F ++GDI+LTETGT+AFGINQ+ FPNNT GISQVLWGSIG+  G
Sbjct: 361 PDTILRQEWMWNEVSKFFRDGDIILTETGTAAFGINQSLFPNNTIGISQVLWGSIGFTGG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LGA  AAEE+D SKRVILF G+GSLQLT QEIST++RW+LKPYLFVLNN GYTIE+LI
Sbjct: 421 AVLGASFAAEEIDPSKRVILFIGDGSLQLTVQEISTLIRWDLKPYLFVLNNNGYTIERLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGP A YN IQ W H  LL  FGA DYE ++++TTGEW  L +DK FN+ SKIR+IE+ML
Sbjct: 481 HGPNAGYNAIQPWRHTKLLEAFGANDYENVKITTTGEWQTLTQDKQFNEPSKIRMIEVML 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           PVMDAP +L+ QA+LTA  N+K
Sbjct: 541 PVMDAPSNLIAQAKLTACINSK 562

>NCAS0A14240 Chr1 (2804135..2805832) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  886 bits (2289), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/565 (75%), Positives = 490/565 (86%), Gaps = 2/565 (0%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MS I+LGRY+FERL QV V T+FGLPGDFNL LLD+IYEV GMRWAGN NELNA+YAAD 
Sbjct: 1   MSTISLGRYLFERLHQVSVDTIFGLPGDFNLTLLDKIYEVPGMRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YAR+KGM+CL+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS S+QAK LLLHHTLGNG
Sbjct: 61  YARVKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTSSQAKNLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFTVFHRMS+NISETT+++TD+A AP+EIDRCIR TYI+QRPVYLG+P+NF D  + A L
Sbjct: 121 DFTVFHRMSSNISETTSIVTDVAQAPAEIDRCIRETYIKQRPVYLGIPANFFDLPISAKL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL+L  ND++AE E I  +L ++KDA NP+IL DACASRHDVK ETKKLIDITQ+
Sbjct: 181 LNTPIDLSLHENDEEAETEAIDLVLGLVKDAVNPIILVDACASRHDVKEETKKLIDITQY 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTPMGKG+I+E+HPR+GGVYVG L+ PA+KEAVESADL+LSVGALLSDFNTGSFSY 
Sbjct: 241 PTFVTPMGKGAINEQHPRYGGVYVGNLTDPAIKEAVESADLILSVGALLSDFNTGSFSYG 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
            KTKNVVEFHSD++KIRNA+FPGVQMKFVLQ L  ++    K+YKPVPVP   A N  V 
Sbjct: 301 LKTKNVVEFHSDYVKIRNASFPGVQMKFVLQKLNRQLPPYTKNYKPVPVPTKTASNKNVA 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
            STP+KQ+W+WNQ+ +FLQEGDIV++ETGTS FGINQT FPNNT GISQVLWGSIG+ATG
Sbjct: 361 ASTPMKQEWMWNQLAKFLQEGDIVISETGTSGFGINQTSFPNNTTGISQVLWGSIGFATG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
             LGA MAAEE+D  KRVILFTG+GSLQLT QEISTMVRWNLKPYLFVLNN GYTIEKLI
Sbjct: 421 CTLGATMAAEEIDPKKRVILFTGDGSLQLTVQEISTMVRWNLKPYLFVLNNNGYTIEKLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKD--YEAIRVSTTGEWNKLAEDKDFNKNSKIRLIEL 567
           HG  A YNEIQ WNHL+L   FGAK+  +E  RVSTTGEWNKL E K F  N+KIR+IE+
Sbjct: 481 HGEHAGYNEIQPWNHLELFHAFGAKEGTFENHRVSTTGEWNKLTESKQFQDNTKIRMIEV 540

Query: 568 MLPVMDAPESLVKQAQLTAATNAKS 592
           MLPVMDAP SL+KQA+LTA+ NAK+
Sbjct: 541 MLPVMDAPTSLIKQAKLTASINAKN 565

>KNAG0J01340 Chr10 complement(243186..244883) [1698 bp, 565 aa] {ON}
           
          Length = 565

 Score =  877 bits (2265), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/565 (72%), Positives = 488/565 (86%), Gaps = 1/565 (0%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MS I+LG Y+FERLKQV V T+FGLPGDFNL LLD+IY+V G+RWAGN NELNA+YAAD 
Sbjct: 1   MSTISLGHYLFERLKQVGVNTIFGLPGDFNLVLLDKIYDVPGIRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YARIKGM+CL+TTFGVGELSALNGIAGSYAEHVGVLH+VG PS  +QA  LLLHHTLGNG
Sbjct: 61  YARIKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGTPSTHSQANGLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DF VFHRMSA ISETT MITD   A  +IDRCIRTTY++QR VYLG+P+N  D  +P SL
Sbjct: 121 DFDVFHRMSAQISETTEMITDPHKAADQIDRCIRTTYVKQRTVYLGIPANMFDYEMPRSL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           LDTPIDL+LK N+  +E +V+ T+L+ +KDAKNP+I++DACASRHDVK ET++LI+ITQF
Sbjct: 181 LDTPIDLSLKANNPTSERQVLDTILQSVKDAKNPIIISDACASRHDVKEETQQLINITQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P+FVTP+GKGSIDE HPR+GG+YVGTLS P VKEAVESADL+LSVGALLSDFNTGSFSYS
Sbjct: 241 PAFVTPLGKGSIDETHPRYGGIYVGTLSRPEVKEAVESADLILSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVP-ELPAPNAAV 388
           Y+TKNVVEFHSDH+KI+NA FPGVQM+ +L+ LL ++ AVVK Y PV VP ++PA + ++
Sbjct: 301 YETKNVVEFHSDHMKIKNAVFPGVQMEPLLRKLLKEIPAVVKGYNPVAVPAKIPANDKSI 360

Query: 389 DPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYAT 448
             + PL+Q+W+WNQ+ +FLQEGDI++TETGTSAFGIN T FP N  GISQVLWGSIG+  
Sbjct: 361 SATAPLRQEWMWNQLSEFLQEGDIIITETGTSAFGINGTTFPKNAVGISQVLWGSIGFTV 420

Query: 449 GACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKL 508
           GA LGA  AAEE+D  KRVILF G+GSLQLT QEISTM++WNLKPYLF+LNN GYTIEKL
Sbjct: 421 GALLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIKWNLKPYLFILNNNGYTIEKL 480

Query: 509 IHGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELM 568
           IHGPTAEYNEIQ+W+HL LLPT GAKDYEA+RV+T GEWNKL +DK+FNKNS+IR+IE+M
Sbjct: 481 IHGPTAEYNEIQSWDHLKLLPTLGAKDYEAVRVATVGEWNKLTQDKEFNKNSRIRVIEVM 540

Query: 569 LPVMDAPESLVKQAQLTAATNAKSA 593
           LPVMDAP+SL++Q +LT   NA S 
Sbjct: 541 LPVMDAPQSLIEQGKLTEKINANSG 565

>NDAI0D03270 Chr4 (778452..780017) [1566 bp, 521 aa] {ON} 
          Length = 521

 Score =  858 bits (2217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/521 (76%), Positives = 455/521 (87%)

Query: 72  MRWAGNCNELNASYAADAYARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVP 131
           MRWAGN NELNA+YAAD YAR+KGMSC+ITTFGVGELSALNGIAGSYAEHVGVLH+VG P
Sbjct: 1   MRWAGNANELNAAYAADGYARVKGMSCIITTFGVGELSALNGIAGSYAEHVGVLHVVGTP 60

Query: 132 SVSAQAKQLLLHHTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRP 191
           S ++QAK LLLHHTLGNGDFTVFHRMS+N+SETTAMITD+ TAP+EIDRCIRTTYI QRP
Sbjct: 61  STTSQAKNLLLHHTLGNGDFTVFHRMSSNLSETTAMITDVTTAPAEIDRCIRTTYIAQRP 120

Query: 192 VYLGLPSNFVDQMVPASLLDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACA 251
           VYLG+P+N+ D  VPA+LL+TPIDL L PN+ +AE+E +  +LE+IKD+KNP IL DACA
Sbjct: 121 VYLGIPANYFDLKVPAALLNTPIDLELHPNEPEAEKEALDMILELIKDSKNPAILVDACA 180

Query: 252 SRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLV 311
           SRHDVKAET KLI++TQFP FVTPMGKG+I+E+HPR+GGVYVGTLS P VK+AVESADL+
Sbjct: 181 SRHDVKAETNKLIELTQFPHFVTPMGKGAINEQHPRYGGVYVGTLSKPEVKKAVESADLI 240

Query: 312 LSVGALLSDFNTGSFSYSYKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVK 371
           LSVGALLSDFNTGSFSYSYKTKN+VEFHSD+IKIRNATFPGVQMKFVL  L   +  VV 
Sbjct: 241 LSVGALLSDFNTGSFSYSYKTKNIVEFHSDYIKIRNATFPGVQMKFVLDKLNAIIPEVVT 300

Query: 372 DYKPVPVPELPAPNAAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPN 431
            YKP  VP     N AV  +TPLKQ W+WNQ+ +FL+EGD+V+ ETGT  FGIN+T FP 
Sbjct: 301 GYKPTAVPARAPANKAVSGTTPLKQAWMWNQLSKFLKEGDVVIVETGTPGFGINETTFPK 360

Query: 432 NTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNL 491
           N  GISQVLWGSIGYATG  LGA MAAEELD  KRVILFTG+GSLQLT QEISTM+RWNL
Sbjct: 361 NVIGISQVLWGSIGYATGCTLGATMAAEELDPHKRVILFTGDGSLQLTVQEISTMIRWNL 420

Query: 492 KPYLFVLNNKGYTIEKLIHGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLA 551
           +PYLF+LNN GYTIEKLIHGPTA+YNEIQ+W+HL LL TFGAKDYE  RV+TTGEW KL 
Sbjct: 421 RPYLFILNNNGYTIEKLIHGPTAQYNEIQSWDHLKLLETFGAKDYENHRVATTGEWTKLT 480

Query: 552 EDKDFNKNSKIRLIELMLPVMDAPESLVKQAQLTAATNAKS 592
           E+KDFNKNS+IR+IE+MLPVMDAPESL+KQ +LTA  NAK+
Sbjct: 481 ENKDFNKNSRIRVIEVMLPVMDAPESLIKQGELTAKINAKN 521

>Ecym_3185 Chr3 (352629..354320) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AAL073W
          Length = 563

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/562 (65%), Positives = 460/562 (81%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MSEI++GRY+FERL QV V T+FGLPGDFNL LLD++YEV G+RWAGN NELNA+YAAD 
Sbjct: 1   MSEISIGRYLFERLNQVGVKTIFGLPGDFNLSLLDKLYEVPGLRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YAR+ GM CL+TTFGVGELSA+NGIAGSYAE + VLH+VGVPS   QAK+LLLHHTLG+G
Sbjct: 61  YARVNGMGCLVTTFGVGELSAINGIAGSYAECISVLHVVGVPSTMVQAKRLLLHHTLGDG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DFT FHRM   I++TTA+++D ATA SEIDRCI+T  +   PVYLG+P+N     + ASL
Sbjct: 121 DFTAFHRMYQRITKTTAILSDDATAASEIDRCIKTCIMTHGPVYLGVPANMATATIDASL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           L+TPIDL+ + NDQ AE EVI  +L +I++A+NP+IL+DACASR+D+K E K LIDITQF
Sbjct: 181 LETPIDLSPELNDQDAENEVIDAVLHLIQNARNPIILSDACASRYDIKEEIKTLIDITQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P++VTPMGK S++E+HPR+GGVY G++S P VK+AVESADL+LS+G+LL+D NTG+FS S
Sbjct: 241 PTYVTPMGKSSVNEQHPRYGGVYAGSISKPEVKKAVESADLILSIGSLLADMNTGNFSQS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD 389
           Y TK++VEFHS    I+NATF GVQMKFVLQ L  KVG VV++Y PVP+   P+PN  +D
Sbjct: 301 YSTKDIVEFHSTFTMIKNATFNGVQMKFVLQKLAEKVGDVVQNYVPVPIASKPSPNKPLD 360

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
           P TPL QQWLW +V  FL+EGDIV+ E+GT AFGIN+   P  T  ISQ+LWGSIGY  G
Sbjct: 361 PLTPLAQQWLWKEVSTFLKEGDIVIAESGTPAFGINEVTLPTGTRCISQLLWGSIGYTVG 420

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           ACLG  +A +E+D S+RVILF G+GSLQL  QE+STM+RW LKPYLFVLNN GYTIE+LI
Sbjct: 421 ACLGICLATQEIDPSRRVILFIGDGSLQLAVQELSTMIRWGLKPYLFVLNNDGYTIERLI 480

Query: 510 HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELML 569
           HGP A+YN+IQ WNHL LLP FGAK+YEA+R+ST G W++L +D +FN++SKIRLIEL+L
Sbjct: 481 HGPEAQYNDIQPWNHLQLLPDFGAKNYEAVRISTVGGWSQLTQDPEFNESSKIRLIELIL 540

Query: 570 PVMDAPESLVKQAQLTAATNAK 591
           P +D+ ++LVKQA++    N+K
Sbjct: 541 PRLDSTDALVKQAKMITDINSK 562

>CAGL0G02937g Chr7 complement(268985..270679) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P06169 Saccharomyces
           cerevisiae YLR044c PDC1 or uniprot|P16467 Saccharomyces
           cerevisiae YLR134w PDC5 or uniprot|P26263 Saccharomyces
           cerevisiae YGR087c PDC6
          Length = 564

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/564 (68%), Positives = 461/564 (81%), Gaps = 1/564 (0%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           M+EITLGRY+FERL Q+ + T+FGLPGDFNL LLD+IYEVEG+RWAGN NELNA+YAAD 
Sbjct: 1   MTEITLGRYLFERLHQIHIDTIFGLPGDFNLTLLDKIYEVEGLRWAGNANELNAAYAADG 60

Query: 90  YARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNG 149
           YAR+KGM+CL+TTFGVGELSALNGIAGSYAEHVGVLH+VGVPS  ++AKQLLLHHTLGNG
Sbjct: 61  YARLKGMACLLTTFGVGELSALNGIAGSYAEHVGVLHVVGVPSTVSRAKQLLLHHTLGNG 120

Query: 150 DFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASL 209
           DF  FHRMS+ ISETT +++D  TAP+EIDRCIR  Y+ QRPVYLG+P+N  D  V + L
Sbjct: 121 DFDAFHRMSSVISETTFIVSDPQTAPAEIDRCIRVCYLTQRPVYLGIPANMFDSKVSSKL 180

Query: 210 LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           LDTPIDLAL+PN   AE EV+  ++ MIK +K P+ILADAC SRHDVK ETK+LI++TQF
Sbjct: 181 LDTPIDLALRPNLPDAEREVLDEIITMIKASKRPIILADACTSRHDVKKETKRLIEVTQF 240

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           PSF TPMGKGSIDE  PRFGGVYVG LS P VK  VE +DLVLSVGALLSDFNTGSFSYS
Sbjct: 241 PSFTTPMGKGSIDEDTPRFGGVYVGNLSDPEVKTFVEESDLVLSVGALLSDFNTGSFSYS 300

Query: 330 YKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKP-VPVPELPAPNAAV 388
             T+NV+EFHSDH+KIRNATFPGVQMKFVL+ LL ++ AVVK       VP    P+  +
Sbjct: 301 LNTRNVIEFHSDHMKIRNATFPGVQMKFVLEKLLEELPAVVKGRTDNRVVPRQKEPSTTL 360

Query: 389 DPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYAT 448
           +    +KQ+W+W  VG+FLQEGD+V+TETGTS FGI ++ FP NT GISQVLWGSIGYA 
Sbjct: 361 NGKDAIKQEWMWKHVGKFLQEGDVVVTETGTSGFGIVESKFPRNTVGISQVLWGSIGYAL 420

Query: 449 GACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKL 508
           G+ +GA  AA+E+D  KRVILF G+GSLQLT QE+ST  RW L PY+FVLNN GYTIE+L
Sbjct: 421 GSTVGAAFAAQEIDPKKRVILFIGDGSLQLTVQELSTAARWGLTPYIFVLNNNGYTIERL 480

Query: 509 IHGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELM 568
           IHG T  YN+IQ+W+H  +LP FGAK+YE  RV+T GEWN +  DK FNKN K+R+IE+M
Sbjct: 481 IHGETQGYNDIQSWDHSLILPAFGAKNYENKRVATYGEWNDMVNDKQFNKNDKLRMIEVM 540

Query: 569 LPVMDAPESLVKQAQLTAATNAKS 592
           LP MD PE+L KQA+LTA+ NAK+
Sbjct: 541 LPTMDGPENLKKQAKLTASINAKN 564

>SAKL0E04972g Chr5 (403578..405413) [1836 bp, 611 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 611

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/559 (59%), Positives = 444/559 (79%), Gaps = 1/559 (0%)

Query: 24  NKPEITMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNA 83
           N P  +   I+LG Y+F+RL+Q+ V T+FGLPGDFN+ LLD+IYEV G+RWAGN NELNA
Sbjct: 5   NSPIASAHPISLGHYLFQRLRQLQVQTIFGLPGDFNMALLDKIYEVPGLRWAGNTNELNA 64

Query: 84  SYAADAYARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLH 143
           +YAAD YARIKG+ CL+TTFGVGELSA+NGIAGS+AEHV VLH+VG+P+  AQ K+LLLH
Sbjct: 65  AYAADGYARIKGLGCLVTTFGVGELSAINGIAGSFAEHVAVLHVVGMPASHAQVKKLLLH 124

Query: 144 HTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQ 203
           HTLGNGD+ VFHRM+AN++  T +++D  TA  EID+C++  + RQRPVYLG+P N  + 
Sbjct: 125 HTLGNGDYAVFHRMAANMAAYTTVLSDSETATKEIDKCLKIAWKRQRPVYLGIPMNLANM 184

Query: 204 MVPASLLDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKL 263
           +V  S+L  P+DL+LK ND + E++V++++++ +K AKNPVI+ADAC +RHDV  ET++L
Sbjct: 185 IVDGSMLQIPLDLSLKRNDPEVEKDVVNSIVQEMKRAKNPVIIADACVTRHDVIQETRRL 244

Query: 264 IDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNT 323
           +D+TQFP FVTPMGKG+IDE+HPRFGGVYVG++SSP V+E V+ AD +L  G +LSDFNT
Sbjct: 245 VDLTQFPVFVTPMGKGAIDEQHPRFGGVYVGSMSSPEVREVVDFADFILVAGTVLSDFNT 304

Query: 324 GSFSYSYKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPA 383
            SF++SYK KNVV  +++H K++NA +P +++KFVLQSLL  +  +   YKP PVPE+  
Sbjct: 305 SSFNFSYKAKNVVLLYANHAKLKNAMYPDMKLKFVLQSLLQSLSNITLPYKPQPVPEMIK 364

Query: 384 PNAAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGS 443
           P   +  + PL+Q+W+WNQ+  +  EGDIV+TETGTSAFGINQT FPNNT  ISQVLWGS
Sbjct: 365 PRVTLQDNVPLRQEWVWNQISHWFHEGDIVITETGTSAFGINQTRFPNNTRAISQVLWGS 424

Query: 444 IGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGY 503
           IGY+ GACLGA  A EEL    RVILF G+G+LQLT QEISTM+RW LKPYLFV+NNKGY
Sbjct: 425 IGYSLGACLGASFAVEELGTKNRVILFVGDGALQLTVQEISTMIRWGLKPYLFVMNNKGY 484

Query: 504 TIEKLIH-GPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKI 562
           TI++L+H   TA Y++IQ W++L LLP FGA +Y+A +V+T G++ KL  D  F  + K+
Sbjct: 485 TIDRLLHKSSTAGYHDIQPWDNLKLLPAFGAVNYDARKVTTVGDFLKLVHDPQFAIDDKL 544

Query: 563 RLIELMLPVMDAPESLVKQ 581
           ++IE++LP MDAP +L+ +
Sbjct: 545 KMIEVVLPSMDAPPALLNK 563

>ZYRO0A08426g Chr1 complement(675104..676858) [1755 bp, 584 aa] {ON}
           similar to uniprot|Q07471 Saccharomyces cerevisiae
           YDL080C THI3 Probable decarboxylase required for
           expression of enzymes involved in thiamine biosynthesis
           may have a role in catabolism of amino acids to
           long-chain and complex alcohols
          Length = 584

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/546 (52%), Positives = 403/546 (73%), Gaps = 1/546 (0%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           IT+  Y F RLKQ++V T+FGLPG+FN  L+D++Y +EG+RWAGN NELNA+YAAD YAR
Sbjct: 12  ITIADYFFHRLKQLEVLTIFGLPGEFNAPLIDKLYGIEGLRWAGNTNELNAAYAADGYAR 71

Query: 93  IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFT 152
           +KG+ C+I+TFGVGELSA+NGIAGSYAEHVG+LH+VG+P  SAQ +QLLLHHTLGNGD+T
Sbjct: 72  LKGLGCIISTFGVGELSAINGIAGSYAEHVGLLHVVGMPPTSAQTRQLLLHHTLGNGDYT 131

Query: 153 VFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLDT 212
           VFHRM+  +S  +A+I D      E+D CIR  YI QRPVY+G+P N V   V +  L+ 
Sbjct: 132 VFHRMATEVSCHSAVIIDTELCAQEVDECIRNAYIFQRPVYMGIPVNLVSMPVDSDRLNE 191

Query: 213 PIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSF 272
           PIDL++ PND   E EVI  +L     A NPVI+ADAC +RH ++AET++L   T+FP F
Sbjct: 192 PIDLSVPPNDTSKENEVIDQILTHFYKATNPVIVADACVTRHRIEAETEELCRRTKFPLF 251

Query: 273 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYKT 332
           VTPMGKGS+DE  P+FGGVY G++SSP+V+E V+ AD ++ +G +L+DF T +F ++Y+ 
Sbjct: 252 VTPMGKGSVDEGLPQFGGVYTGSISSPSVREVVDFADCLIVIGCMLADFETTTFHFNYRA 311

Query: 333 KNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDPST 392
             +V  +   +K ++AT+P + +K +L SLL  +      Y+  P P +  P   +  + 
Sbjct: 312 NELVLLYPTSVKFKHATYPDLSIKPLLHSLLANLQERQLSYQWQPRPRMVIPKLELPTTH 371

Query: 393 PLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACL 452
           PL+Q+W+WNQ+ Q+  EGD+++TETGTSAFGINQT+FP +T GISQ LWGS+GY+ GACL
Sbjct: 372 PLRQEWVWNQISQWFMEGDVIITETGTSAFGINQTNFPPHTLGISQALWGSVGYSLGACL 431

Query: 453 GAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGP 512
           GA MA +E  ++ RV+LF G+G+ QLTAQE+ST++RW L PY+F++NN+GY++++ +H  
Sbjct: 432 GAAMAVDEKPRTHRVVLFVGDGAFQLTAQELSTVIRWGLTPYIFIMNNQGYSVDRFLHS- 490

Query: 513 TAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELMLPVM 572
            A Y +IQ WN+  L   FGAKDYE+ ++ T G++  +  D  F+   +IR++E+MLP M
Sbjct: 491 NASYYDIQQWNYSTLPSVFGAKDYESRKIITVGDFQSMVNDPAFSVGDRIRILEIMLPPM 550

Query: 573 DAPESL 578
           D P++L
Sbjct: 551 DVPQAL 556

>KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 607

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/551 (51%), Positives = 411/551 (74%), Gaps = 1/551 (0%)

Query: 32  EITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYA 91
           EI L +Y+  RL+Q+ + T+FG+PG FN+ LL EI  V  M+WAGN NELNA+YAAD Y+
Sbjct: 14  EIPLAQYMLHRLRQLGIATIFGVPGGFNVPLLREICNVPQMKWAGNTNELNAAYAADGYS 73

Query: 92  RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDF 151
           RIK ++CL+TTFGVGELSA+NG+AGS+AEHVG+LH VG+P ++AQ ++LLLHHTLGNG++
Sbjct: 74  RIKHLACLVTTFGVGELSAVNGVAGSFAEHVGLLHFVGMPPLAAQRRRLLLHHTLGNGNY 133

Query: 152 TVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLD 211
            VFHR+ +++++ T+++TD  T   E+D+CI   + +QRPVYLG+P+N  D +V ++LL+
Sbjct: 134 KVFHRLGSDVTQYTSVLTDTETCSKEVDKCISIAFTKQRPVYLGVPTNISDTLVSSALLN 193

Query: 212 TPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPS 271
            P+DL+    + + +E+ ++ +L  +   ++P I+ DAC SRH+V AE ++L+++TQFP 
Sbjct: 194 IPLDLSAHEGNTEVQEDFVNAILSAMYKCRSPAIVVDACVSRHNVVAEVRQLVELTQFPV 253

Query: 272 FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYK 331
           F TPMGKG+I+E HPRFGG +VG++S P V+E V+ +D VL VGALLSDFN+ SF ++YK
Sbjct: 254 FCTPMGKGAINEHHPRFGGTFVGSISPPQVREVVDFSDFVLVVGALLSDFNSSSFHFAYK 313

Query: 332 TKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDPS 391
            KN     S + +++NA +P +++K  L+ LL K+      Y+P  VPE+  P   +  +
Sbjct: 314 AKNTALLFSSYARLKNAMYPDLELKTALRVLLTKLDPSKLRYRPEEVPEVIRPKIKLMSN 373

Query: 392 TPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGAC 451
            PL+Q+W+WNQ+  + +EGDIV+TETGTSAFG+NQ+ FPNNT  I+Q LWGS+GY+ GAC
Sbjct: 374 VPLRQEWVWNQISNWFREGDIVITETGTSAFGVNQSKFPNNTRCITQALWGSVGYSVGAC 433

Query: 452 LGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHG 511
           LGA  AA E   + RVILF G+G+LQLT QE+STM+RW LKP +FV+NN GYTI++L+H 
Sbjct: 434 LGASFAAREEGNNSRVILFVGDGALQLTVQELSTMIRWGLKPIIFVMNNSGYTIDRLLHR 493

Query: 512 PT-AEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELMLP 570
            + A Y++IQ W++L LLP FGA DY+   V T G++  L  D  F  N+KI+++E++LP
Sbjct: 494 KSNAGYHDIQAWDNLKLLPLFGALDYDTRVVKTVGDFLGLVSDPGFALNNKIKMVEVVLP 553

Query: 571 VMDAPESLVKQ 581
            MDAP +L+ +
Sbjct: 554 PMDAPPALMDK 564

>Kwal_47.17878 s47 (590664..592496) [1833 bp, 610 aa] {ON} YDL080C
           (THI3) - alpha-ketoisocaproate decarboxylase [contig
           204] FULL
          Length = 610

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/551 (51%), Positives = 405/551 (73%), Gaps = 1/551 (0%)

Query: 32  EITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYA 91
           +ITL +++  RL+Q+ +TT+F +PG F++  + +IY+   M+WAGN NELNA+YAAD Y+
Sbjct: 14  DITLAQFLVHRLRQLGITTIFAVPGGFSMPFIMQIYQTPQMQWAGNTNELNAAYAADGYS 73

Query: 92  RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDF 151
           RIK + CL TTFGVGELSA+NG+AG++AEHVG+LH+VG+P V+AQ KQLL HHTLGNGD+
Sbjct: 74  RIKRLGCLATTFGVGELSAVNGVAGAFAEHVGLLHVVGMPPVAAQVKQLLWHHTLGNGDY 133

Query: 152 TVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLD 211
            VFHR+ +++++   ++ D      E+D+CI     +QRPVYLG+P N  + +V + LL+
Sbjct: 134 QVFHRLGSDVAQYATVLRDAEACAQEVDKCIIIALTKQRPVYLGVPVNMNNVLVSSVLLN 193

Query: 212 TPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPS 271
            P+DL     +   E   ++T+L  I    NP I+ADAC SRH+V+AE K L+D+TQFP 
Sbjct: 194 VPLDLEPHATNPDTERRFVNTVLNAIYKCSNPAIIADACVSRHEVEAELKHLVDLTQFPV 253

Query: 272 FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYK 331
           F TPMGKGSIDE+HPRFGG +VG++SSP V+E V+ +D VL VGALLS+FNT SF ++Y+
Sbjct: 254 FCTPMGKGSIDEQHPRFGGTFVGSISSPQVREVVDFSDFVLVVGALLSEFNTSSFHFAYR 313

Query: 332 TKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDPS 391
           TKN V   SD+ K++NA +P + +K VL+++L K+      Y+P  VP++  P   +  +
Sbjct: 314 TKNSVLLFSDYAKLKNAIYPDLNLKTVLRAILAKLDPSKITYRPEQVPDVIKPRIKLMSN 373

Query: 392 TPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGAC 451
            PL+Q+W+W Q+ ++ +EGDIV+TETGTSAFG+NQ  FP++T  I+Q LWGS+GY+ GAC
Sbjct: 374 VPLRQEWVWGQISRWFREGDIVITETGTSAFGVNQAKFPSHTRCIAQALWGSVGYSVGAC 433

Query: 452 LGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHG 511
           LGA  AA E   + RVILF G+G+LQLT QEISTM+RW L P +F++NN GYTI++L+H 
Sbjct: 434 LGASFAAREEGCNSRVILFVGDGALQLTVQEISTMIRWGLTPIIFLMNNSGYTIDRLLHK 493

Query: 512 PT-AEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELMLP 570
            + A Y++IQ W++L +LPTFGA +YEA  V T G++  L  D  F  N KI+++E++LP
Sbjct: 494 KSNAAYHDIQTWDNLRILPTFGALNYEARAVRTVGDFLHLIHDTQFAVNDKIKMVEVVLP 553

Query: 571 VMDAPESLVKQ 581
            MDAP +L+ +
Sbjct: 554 PMDAPPALMDK 564

>YDL080C Chr4 complement(310642..312471) [1830 bp, 609 aa] {ON}
           THI3Probable alpha-ketoisocaproate decarboxylase, may
           have a role in catabolism of amino acids to long-chain
           and complex alcohols; required for expression of enzymes
           involved in thiamine biosynthesis
          Length = 609

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/556 (50%), Positives = 401/556 (72%), Gaps = 7/556 (1%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           I +  Y+F RL Q+++ T+FGL G+F++ LLD++Y +  +RWAGN NELNA+YAAD Y+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 93  IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFT 152
           +KG+ CLITTFGVGELSA+NG+AGSYAEHVG+LHIVG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 153 VFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLDT 212
           VFHR++++++  T +I D      E+D+CI+  +I QRPVY+G+P N V+  + ++ L+T
Sbjct: 135 VFHRIASDVACYTTLIIDSELCADEVDKCIKKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 213 PIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSF 272
           P+DL L  ND   E+EVIS +L  I  ++NP I+ DAC SR ++  ETK+L +  +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVISRILSFIYKSQNPAIIVDACTSRQNLIEETKELCNRLKFPVF 254

Query: 273 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYKT 332
           VTPMGKG+++E  P+FGGV+ G++S+P V+E V+ AD ++ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 333 KNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDPST 392
           KN    +S  +K++NAT+P + +K +LQ +L  +      Y+P   P +  P      + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKILANLDESKLSYQPSEQPSMMVPRPYPAGNV 374

Query: 393 PLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACL 452
            L+Q+W+WN++  + Q GDI++TETG SAFG+NQT FP NT GISQ LWGS+GY  GACL
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 453 GAVMAAEELDKSK------RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIE 506
           GA  A +E++K K      RVILF G+G+ QLT QE+ST+V+W L PY+FV+NN+GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 507 KLIHGPT-AEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLI 565
           + +H  + A Y +IQ WN+L LL  FG  +YE  ++ T GE+  +  D +F  N KIR+I
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMISDPNFATNDKIRMI 554

Query: 566 ELMLPVMDAPESLVKQ 581
           E+MLP  D P++L+ +
Sbjct: 555 EIMLPPRDVPQALLDR 570

>Suva_4.167 Chr4 complement(300197..302059) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/556 (50%), Positives = 400/556 (71%), Gaps = 7/556 (1%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           I +  Y+F RL Q+++ T+FGL G+F++ LLD++Y++  +RWAGN NELNA+YAAD Y+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 93  IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFT 152
           +KG+ CLITTFGVGELSA+NG+AGSYAEHVG+LHIVG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 153 VFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLDT 212
           VFHR++++++  T +I D      E+D+CI+  +I QRPVY+G+P N V+  + +  L+T
Sbjct: 135 VFHRIASDVACYTTLIVDSDLCADEVDKCIQKAWIEQRPVYMGMPVNQVNLPIESERLNT 194

Query: 213 PIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSF 272
           P+DL L  ND   E+EVI+ +L  I  +KNP I+ DAC SR ++  E K+L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSFIYKSKNPAIIVDACTSRQNLIEEAKELCSRLKFPIF 254

Query: 273 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYKT 332
           VTPMGKG+++E  P+FGGV+ G++S+P V+E V+ AD ++ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 333 KNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDPST 392
           KN    +S  +K++NAT+P + +K +LQ LL  +      Y+P   P +  P      + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKILLQKLLATLDESKLSYRPDEQPSMMVPRPYPAGNV 374

Query: 393 PLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACL 452
            L+Q+W+WN++ ++ Q GDI++TETG SAFG+NQT FP NT GISQ LWGS+GY  GACL
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 453 GAVMAAEELDKSK------RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIE 506
           GA  A +E++K K      RVILF G+G+ QLT QE+ST+V+W L PY+FV+NN+GY+++
Sbjct: 435 GAEFAVQEINKDKFPATKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 507 KLIHGPT-AEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLI 565
           + +H  + A Y +IQ WN+L LL  FG  +YE  ++ T GE+  +  D +F  N KIR+I
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMINDANFAVNDKIRMI 554

Query: 566 ELMLPVMDAPESLVKQ 581
           E+MLP  D P++L+ +
Sbjct: 555 EIMLPPRDVPQALLDR 570

>TDEL0G03210 Chr7 complement(597217..599037) [1821 bp, 606 aa] {ON}
           Anc_2.390 YDL080C
          Length = 606

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/568 (49%), Positives = 403/568 (70%), Gaps = 8/568 (1%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           I++  Y+F RLKQ+ + T+FGLPG FN  LLD++ E+ G+RWAGN NELNA+YAAD Y+R
Sbjct: 13  ISIAEYLFHRLKQLHIETIFGLPGAFNATLLDKLNEIPGLRWAGNTNELNAAYAADGYSR 72

Query: 93  IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFT 152
           +KG+ C+ITTFGVGELSA+NG+AGS+AEHVG+LH+VG+P  SAQ KQLLLHHTLGNGD+ 
Sbjct: 73  LKGLGCIITTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQTKQLLLHHTLGNGDYK 132

Query: 153 VFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLDT 212
           VFHRM++ ++  + +I D      E+D CI   +  Q+PVY+G+P N VD  V +  L+T
Sbjct: 133 VFHRMASEVTCYSTVINDKDLCGDEVDDCIAKAWTLQKPVYMGIPVNLVDTSVNSQRLNT 192

Query: 213 PIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSF 272
            ++L L  ND+Q E E++  +L+ +  +KNPVI+ADAC +RH +  ET +L   T FP F
Sbjct: 193 ALNLNLPSNDEQTENELVKQILQQLYKSKNPVIIADACVTRHRIVPETVELCQRTNFPIF 252

Query: 273 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYKT 332
            TPM KG+IDE  P FGGV++G++SSP V+E V  AD ++ +G +LSDF+T SF ++YKT
Sbjct: 253 ATPMSKGAIDETLPNFGGVFMGSISSPEVREVVNFADFLIVIGCMLSDFSTSSFHFNYKT 312

Query: 333 KNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDPST 392
           K  V  +   +K ++A +P +++K ++ +LL  +      Y+  P P++  P + +    
Sbjct: 313 KECVLLYPTSVKFKHAIYPDLRIKSLMANLLRNLNESKIKYQSQPTPQMIIPRSELPSRH 372

Query: 393 PLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACL 452
            L+ +W+WNQ+  + QEGDI++TETGTSAFGINQTHFP+++ GISQ LWGS+GY  GACL
Sbjct: 373 SLRHEWVWNQMSHWFQEGDIIITETGTSAFGINQTHFPHSSRGISQALWGSVGYTLGACL 432

Query: 453 GAVMAAEELDKSK------RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIE 506
           GA  AA E+ + +      RVILF G+G+ QLT QE+STM+RW L PY+FV+NN+GY+++
Sbjct: 433 GASFAANEMARDQVTAVPHRVILFVGDGAFQLTVQEVSTMIRWGLTPYIFVMNNQGYSVD 492

Query: 507 KLIHGPT-AEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLI 565
           + +H  + A Y +IQ W +L L+P FGA+ YE  ++ T G++ ++  D  F  N KIR++
Sbjct: 493 RFLHHRSNASYYDIQTWEYLRLIPLFGARHYETRKIVTVGDFLEMIHDPLFATNDKIRML 552

Query: 566 ELMLPVMDAPESLVKQAQLTAATNAKSA 593
           E+MLP MD P++L+ +  LT   N K A
Sbjct: 553 EIMLPPMDVPQALMDR-WLTEQENKKRA 579

>KNAG0A05900 Chr1 complement(880996..882858) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/579 (48%), Positives = 405/579 (69%), Gaps = 27/579 (4%)

Query: 18  SNRVSQNKPEITMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGN 77
           S ++  N P+    +IT+  Y+F RL+Q+ V T+FGLPG+FN+ LLD+IY +  MRWAGN
Sbjct: 6   SYKMQNNLPD----QITITDYLFHRLRQLKVKTIFGLPGEFNMPLLDKIYRIPDMRWAGN 61

Query: 78  CNELNASYAADAYARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQA 137
            NELNA+YAAD Y+RIK + CL+TTFGVGELSA+NG+AGS+AEHVG+LH+VG+P  SAQ 
Sbjct: 62  ANELNAAYAADGYSRIKRLGCLVTTFGVGELSAINGVAGSFAEHVGLLHVVGMPPTSAQT 121

Query: 138 KQLLLHHTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLP 197
           KQLLLHHTLGNGD+ VF+RM+ +++  T ++ D      E+D+C+   +  Q+P YLG+P
Sbjct: 122 KQLLLHHTLGNGDYNVFYRMANDVTCHTGLVADSDLCCMEVDKCVEMAWREQKPAYLGIP 181

Query: 198 SNFVDQMVPASLLDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVK 257
            N VD  V +  LDTP++L  +PN+Q+ E +V+ T+L+ +   +NP I+ DAC  RHD+ 
Sbjct: 182 VNQVDLTVDSVRLDTPLNLESEPNNQEIENDVVKTILKKLYTCENPAIIVDACVIRHDLV 241

Query: 258 AETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGAL 317
            ETK+   +T FP+FVTPMGKG++DE    FGGV+ G+LSSP+V+E V+ AD ++ +G+L
Sbjct: 242 EETKQFRQMTNFPTFVTPMGKGAVDESLSNFGGVFTGSLSSPSVREVVDFADFIIVIGSL 301

Query: 318 LSDFNTGSFSYSYKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLL-----NKVGAVVKD 372
           L++F+T +F + YKTKN    HS  +K++NAT+P + +K ++Q LL     +K+    ++
Sbjct: 302 LAEFSTPTFHFFYKTKNYALIHSSSVKLKNATYPDIHIKHLMQVLLSRLDTSKISCTFRN 361

Query: 373 YKPVPV--PELPAPNAAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFP 430
             P+ V  P+L         +  LKQ+W+WN++  + Q+GDI++TE GTSAFGINQT FP
Sbjct: 362 TPPINVSRPKLSG-------NQLLKQEWVWNELSHWFQQGDIIITEIGTSAFGINQTRFP 414

Query: 431 NNTYGISQVLWGSIGYATGACLGAVMAAEELDKSK--------RVILFTGEGSLQLTAQE 482
             T GISQ LW S GY+ GACLGA  AA+EL +          RV+LF G+G+ Q+T QE
Sbjct: 415 PRTKGISQALWASSGYSVGACLGASFAAQELQEENPGDASLQHRVLLFVGDGAFQITMQE 474

Query: 483 ISTMVRWNLKPYLFVLNNKGYTIEKLIHGPT-AEYNEIQNWNHLDLLPTFGAKDYEAIRV 541
           ISTM+RW L PY+F+LNN+GY++++ +H  + A Y ++Q W++L     FGA DYE  ++
Sbjct: 475 ISTMIRWKLTPYIFLLNNQGYSVDRFLHHRSKASYYDVQPWHYLKFFDAFGADDYETRKI 534

Query: 542 STTGEWNKLAEDKDFNKNSKIRLIELMLPVMDAPESLVK 580
            T G+   +  DK F K+ KIR++E+MLP  D P+ LV+
Sbjct: 535 VTLGDLRDVMNDKHFCKDDKIRMLEIMLPSTDVPQVLVE 573

>Skud_4.175 Chr4 complement(306124..307986) [1863 bp, 620 aa] {ON}
           YDL080C (REAL)
          Length = 620

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/556 (50%), Positives = 404/556 (72%), Gaps = 7/556 (1%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           I +  Y+F RL Q+++ T+FGL G+F++ LLD++Y++  +RWAGN NELNA+YAAD Y+R
Sbjct: 15  IAISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYDIPNLRWAGNSNELNAAYAADGYSR 74

Query: 93  IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFT 152
           +KG+ CLITTFGVGELSA+NG+AGSYAEHVG+LHIVG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 153 VFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLDT 212
           VFHR++++++  T +I D      E+D+CI+  +I QRPVY+G+P N V+  + ++ L+T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIKMAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 213 PIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSF 272
           P+DL L  ND   E+EVI+ +L ++  ++NP I+ DAC SR ++  ETK+L    +FP F
Sbjct: 195 PLDLQLHKNDPDVEKEVITRILSIMYKSQNPAIIVDACTSRQNLIEETKELCSRLKFPIF 254

Query: 273 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYKT 332
           VTPMGKG+++E  P+FGGV+ G++S+P V+E V+ AD ++ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETDPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 333 KNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDPST 392
           KN    +S  +K++NAT+P + +K +LQ LL  +      Y+P   P +  P      + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSVKLLLQKLLASLDESKLSYRPSEQPNMMVPRPYPAGNV 374

Query: 393 PLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACL 452
            L+Q+W+WN++ ++ Q GDI++TETG SAFG+NQT FP NT GISQ LWGS+GY  GACL
Sbjct: 375 LLRQEWVWNEISRWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 453 GAVMAAEELDKSK------RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIE 506
           GA  A +E++K++      RVILF G+G+ QLT QE+ST+V+W L PY+FV+NN+GY+++
Sbjct: 435 GAEFAVQEINKNEFPPTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 507 KLIHGPT-AEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLI 565
           + +H  + A Y +IQ WN+L LL  FG  +YE  ++ T GE+  L  D +F  N KIR+I
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCANYETKKIITVGEFRSLINDPNFAINDKIRMI 554

Query: 566 ELMLPVMDAPESLVKQ 581
           E+MLP  D P++L+ +
Sbjct: 555 EIMLPPRDVPQALLDR 570

>Smik_4.156 Chr4 complement(287087..288952) [1866 bp, 621 aa] {ON}
           YDL080C (REAL)
          Length = 621

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/556 (50%), Positives = 400/556 (71%), Gaps = 7/556 (1%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           I++  Y+F RL Q+++ T+FGL G+F++ LLD++Y +  +RWAGN NELNA+YAAD Y+R
Sbjct: 15  ISISDYLFHRLNQLNIHTIFGLSGEFSMPLLDKLYNIPNLRWAGNSNELNAAYAADGYSR 74

Query: 93  IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFT 152
           +KG+ CLITTFGVGELSA+NG+AGSYAEHVG+LHIVG+P  SAQ KQLLLHHTLGNGDFT
Sbjct: 75  LKGLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGDFT 134

Query: 153 VFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLDT 212
           VFHR++++++  T +I D      E+D+CIR  +I QRPVY+G+P N V+  + ++ L+T
Sbjct: 135 VFHRIASDVACYTTLIVDSELCADEVDKCIRKAWIEQRPVYMGMPVNQVNLPIESARLNT 194

Query: 213 PIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSF 272
           P+DL L  ND   E+EVIS +L  +  ++NP I+ DAC SR ++  E+K+L    +FP F
Sbjct: 195 PLDLQLPKNDPDVEKEVISRILSFMYKSQNPAIIVDACTSRQNLIEESKELCSRLKFPVF 254

Query: 273 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYKT 332
           VTPMGKG+++E  P+FGGV+ G++S+P V+E V+ AD ++ +G +LS+F+T +F + YKT
Sbjct: 255 VTPMGKGTVNETIPQFGGVFTGSISAPEVREVVDFADFIIVIGCMLSEFSTSTFHFQYKT 314

Query: 333 KNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDPST 392
           KN    +S  +K++NAT+P + +K +LQ LL  +      Y+P   P +  P      + 
Sbjct: 315 KNCALLYSTSVKLKNATYPDLSIKLLLQKLLASLDESKLSYRPNEQPSMMVPRPYPAGNV 374

Query: 393 PLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACL 452
            L+Q+W+WN++  + Q GDI++TETG SAFG+NQT FP NT GISQ LWGS+GY  GACL
Sbjct: 375 LLRQEWVWNEISHWFQPGDIIITETGASAFGVNQTRFPVNTLGISQALWGSVGYTMGACL 434

Query: 453 GAVMAAEELDKSK------RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIE 506
           GA  A +E+ K K      RVILF G+G+ QLT QE+ST+V+W L PY+FV+NN+GY+++
Sbjct: 435 GAEFAVQEIKKDKFPVTKHRVILFMGDGAFQLTVQELSTIVKWGLTPYIFVMNNQGYSVD 494

Query: 507 KLIHGPT-AEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLI 565
           + +H  + A Y +IQ WN+L LL  FG  +YE  ++ T GE+  + +D +F  N KIR+I
Sbjct: 495 RFLHHRSDASYYDIQPWNYLGLLRVFGCTNYETKKIITVGEFRSMIDDPEFAINDKIRMI 554

Query: 566 ELMLPVMDAPESLVKQ 581
           E+MLP  D P+ L+ +
Sbjct: 555 EIMLPPRDVPQVLLDR 570

>TPHA0G02620 Chr7 complement(547384..549450) [2067 bp, 688 aa] {ON}
           Anc_2.390 YDL080C
          Length = 688

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/593 (47%), Positives = 399/593 (67%), Gaps = 43/593 (7%)

Query: 32  EITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYA 91
           E+T+  Y+F RLKQ++V T+FGLPG+FN+ LLD++Y VEGMRWAGN NELNASYAAD Y+
Sbjct: 18  ELTVSEYLFHRLKQLNVNTIFGLPGEFNMSLLDKLYNVEGMRWAGNANELNASYAADGYS 77

Query: 92  RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDF 151
           R+K + CL+TTFGVGELS +NGIAGS++E+VG++HIVG+P +  Q  QLL+HHTLGNGD+
Sbjct: 78  RLKKLGCLMTTFGVGELSVINGIAGSFSENVGIIHIVGMPPIQIQRSQLLMHHTLGNGDY 137

Query: 152 TVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLD 211
            +FHR+S +I   +A++T       EID+C+   ++ Q+PVYLGLP N V   V ++LL+
Sbjct: 138 NIFHRLSDDIYCYSAVVTHPNLCIQEIDKCLSKAWLSQKPVYLGLPENLVSVKVKSTLLN 197

Query: 212 TPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPS 271
           TP+DL L  ND+  E   I  +L+ I  AKNP I+ADAC +RH V+ ET+ LI+ T+FP 
Sbjct: 198 TPLDLKLPNNDKDNENIAIDQILKKIYSAKNPAIIADACVTRHSVEKETQMLIEKTKFPY 257

Query: 272 FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYK 331
           FVTPMGKG +DE   +FGGV+VG++SS  V+E V+ ADL++ +G L SDF T SF ++YK
Sbjct: 258 FVTPMGKGGVDEYSKQFGGVFVGSISSAKVREIVDFADLIIVIGNLQSDFKTTSFHFTYK 317

Query: 332 TKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDP- 390
           TK++V   S  +K++N  +P + +K  L  L++ +      YKP+  P +  PN      
Sbjct: 318 TKDIVMISSSCVKLKNGLYPELHIKEFLGKLVDNIVTTKITYKPIISPIMNIPNNITSEE 377

Query: 391 --------------------STPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFP 430
                                T LKQ+W+WN+   + +EGDI++TETGTSAFGINQT FP
Sbjct: 378 SFESLTNYSKTPDKNDSNVNKTLLKQEWVWNEFSLWFREGDIIITETGTSAFGINQTKFP 437

Query: 431 NNTYGISQVLWGSIGYATGACLGAVMAAEELDKSK------RVILFTGEGSLQLTAQEIS 484
           N T GISQ LWGS GY+ GACLGA  AAEE+ +S       RVILF G+G+ QLT QE+S
Sbjct: 438 NRTIGISQTLWGSTGYSVGACLGASFAAEEIHQSNPNIEKPRVILFVGDGAFQLTMQELS 497

Query: 485 TMVRWNLKPYLFVLNNKGYTIEKLI----------------HGPTAEYNEIQNWNHLDLL 528
           TMV+WNL PY+F++NN+GY++++ +                     +Y +IQ W++L+L 
Sbjct: 498 TMVKWNLDPYIFLMNNQGYSVDRFLTHQSRRNNSNANNILKSNNNNDYFDIQLWDYLNLF 557

Query: 529 PTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELMLPVMDAPESLVKQ 581
             F A +YE  +V +  +  K+   K F+   +IR++E++LP MD P+SL+++
Sbjct: 558 NLFNAMNYETYKVLSCNDLLKILNSKSFSNEHRIRMVEIILPPMDVPKSLMER 610

>NCAS0A04000 Chr1 complement(806883..808760) [1878 bp, 625 aa] {ON}
           Anc_2.390
          Length = 625

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/574 (47%), Positives = 398/574 (69%), Gaps = 20/574 (3%)

Query: 26  PEITMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASY 85
           P+IT+SE     Y+F RLKQ+ + T+FGL G++N+ L+D++Y+V  +RWAGN NELNA+Y
Sbjct: 11  PQITISE-----YLFHRLKQLHIETIFGLSGEYNMPLIDKLYQVHNLRWAGNANELNAAY 65

Query: 86  AADAYARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHT 145
           AAD YAR+KG+  LITTFGVGELSALNG+AGS+AEHVG+LHIVG+P  SAQ KQLLLHHT
Sbjct: 66  AADGYARLKGLGVLITTFGVGELSALNGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHT 125

Query: 146 LGNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMV 205
           LGNGD++VFHR++++I+    +I D      E+D+CI   ++ QRPVY+G+P N V+ +V
Sbjct: 126 LGNGDYSVFHRIASDIAVYNTVIDDTDLCFQEVDKCITLAWMEQRPVYMGMPVNQVNLLV 185

Query: 206 PASLLDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLID 265
            +  LD P+DL +  N  +   E+ + +L+ I   K+P I+ DAC  RH+   E ++   
Sbjct: 186 DSKFLDIPLDLDMFENATEVNSEITNKILQKIYKCKHPAIVVDACTIRHECIDEVEEFCR 245

Query: 266 ITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGS 325
            T+FP FVTPMGKG+I+E  P FGGV++G+LSSP+V+E V+ AD ++ +G++LS+F+T +
Sbjct: 246 RTKFPVFVTPMGKGAINENTPHFGGVFMGSLSSPSVREVVDFADFIIVIGSMLSEFSTST 305

Query: 326 FSYSYKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPN 385
           F + +K K+ V   SD +KI+N+ +  + +K +++SLL+ +      Y     P +  P 
Sbjct: 306 FHFVFKVKDSVLLFSDLVKIKNSVYANIHIKPLMKSLLHSLDESKIKYIFEEAPSMILPK 365

Query: 386 AAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIG 445
             +     L+Q+W+WN++  + +EGDI++TE GTSAFGINQT FPN   GISQ LWGS G
Sbjct: 366 TKIPDDVLLRQEWVWNEISHWFREGDIIITEIGTSAFGINQTRFPNEAQGISQSLWGSSG 425

Query: 446 YATGACLGAVMAAEELDK--------------SKRVILFTGEGSLQLTAQEISTMVRWNL 491
           Y+ GACLG   A +E ++                RVILF G+G+ QLT QE+ST++RWNL
Sbjct: 426 YSLGACLGTSFAIQEFEREHNHNFHRHTQNVEKHRVILFVGDGAFQLTMQELSTIIRWNL 485

Query: 492 KPYLFVLNNKGYTIEKLIH-GPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKL 550
            PY+FVLNN+GY++++ +H    A Y +IQ WN+LDL+ TF AK+YE  ++ T G++  +
Sbjct: 486 TPYIFVLNNEGYSVDRFLHPEANASYYDIQPWNYLDLMATFNAKNYETKKIVTVGDFRDM 545

Query: 551 AEDKDFNKNSKIRLIELMLPVMDAPESLVKQAQL 584
            +D  F  N KIR++E++LP  D P++LV   +L
Sbjct: 546 VQDPLFAINDKIRMVEILLPSTDVPQALVDTWKL 579

>CAGL0L06842g Chr12 (771870..773786) [1917 bp, 638 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080c THI3
           or uniprot|P06169 Saccharomyces cerevisiae YLR044c PDC1
           or uniprot|P16467 Saccharomyces cerevisiae YLR134w PDC5
           or uniprot|P26263 Saccharomyces cerevisiae YGR087c PDC6
          Length = 638

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/582 (48%), Positives = 393/582 (67%), Gaps = 19/582 (3%)

Query: 31  SEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAY 90
           S+I++  Y+F RL Q+ + T+FGLPGDFN+ LLD++Y +  MRWAGN NELNA+YAAD Y
Sbjct: 11  SQISISEYLFHRLNQLKIWTIFGLPGDFNMPLLDKLYSIPTMRWAGNTNELNAAYAADGY 70

Query: 91  ARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGD 150
           +R+K + CLITTFGVGELSA+NG+AGSYAEHVG+LHIVG+P  SAQ KQLLLHHTLGNGD
Sbjct: 71  SRLKHLGCLITTFGVGELSAINGVAGSYAEHVGILHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 151 FTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLL 210
           ++VF+R++ +I+  TA+I D      E+D CIR  +  Q+PVYLG+P N VD  V +S L
Sbjct: 131 YSVFYRIANDIACHTAIINDTDLCADEVDNCIRAAWGYQKPVYLGVPVNQVDIPVDSSRL 190

Query: 211 DTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFP 270
           + PIDL++    ++ + +VI  LL+ +  A  P+I+ DAC  RHD   ET  L ++T FP
Sbjct: 191 NNPIDLSILKKTKETDAQVIDLLLKQMYSASKPIIVVDACVRRHDALKETHALCELTNFP 250

Query: 271 SFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSY 330
            FVTPMGKG+IDE +  FGGVY G+LSSP V+E  + AD VL +GA+L +F+T +F + +
Sbjct: 251 VFVTPMGKGTIDESYKNFGGVYSGSLSSPEVREVTDFADFVLFIGAILPEFSTSTFHFGF 310

Query: 331 KTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDP 390
           K KN        +KI+ ATFP + +K  LQSL++ +      YK     ++ AP      
Sbjct: 311 KKKNCCILFPTSVKIKKATFPDMLLKGTLQSLVDTIEPSKITYKHQAKVDIIAPKMEPSD 370

Query: 391 STPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGA 450
           S  L+Q+W+WN++  + +E DI++TETG+SAFGINQT FP NT GI+Q LWGS+G+A  +
Sbjct: 371 SNLLRQEWVWNEISHWFKENDIIITETGSSAFGINQTRFPTNTIGINQALWGSVGFALCS 430

Query: 451 CLGAVMAAEE------------------LDKSKRVILFTGEGSLQLTAQEISTMVRWNLK 492
           CLGA+ A EE                  +    R ILF G+G+ QLT QE+ST++RW LK
Sbjct: 431 CLGALFAVEEKTVVKHNLEIKLRNYNRNIFTENRTILFVGDGAFQLTVQELSTIIRWKLK 490

Query: 493 PYLFVLNNKGYTIEKLIHGPT-AEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLA 551
           PY+F++NN GY++++ +H  + A Y ++Q WN+L LL  FG   +E  ++ T  ++ +L 
Sbjct: 491 PYIFIMNNNGYSVDRFLHHRSDASYYDVQPWNYLYLLELFGCTSFETRKIVTVSDFKELL 550

Query: 552 EDKDFNKNSKIRLIELMLPVMDAPESLVKQAQLTAATNAKSA 593
            D+ F K  KIR+IE+MLP  D P++L+ + Q     + K A
Sbjct: 551 ADESFAKPDKIRMIEIMLPQSDVPKTLIARWQAEKELSNKRA 592

>NDAI0E01700 Chr5 (337856..339721) [1866 bp, 621 aa] {ON} Anc_2.390
          Length = 621

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/564 (48%), Positives = 391/564 (69%), Gaps = 15/564 (2%)

Query: 31  SEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAY 90
           S IT+  Y+F RLKQ+ + T+FGLPG+FN+ L+D++Y++  +RWAG+ NELNA+YAAD Y
Sbjct: 11  SYITIAEYIFHRLKQLKIETIFGLPGEFNMPLIDKLYKIPQLRWAGDANELNAAYAADGY 70

Query: 91  ARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGD 150
           +R+KG+  L+TTFGVGELSA+NG+AGS+AEHVG+LHIVG+P  SAQ KQLLLHHTLGNGD
Sbjct: 71  SRLKGLGVLVTTFGVGELSAINGVAGSFAEHVGLLHIVGMPPTSAQTKQLLLHHTLGNGD 130

Query: 151 FTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLL 210
           + VF R+++ ++  T +I D      E+D+CI   + RQ+PVY+G+P N VD  V +  L
Sbjct: 131 YNVFWRIASEVACHTVIINDTDLCFMEVDKCIEIAWKRQKPVYIGIPVNQVDIPVRSLHL 190

Query: 211 DTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFP 270
           + P+ L+   N      +V+  LL+ I  + +PVI+ D C  RH    E ++ I  T+FP
Sbjct: 191 NVPLTLSPDMNLNDIGNDVVQLLLQKIYKSTHPVIIVDGCIIRHGCIDEMEEFIQRTKFP 250

Query: 271 SFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSY 330
            FVTPMGKG+IDE +P F GV+ G++SSP+V+E V+ AD ++ +G +L+ FNT +F + Y
Sbjct: 251 VFVTPMGKGAIDENNPNFKGVFTGSISSPSVREVVDFADFLMVMGCMLAAFNTSTFHFGY 310

Query: 331 KTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDP 390
           K+KN    +SD IK  NAT+P V +K +LQSLL  +     +Y P   P++  P   +  
Sbjct: 311 KSKNRALLYSDSIKFNNATYPDVYLKPLLQSLLQNLDESQINYVPKETPKMIIPKRELPD 370

Query: 391 STPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGA 450
              L+Q+W+WN++  + QEGDI++TETGTSAFGINQT FPN   GISQ LWGS+GY+ GA
Sbjct: 371 DELLRQEWVWNEISHWFQEGDIIITETGTSAFGINQTRFPNEAQGISQALWGSVGYSLGA 430

Query: 451 CLGAVMAAEELDKS--------------KRVILFTGEGSLQLTAQEISTMVRWNLKPYLF 496
           CLG++ A +E  +                RVILF G+G+ QLT QE+ST+VRW L PY+F
Sbjct: 431 CLGSLFAVQEFQRDHNHDFHHHTQKSEKHRVILFVGDGAFQLTMQELSTIVRWKLTPYIF 490

Query: 497 VLNNKGYTIEKLIHGPT-AEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKD 555
           +LNN GY++++++H  + A Y +IQ W++L+L+ TF A D +  ++ T G+   +  D +
Sbjct: 491 ILNNHGYSVDRILHHRSDASYYDIQQWDYLNLMNTFNATDADTRKIITVGDMKDMLRDPE 550

Query: 556 FNKNSKIRLIELMLPVMDAPESLV 579
           F  +++IR+IE+MLP MD P++LV
Sbjct: 551 FAVDNRIRMIEVMLPSMDVPKALV 574

>KAFR0F02990 Chr6 complement(589562..591388) [1827 bp, 608 aa] {ON}
           Anc_2.390 YDL080C
          Length = 608

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/558 (47%), Positives = 391/558 (70%), Gaps = 8/558 (1%)

Query: 32  EITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYA 91
           EIT+  Y+F RLKQ+ V T+FGLPG+FN+ LLD +Y + G++WAGN NELNA+YAAD YA
Sbjct: 12  EITIADYLFHRLKQLHVETIFGLPGEFNMPLLDRLYNIPGLKWAGNANELNATYAADGYA 71

Query: 92  RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDF 151
           R+KG+ C+ITTFGVGELSA+NGIAG++AEHVGVLH+VG+P  SAQ KQLLLHHTLGNGD+
Sbjct: 72  RLKGLGCIITTFGVGELSAINGIAGAFAEHVGVLHVVGMPPTSAQTKQLLLHHTLGNGDY 131

Query: 152 TVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLD 211
            VFHRM+ ++S  + +I D     +E+D+CI   Y++Q+PVYLG+P N V+  V ++ L+
Sbjct: 132 RVFHRMANDVSFYSRIINDTDLCSNEVDKCIELAYLKQKPVYLGVPVNQVNLKVNSAKLN 191

Query: 212 TPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPS 271
             +   +  N+   E E I+ +L+ I   ++P I+ DAC +R D   ET++ I +T FP 
Sbjct: 192 KELRFRVLKNNLDMENEAINLILKKIYTCESPAIVVDACVNRQDTVKETEQFIRLTNFPV 251

Query: 272 FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYK 331
           FVTPMGKGSIDE  P FGGV+ G++SSP V+E V+ AD V+ +G+LL++F+T +F + YK
Sbjct: 252 FVTPMGKGSIDENIPTFGGVFSGSISSPNVREVVDFADFVIVIGSLLTEFSTSAFHFFYK 311

Query: 332 TKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELP--APNAAVD 389
           +KN V    D ++ + + +P + +K +++++L+++      ++P      P   P +   
Sbjct: 312 SKNCVLLFDDCVRFKGSIYPDLFLKPLMKNILSRLDPGKISFRPTSDCNNPMIVPKSKPS 371

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
               L+Q+W+W++   + QEGDI++TE GTS+FGINQ  FP++T GISQ LWGS GY+ G
Sbjct: 372 DDQLLRQEWVWHEFSHWFQEGDIIITELGTSSFGINQIRFPSHTKGISQALWGSSGYSMG 431

Query: 450 ACLGAVMAAEELDKS-----KRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYT 504
           +CLGA  A  E   +     +RVILF G+G+ Q+T QEISTM+RWNL PY+F+LNN+GY+
Sbjct: 432 SCLGACFATLESQSASTSTRQRVILFIGDGAFQITMQEISTMIRWNLTPYIFLLNNQGYS 491

Query: 505 IEKLIHG-PTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIR 563
           I++ +H        ++Q WN+L     FGA DYE  ++ T G+  ++  ++DF++  +IR
Sbjct: 492 IDRFLHHRKNTTLYDVQQWNYLSFFKVFGATDYETRKIVTLGDLRQMLGNEDFSRADRIR 551

Query: 564 LIELMLPVMDAPESLVKQ 581
           + E+MLP MD P+++V +
Sbjct: 552 MAEIMLPSMDVPKAIVDK 569

>TBLA0B08820 Chr2 (2097075..2098982) [1908 bp, 635 aa] {ON}
           Anc_2.390 YDL080C
          Length = 635

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/587 (46%), Positives = 399/587 (67%), Gaps = 28/587 (4%)

Query: 31  SEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAY 90
           ++ITL  Y+F RL Q  + TVFGLPG+FN+ L+D++  +  ++WAGN NELNA+YAAD Y
Sbjct: 11  NDITLADYLFHRLNQFKIHTVFGLPGEFNMPLIDKLLTIPDLKWAGNANELNAAYAADGY 70

Query: 91  ARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGD 150
           ARIKG+ CL+TTFGVGELS++NGIAGSYAEHVGVLHI+G+P  S Q  QLLLHHTLGNGD
Sbjct: 71  ARIKGIGCLLTTFGVGELSSINGIAGSYAEHVGVLHIIGMPPSSIQTSQLLLHHTLGNGD 130

Query: 151 FTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLL 210
           +TVFHR+++ ++  + ++ D      EID  I   +  QRPVYLG+P NF+   + ++LL
Sbjct: 131 YTVFHRIASELACYSTVLNDTDYLTKEIDLSIVKAWTLQRPVYLGIPMNFISYPIKSNLL 190

Query: 211 DTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFP 270
           +  +D  L+ N++ ++++VI  +L+ I   K PVI+ DAC +RH+++ ET++L   T+FP
Sbjct: 191 NKDLDFTLESNNEISQDDVIELILKNIYRCKKPVIVVDACVTRHNIEKETEELFRRTKFP 250

Query: 271 SFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSY 330
             VTPM KGS+DE  P F GV+ G++SSP V+E ++S DL+L +G  L +F T SF +SY
Sbjct: 251 VLVTPMAKGSVDESLPEFAGVFCGSISSPQVREVLDSVDLLLVIGCTLPEFTTSSFHFSY 310

Query: 331 KTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPE-----LPAPN 385
           K+K+ +   SD+IK RN TF  + +K +++ LL  +   V   K   + E     +  PN
Sbjct: 311 KSKHCIFIFSDYIKYRNTTFADLNIKQLIKKLL--LALDVSKIKNFQLQENNNGNIYIPN 368

Query: 386 AAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIG 445
             ++P+  L+Q+W+WNQ+  + Q+GDI++TETGT+AFGINQT FP+N  GISQ LWGS G
Sbjct: 369 IKLNPTLLLRQEWVWNQLSHWFQDGDIIITETGTTAFGINQTKFPHNARGISQSLWGSTG 428

Query: 446 YATGACLGAVMAAEELDKSK--------------------RVILFTGEGSLQLTAQEIST 485
           Y+ GACLGA  A  E+ K +                    RVILF G+G+ QLT QE+ST
Sbjct: 429 YSLGACLGASFALSEIRKEQQVINNITQNVFPLFKDPPKHRVILFIGDGAFQLTVQELST 488

Query: 486 MVRWNLKPYLFVLNNKGYTIEKLIHGPT-AEYNEIQNWNHLDLLPTFGAKDYEAIRVSTT 544
           ++RW L PY+F++NN GY+ ++ +H  + A Y +I  W++L LL  FGAK YE+ ++ T 
Sbjct: 489 IIRWGLTPYIFIMNNHGYSGDRFLHHRSDAGYYDIPQWDYLGLLEVFGAKIYESKKIITV 548

Query: 545 GEWNKLAEDKDFNKNSKIRLIELMLPVMDAPESLVKQAQLTAATNAK 591
           G++ K+  + +F  +S +R+IE++LP MD P++L+ + +L      K
Sbjct: 549 GDFEKMVNNPNFAIDSVLRMIEIVLPPMDVPQALMDKWRLEQEEEKK 595

>Ecym_6055 Chr6 complement(105018..106796) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii ADR254W
          Length = 592

 Score =  543 bits (1398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/561 (47%), Positives = 381/561 (67%), Gaps = 12/561 (2%)

Query: 32  EITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYA 91
           +I LG+Y+F RL Q++VTT+FGLP +FN  LLD+IY++  MRW GN NELNASYAAD Y+
Sbjct: 13  QIPLGKYLFHRLNQLNVTTIFGLPSEFNSPLLDQIYQIPSMRWCGNANELNASYAADGYS 72

Query: 92  RIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDF 151
           RIK +SCL+TTFGVGE+S LNGIAGS++EHV VLH+VG+P  SAQ K+LLLHHTLGN D+
Sbjct: 73  RIKRLSCLVTTFGVGEMSVLNGIAGSFSEHVAVLHVVGMPPSSAQLKKLLLHHTLGNSDY 132

Query: 152 TVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLD 211
            +FHR++++I   TA++ +       ID CI   Y +Q+PVY G+P N    +V +  LD
Sbjct: 133 DIFHRLASDICVHTAVLKESDNICDVIDNCIVRCYNQQQPVYCGIPVNLAGHLVDSKSLD 192

Query: 212 TPIDLALKPND--QQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
           +P+ L    N     A EE++  LLE I  A++PVI+AD CASRHD   E  ++   T F
Sbjct: 193 SPLHLMRGFNQPISDAVEELVDILLEKIYSAQHPVIVADGCASRHDCIEELTEIAQKTGF 252

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYS 329
           P   TPMGKGS DE+  R+ GVY+G++SSP V+E V+ AD VL  GAL +D+ T S+ + 
Sbjct: 253 PLCCTPMGKGSFDEQSKRYVGVYMGSISSPQVREVVDFADFVLVAGALTADYATSSYHFC 312

Query: 330 YKTKNVVEFHSDHIKIRNA-TFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAV 388
           YK KN+V     + K+    T+P V++K VLQ L   +      Y    +PE        
Sbjct: 313 YKPKNIVLLFDKYAKVSGTKTYPDVRLKDVLQLLARCLDPTKLQYIQEEIPESSCLRVKP 372

Query: 389 DPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYAT 448
           D +TPL+Q+W+W ++  + + GD+++TE GTS  G+NQ  FP+ T  +SQ LWGS+GY+ 
Sbjct: 373 DANTPLRQEWMWARLSHWFRPGDVIVTEMGTSGLGVNQIKFPSGTKVVSQPLWGSLGYSV 432

Query: 449 GACLGAVMAAEELD-----KSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGY 503
           GACLG ++A +E       K  R+ILF G+G+LQLT QEIST+++W L PY+FV+NN+GY
Sbjct: 433 GACLGVLIAVQEESRGNRLKDNRIILFVGDGALQLTVQEISTIIKWGLAPYIFVINNQGY 492

Query: 504 TIEKLI----HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKN 559
           TI++L+    H  TA+Y  IQ WN+L ++P FG  +Y+  +V   G+ ++L +D+ F+  
Sbjct: 493 TIDRLLSRDTHHATADYYNIQPWNNLSIIPAFGGTNYDVRKVVKVGQLDQLLKDQRFSNQ 552

Query: 560 SKIRLIELMLPVMDAPESLVK 580
             ++++E++LP MDAP++L++
Sbjct: 553 DILKMVEIILPSMDAPQALLE 573

>ADR254W Chr4 (1143623..1145368) [1746 bp, 581 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL080C (THI3)
          Length = 581

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/553 (46%), Positives = 363/553 (65%), Gaps = 6/553 (1%)

Query: 31  SEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAY 90
           S I L  Y+F RL+Q+ VTT FGLP D+N+ LLD +  V  M    N NELNASYAAD Y
Sbjct: 12  SSIPLAEYLFHRLRQLGVTTGFGLPSDYNMFLLDGLENVADMHLCCNTNELNASYAADGY 71

Query: 91  ARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGD 150
           AR++ +SCL++TFGVGELS +NGIAGS+AEHV VL IVG+P  SAQ ++LLLHHTLGNGD
Sbjct: 72  ARMQRLSCLVSTFGVGELSVVNGIAGSFAEHVAVLLIVGMPPASAQRRKLLLHHTLGNGD 131

Query: 151 FTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLL 210
           + VF R++++I   + ++    TA   +D CI   Y  Q+PVY G+P N  + M+P++ L
Sbjct: 132 YDVFRRLASDICTYSTVVRSAHTAAEVLDHCIARCYRDQKPVYCGVPINLAEAMLPSAPL 191

Query: 211 DTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFP 270
           D P+ L  +P      +E+++ LL+ I  AK+PV++ DAC +RH    + ++L   T FP
Sbjct: 192 DVPLPLLDEPC--APLDELVALLLDKIYAAKHPVLVVDACVARHGCMQQLQRLAQATDFP 249

Query: 271 SFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSY 330
              TPMGKG +DE+  RF GVYVG+LS+P V+E V+ AD VL VGAL ++F T +F ++Y
Sbjct: 250 VCCTPMGKGIVDEQGARFAGVYVGSLSAPQVREVVDFADFVLVVGALTAEFCTFAFHFAY 309

Query: 331 KTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDP 390
           K KN+   H+ H ++    FP   ++ +L  L+ +           PVPE  A   A +P
Sbjct: 310 KPKNIGLVHARHARVGARGFPDAPLRALLGLLVQRWTPRASANAREPVPEPSALRVAPNP 369

Query: 391 STPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGA 450
           +TPL+ +WLW ++ ++   GDI+++ETGTSAFG+ QT  P     +SQ LWGS+GY+ GA
Sbjct: 370 ATPLRHEWLWARLSRWFAPGDILVSETGTSAFGVLQTRLPPGVCVVSQPLWGSVGYSVGA 429

Query: 451 CLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI- 509
           CLG ++A       +RV+LF G+G+LQLT QE+STMVR  L P +FVLNN+GY+ ++L+ 
Sbjct: 430 CLGVLVATRAAAPPRRVVLFVGDGALQLTVQELSTMVRLRLAPLIFVLNNRGYSADRLLN 489

Query: 510 ---HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIE 566
              H   A Y ++Q W++L L P FGA  Y+   V+T GE + L  D  F + S ++++E
Sbjct: 490 RARHRANARYYDVQPWHNLALAPAFGASAYDPRAVTTVGELDALLSDPAFAQPSVLKMVE 549

Query: 567 LMLPVMDAPESLV 579
           + LP MD P +L+
Sbjct: 550 VALPSMDGPPALL 562

>Kpol_1046.9 s1046
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 bp, 598 aa] {ON}
           (18301..18855,18984..18992,19556..19693,19697..19987,
           19994..20797) [1797 nt, 599 aa]
          Length = 598

 Score =  460 bits (1183), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 238/562 (42%), Positives = 352/562 (62%), Gaps = 44/562 (7%)

Query: 31  SEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAY 90
           S IT+  Y+F RLKQ+D+ T+FGLPG+FN+ L+D++Y++  +RWAGN NELNA+YAAD Y
Sbjct: 12  SSITVAEYLFHRLKQMDIRTIFGLPGEFNMPLIDKLYKIPSLRWAGNANELNAAYAADGY 71

Query: 91  ARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGD 150
           AR+K + CLITTFGVGELSALNGIAGS++EH+G+LH+V +P +      +L+     NGD
Sbjct: 72  ARLKRLGCLITTFGVGELSALNGIAGSFSEHLGILHVVRMPPLRLNHSIVLI--LFRNGD 129

Query: 151 FTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLL 210
           +     M A          D+   P    R +    I+    ++        +    S +
Sbjct: 130 YKF--PMKAR---------DILVTPRISHRNLWDEMIKPNQAWISSAGILAYRYWRGSKI 178

Query: 211 DTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFP 270
                      + Q     +S+     K+          C S + V+ +        +FP
Sbjct: 179 PKGKGADXXXKNLQCRTSYLSSRSLRFKEQ------CRRCNSDYSVRKQ--------KFP 224

Query: 271 SFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSY 330
            FV P  +    E + +FGGV+ G++SSP V+E V+ ADLV+ +G  L DF+T SF +SY
Sbjct: 225 YFV-PQWERVQHENNDQFGGVFSGSISSPHVREVVDFADLVIVIGCTLPDFHTSSFHFSY 283

Query: 331 KTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDY---KPVPVPELPAPNAA 387
           + K+VV   S ++KIRN  +P + +K +L +LL++V + +  Y   KP+ VP    P+ +
Sbjct: 284 RAKDVVLITSTYVKIRNRLYPDLNIKPLLNTLLSRVDSSLIKYDSIKPMVVPTSKLPSKS 343

Query: 388 VDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYA 447
           V     L+Q+W+WN++  + QE D+++TETGTSAFGINQT FP  ++GISQ LWGS+GY+
Sbjct: 344 V-----LRQEWVWNEISHWFQEKDVIITETGTSAFGINQTRFPKQSHGISQCLWGSVGYS 398

Query: 448 TGACLGAVMAAEELDKS-------KRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNN 500
            GACLGA  A +EL +S        RVILF G+G+ QLT QE+STM++WNLKPY+F++NN
Sbjct: 399 LGACLGASFAVDELYESGKTNGIMPRVILFVGDGAFQLTMQEVSTMIKWNLKPYIFLMNN 458

Query: 501 KGYTIEKLI-HGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKN 559
           +GY+I++ + H   A+Y +IQ W +L+LL  FGA DYEA ++ T  ++  + +D +F +N
Sbjct: 459 QGYSIDRFLSHRSNAKYYDIQQWEYLNLLQVFGAIDYEAKKIVTVEDFQNILKDANFARN 518

Query: 560 SKIRLIELMLPVMDAPESLVKQ 581
            KIR+IE+MLP MD P+SL++Q
Sbjct: 519 DKIRMIEIMLPPMDVPQSLMEQ 540

>KLLA0F16962g Chr6 complement(1559454..1561190) [1737 bp, 578 aa]
           {ON} uniprot|O74722 Kluyveromyces lactis PDC Pyruvate
           decarboxylase
          Length = 578

 Score =  353 bits (907), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/555 (35%), Positives = 318/555 (57%), Gaps = 38/555 (6%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           I L  Y+F RL Q++  TVFG+  +++   L +     G++W    N+LN S+A DAY R
Sbjct: 27  IPLPEYLFHRLFQLNCRTVFGV-ANYSTAKLYQAIAASGIQWIQTINQLNTSFAVDAYGR 85

Query: 93  IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFT 152
             G+SC +T+    EL  +NG  GS+ E+V +L +V V   S   ++L+       GD +
Sbjct: 86  AIGVSCYVTSES-AELGHVNGFFGSFCEYVPILQVV-VLEQSHDLERLI-------GDVS 136

Query: 153 VFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLDT 212
           +FH              D+   PSEID C+RT +  +RPVY+GL S    ++VP+S L+ 
Sbjct: 137 IFH--------------DVVDDPSEIDSCVRTLFWGKRPVYMGLRSKDATKLVPSSSLNG 182

Query: 213 PI--DLALKPNDQQAE--EEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQ 268
            I   + +K    Q +  + VI  ++  +  +  P+I+ DA   R++  +  +  +  T 
Sbjct: 183 NIADKMGIKNTFFQTDTIKRVIDKIIAEVYASSRPLIVVDALIDRYNYNSTIQNFLTETG 242

Query: 269 FPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSY 328
            P   T M KGSIDE  P F G ++GT+S P V+E + +AD  L +G ++ +F      +
Sbjct: 243 IPFVTTLMSKGSIDESLPNFVGTFLGTMSQPIVREYMNNADCTLILGCMIENFKNSYCRF 302

Query: 329 SYKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAV-VKDYKPVPVPELPAPNAA 387
           +YK+KN +   +D +KI N   P + +  +L  L+  +    + + +PV +P +  P   
Sbjct: 303 NYKSKNQILLWNDRVKIENNIIPDILLHELLPQLIASLDTTKIVNSRPVTIPNM-IPRVE 361

Query: 388 VDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYA 447
             P T L+Q++LW ++  +L++GD++++E+GTSA G+ Q  FP+NT  +SQ +W S GY+
Sbjct: 362 PQPVTFLRQEYLWFKMSTWLKQGDVIISESGTSAIGLLQQKFPDNTRLVSQAIWNSSGYS 421

Query: 448 TGACLGAVMAAEE---LDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYT 504
            GACLG + A  +   LDK  R+IL  G+GSLQ T QE+ST++    KPY+FV+NN+GYT
Sbjct: 422 IGACLGILAAYRDMGTLDK-HRIILMVGDGSLQFTFQELSTILTHGFKPYIFVINNQGYT 480

Query: 505 IEKLIHGP----TAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNS 560
           +++ ++       A Y +IQ W  L L   F +++Y   R  + GE N L  DK+FNK+ 
Sbjct: 481 VDRTLNREKTHLNATYFDIQPWELLKLPSLFYSQEYFKRRCMSVGELNSLLSDKEFNKSD 540

Query: 561 KIRLIELMLPVMDAP 575
           +++++EL+LP MD P
Sbjct: 541 QLKIVELILPSMDVP 555

>SAKL0G03036g Chr7 (250012..251925) [1914 bp, 637 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 637

 Score =  352 bits (904), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 205/600 (34%), Positives = 326/600 (54%), Gaps = 50/600 (8%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIY----EVEGMRWAGNCNELNASYAAD 88
           I  G+YVFERL      +VFG+PGDFNL LL+ +Y    + + ++W G CNELNA+YAAD
Sbjct: 32  IPFGQYVFERLISAGTKSVFGVPGDFNLSLLEHMYSRTVQRKDLKWFGTCNELNAAYAAD 91

Query: 89  AYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHT-- 145
            Y+R    + C+ITT+GVGELSA+NG+AG++AE+V VLHIVGV     +  +  +HH   
Sbjct: 92  GYSRYTNKIGCVITTYGVGELSAINGVAGAFAENVKVLHIVGVTPSKFRNDETFIHHNVH 151

Query: 146 -----LGNGDFT-----VFHRM-SANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYL 194
                + N +F       +H M    IS +T  + ++  A  ++D+ +   Y   +P Y+
Sbjct: 152 HLIPAMDNPNFRGPNHRSYHDMIDGRISCSTEFVDNVDQACDQLDKVVNDIYKYSKPGYI 211

Query: 195 GLPSNFVDQMVPA-SLLDTPI----DLALKPNDQQAEEEVISTLLEMIKDAKNPVILADA 249
            +P++F D+MV A +L+ TP     ++  +  +Q+  + + + +++++  +K P ++ D 
Sbjct: 212 FIPADFADKMVNAQNLITTPTITLENVISQGFNQEVVDSMATKIIDLLYKSKTPAVIGDV 271

Query: 250 CASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESAD 309
              R     E +  + IT+  +F + MG+  +DE  P F GVY G  SSP + +A+ S D
Sbjct: 272 LCDRFGCVNEIRNFVRITKMWAFSSFMGRSILDESEPNFHGVYNGAESSPHIIQAIGSCD 331

Query: 310 LVLSVGALLSDFNTGSFSYSYKTKNV-VEFHSDHIKI------RNATFPGVQMKFVLQSL 362
           L+L  G L ++ N G +S+S+      VE HSD++              GV    VL  +
Sbjct: 332 LILHFGVLKNEINNGHYSFSFNANATEVELHSDYLNFVDYKSGNEVLVKGVHFVSVLNRI 391

Query: 363 LN--KVGAVVKDYKPVPV-PELPAPNAAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGT 419
           +    V  +   Y  + V PE+  P     P + + Q++L N + ++L  GD+ + ETG+
Sbjct: 392 IQLIDVTKINLKYPDLTVNPEMATPAGIHSPESQITQKFLQNAMSEYLSPGDVFVVETGS 451

Query: 420 SAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEE-------------LDKSKR 466
             F +    FP N   ISQ  + SIG A  +CLG   A ++             LD + +
Sbjct: 452 FQFVVRDFQFPTNVKYISQGFYLSIGMALPSCLGIGCAMKDYPGSHICDAGVSTLDYTPK 511

Query: 467 VILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYNEIQNWNHLD 526
           +IL  G+G+ Q+T QE+++ +R+ +   +F+ NN GYT+E+ I GPT  YN+I  W    
Sbjct: 512 LILCEGDGAAQMTIQELTSFLRYQIPVEIFLWNNHGYTVERAIRGPTRSYNDIMEWKWTK 571

Query: 527 LLPTFGAKD---YEAIRVSTTGEWNKLAED-KDFNKNSKIRLIELMLPVMDAPESLVKQA 582
           LL  FG  D    EA +V   GE+  +    K   + SK+RLIE+ML +MD P+ L+  A
Sbjct: 572 LLEAFGDFDGSISEACKVKNVGEFKDVVGSLKHSKERSKVRLIEVMLGMMDIPKQLLAMA 631

>CAGL0A03102g Chr1 (317961..319910) [1950 bp, 649 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380w
          Length = 649

 Score =  346 bits (887), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 218/610 (35%), Positives = 318/610 (52%), Gaps = 54/610 (8%)

Query: 23  QNKPEITMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYE---VEGMRWAGNCN 79
           Q+       EIT G YVF RL      +VFG+PGDFNL LL+ +Y+    + +RW GNCN
Sbjct: 21  QSNSGFAYGEITFGEYVFRRLLSCGTKSVFGVPGDFNLALLEHLYDDSVADALRWVGNCN 80

Query: 80  ELNASYAADAYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAK 138
           ELNA+YAAD Y+R    + CLITT+GVGELSALNG+AGS+AE V VLHIVGV S     K
Sbjct: 81  ELNAAYAADGYSRYTNKIGCLITTYGVGELSALNGVAGSFAEDVKVLHIVGVASSQTSCK 140

Query: 139 QL---LLHH---TLGNGDF------TVFHRMSANISETTAMITDLATAPSEIDRCIRTTY 186
                 +HH    L + +F      T +  +   +      + D+  A   +D+ I   Y
Sbjct: 141 NTDNKNVHHLIPALNDSNFVSPNHKTYYEMVKDRVCCAAEYLEDIDVACDMLDKVIEDMY 200

Query: 187 IRQRPVYLGLPSNFVDQMVPA-SLLDTP---IDLALKP---NDQQAEEEVISTLLEMIKD 239
              +P YL +P++F D MV   +L+  P   ++ A+ P     +   E +++ + ++I +
Sbjct: 201 RYSKPGYLFIPADFADMMVSTRNLVARPTITLEQAIAPLVGCGESQLEAIVAKVAQLIYN 260

Query: 240 AKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSP 299
           + NP IL D    R+ V  +   LI   Q  +F T MGK  IDE +P + G+Y G   S 
Sbjct: 261 SSNPCILGDVLTDRYGVSQQLNSLISHCQMWNFSTVMGKSVIDESNPYYKGLYNGRECSS 320

Query: 300 AVKEAVESADLVLSVGALLSDFNTGSFSYSYKTK---NVVEFHSDHIKIRNAT------F 350
           +V E     DL+L  G   ++ N G ++  Y      NVVEFHSD+I+  N+        
Sbjct: 321 SVIEDFSKCDLILHFGIERNEINNGHYTIDYNEHIGANVVEFHSDYIRFFNSKTKEEDMI 380

Query: 351 PGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDP--STPLKQQWLWNQVGQFLQ 408
            GV    VL  L   + A    +           ++ +D   S  + Q++L + + Q+L 
Sbjct: 381 RGVNFVHVLNRLQPAIQADKLSFNYQECSTTSNADSKIDSQSSNEITQEFLQDIMPQYLN 440

Query: 409 EGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAA---------- 458
            GD+++ ETG+  FG+    FP+N   +SQ  + SIG A  A LG  +            
Sbjct: 441 PGDVLVCETGSVQFGVRDYRFPSNVKYVSQGFYLSIGMALPASLGVGIGMQDYPMSHIPN 500

Query: 459 -EELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYN 517
            EE++   ++ILF G+GS Q+T QE+STM+  N+K  +F+ NN GYTIE+ I GPT  YN
Sbjct: 501 PEEIEYEPKLILFEGDGSAQMTIQELSTMLHNNVKMEIFLWNNDGYTIERAIKGPTRSYN 560

Query: 518 EIQNWNHLDLLPTF----GAKDYEAIRVSTTGE--WNKLAEDKDFNKN---SKIRLIELM 568
           +I  WN   +   F    G+K     +V +T E    +L E KD   N    +I L+E+ 
Sbjct: 561 DIAPWNWTKMFEAFGDGLGSKHKTRNQVYSTREEFLTRLREKKDTKHNDPACQIELLEVK 620

Query: 569 LPVMDAPESL 578
           + V+D PE L
Sbjct: 621 MGVLDFPEQL 630

>NCAS0A11830 Chr1 (2347016..2348929) [1914 bp, 637 aa] {ON}
           Anc_5.456
          Length = 637

 Score =  333 bits (855), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 215/610 (35%), Positives = 328/610 (53%), Gaps = 52/610 (8%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYE----VEGMRWAGNCNELNASYAAD 88
           I  G Y+ +R+      ++FG+PGDFNL LL+ +Y      +G+RW G CNELNA+YAAD
Sbjct: 28  IPFGEYLLQRILTAGTKSIFGVPGDFNLSLLEYLYTPSLISQGLRWIGTCNELNAAYAAD 87

Query: 89  AYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVP-SVSAQAKQLL---LH 143
            Y+R    MSCLITT+GVGELSA+NG+AG++AE V VLHIVGV  SV +++       +H
Sbjct: 88  GYSRYSNKMSCLITTYGVGELSAMNGVAGAFAEDVKVLHIVGVTRSVDSRSDDYHTRNIH 147

Query: 144 H---TLGNGDFT-----VFHRMSAN-ISETTAMITDLATAPSEIDRCIRTTYIRQRPVYL 194
           H    L + +F      V+  M  + ++ + A + ++ TA  E+D+ I   Y   +P Y+
Sbjct: 148 HLVPKLKDSNFIGPNHRVYSEMVRDKLACSVAYLDNIETACDEVDKVIFDIYKYSKPGYI 207

Query: 195 GLPSNFVDQMV-PASLLDTPI---DLALKPNDQQAEEEVISTLLEMIKDAKNPVILADAC 250
            +P++F D +V P++L+  P+   + A+        EEV   LL+ I D+K P I+ D  
Sbjct: 208 FVPADFSDMLVNPSNLVSNPVITLENAIPEVPSLELEEVTQLLLQCIYDSKTPAIIGDVL 267

Query: 251 ASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADL 310
             R     E  KLI +T   +F T MGK  IDE +P++ G+Y G     +V E     DL
Sbjct: 268 TDRFGCAPELNKLIKMTSMWNFSTVMGKSVIDESNPKYMGLYNGNEGICSVTERFLQCDL 327

Query: 311 VLSVGALLSDFNTGSFSYSY-KTKNVVEFHSDHIKI------RNATFPGVQMKFVLQSLL 363
           VL  G  +++ N G ++Y Y +   +VE H ++++           F GV    +L+ LL
Sbjct: 328 VLHFGINVNEINNGHYTYKYNENAKIVELHPEYVRFFDFKINEEKLFKGVHFVPILKRLL 387

Query: 364 NKVGAVVKDYK-PVPVPELPAPNAAV--DPSTPLK--QQWLWNQVGQFLQEGDIVLTETG 418
            K+     ++  P  V         +  + S+ LK  Q  L N++  +  +GD+V+ ETG
Sbjct: 388 EKLEPTNLNFNYPTNVARFSQEEICLPQESSSELKVTQTHLQNKIPSYFNDGDVVVCETG 447

Query: 419 TSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSK------------R 466
           +  F +    FP+    ISQ  + SIG A  A +G  +A ++  KS             R
Sbjct: 448 SFQFALRDFIFPSQLKYISQGFFLSIGMALPASMGVGIAMQDFPKSHLIANGKEHSYQPR 507

Query: 467 VILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYNEIQNWNHLD 526
           +ILF G+G+ Q+T QE++TM+R  +   + +LNN GYTIE+ I GPT  YN+I  W    
Sbjct: 508 LILFEGDGAAQMTVQELTTMLRNKIPIEIILLNNNGYTIERAIKGPTRSYNDIMPWKWTK 567

Query: 527 LLPTFGAKDYEAIR---VSTTGEWNKLAEDKDFNK-NSKIRLIELMLPVMDAPESLVKQA 582
           L   FG  D +      V T  E +++ ED  + K ++ I L+E+ L VMD P+ L  Q+
Sbjct: 568 LFEAFGDFDNKYTMNTLVETRSELDRILEDLKYKKRDNLIELLEVKLDVMDFPKQL--QS 625

Query: 583 QLTAATNAKS 592
            + AA   +S
Sbjct: 626 MVDAAAFKRS 635

>KAFR0E03730 Chr5 complement(746616..748523) [1908 bp, 635 aa] {ON}
           Anc_5.456 YDR380W
          Length = 635

 Score =  329 bits (844), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 209/620 (33%), Positives = 337/620 (54%), Gaps = 59/620 (9%)

Query: 28  ITMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYE----VEGMRWAGNCNELNA 83
           I   +I  G Y+F+R+      +VFG+PGDFNL LL+ +Y+     +G+RW G CNELNA
Sbjct: 20  IAKDQIRFGEYIFQRILSCGTKSVFGVPGDFNLPLLEYLYDDSIINQGLRWIGTCNELNA 79

Query: 84  SYAADAYARI-KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVP-SVSAQA---K 138
           +YAAD Y+R  +G+ CLITT+GVGELSA+NGIAG++AE+V +LHIVGV  S+ +Q    K
Sbjct: 80  AYAADGYSRYSQGIGCLITTYGVGELSAMNGIAGAFAENVKLLHIVGVARSIDSQHDDFK 139

Query: 139 QLLLHH---TLGNGDFT-----VFHRMSAN-ISETTAMITDLATAPSEIDRCIRTTYIRQ 189
           Q  LHH    L + +F+     +++ M  + IS +T  + ++ TA  ++D+ I   Y   
Sbjct: 140 QRNLHHLVPQLNDSNFSGPNHKIYYEMVKDRISCSTEYLENIDTACDQVDKVIMDIYRYS 199

Query: 190 RPVYLGLPSNFVDQMVPA-SLLDTPI----DLALKPNDQQAEEEVISTLLEMIKDAKNPV 244
           +P Y+ +P +FV+ MV   +LL  P     D  L+ +     +++ + +L+ I  +K+P 
Sbjct: 200 KPGYIFVPCDFVNMMVDTKNLLQRPKITFQDCILQDDKLNQIDQITNLILDQIYSSKSPA 259

Query: 245 ILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEA 304
           I+ D    R+       + I +T+  +F T  GK  I+E++P + G+Y G   +  V + 
Sbjct: 260 IIGDVLTDRYHGNKLLNEFITLTKIWNFTTFNGKSIINEQNPYYMGLYNGNEGAETVIDR 319

Query: 305 VESADLVLSVGALLSDFNTGSFSYSYKTK-NVVEFHSDHIKIRNA------TFPGVQMKF 357
               DL+++VG  +++ N G +++SY+    ++E H  +I++ +        F G+    
Sbjct: 320 FLKCDLIINVGIDINEINHGHYTFSYRQNAKLIEMHPTYIRLYDTGSHEETLFKGINFIH 379

Query: 358 VLQSLLNKVGAVVK----DYKPV-----PVPELPAPNAAVDPSTPLKQQWLWNQVGQFLQ 408
           VL+ +L K+   +K    DY P      P  EL  P+A  D S  + Q +L   V  +L 
Sbjct: 380 VLKRMLIKID--IKRFDFDYDPSVTKFDPTIELKFPSADPD-SNKITQNFLAQNVPDYLN 436

Query: 409 EGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSK--- 465
           +GD+++ ETG   F       P+    I+Q  + SIG A  A LG  +A ++  +     
Sbjct: 437 DGDVLVVETGAFQFATRDFLLPDQLKYITQGFYLSIGTALPAALGVGIAMQDYPRCHLYG 496

Query: 466 --------RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYN 517
                   R+IL  G+G+ Q+T QE+S+ +R+N+   + +LNN GYTIE+ I GPT  YN
Sbjct: 497 KIPETYNPRLILMEGDGAAQMTVQELSSFIRYNIPIEIILLNNDGYTIERAILGPTRSYN 556

Query: 518 EIQNWNHLDLLPTFGAKDYEAIRVSTTGE-----WNKLAEDKDFNKNSKIRLIELMLPVM 572
           +I  WN   +    G  D +A  V+TT +      NK  + K+  + +KI  IE++L V+
Sbjct: 557 DIMAWNWTKIFEALGDFDNKA-TVNTTIKSPSKLLNKFKQLKNETERNKIEFIEVILGVL 615

Query: 573 DAPESLVKQAQLTAATNAKS 592
           D PE L    +       K+
Sbjct: 616 DYPEQLKSMVEAAKVKKPKA 635

>YDR380W Chr4 (1234218..1236125) [1908 bp, 635 aa] {ON}
           ARO10Phenylpyruvate decarboxylase, catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde,
           which is the first specific step in the Ehrlich pathway
          Length = 635

 Score =  328 bits (840), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 220/617 (35%), Positives = 323/617 (52%), Gaps = 62/617 (10%)

Query: 14  RNLNSNRVSQNKPEITMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIY----EV 69
           R+L SNR          + I  G Y+F+RL  +D  +VFG+PGDFNL LL+ +Y    E 
Sbjct: 15  RHLVSNR---------SATIPFGEYIFKRLLSIDTKSVFGVPGDFNLSLLEYLYSPSVES 65

Query: 70  EGMRWAGNCNELNASYAADAYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIV 128
            G+RW G CNELNA+YAAD Y+R    + CLITT+GVGELSALNGIAGS+AE+V VLHIV
Sbjct: 66  AGLRWVGTCNELNAAYAADGYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIV 125

Query: 129 GVP----SVSAQAKQLLLHH---TLGNGDFT-----VFHRMSAN-ISETTAMITDLATAP 175
           GV     S S+      LHH    L + +F      V+H M  + ++ + A + D+ TA 
Sbjct: 126 GVAKSIDSRSSNFSDRNLHHLVPQLHDSNFKGPNHKVYHDMVKDRVACSVAYLEDIETAC 185

Query: 176 SEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPA-SLLDTPI----DLALKPNDQQAEEEVI 230
            ++D  IR  Y   +P Y+ +P++F D  V   +L++ P     D  + P++ Q  + +I
Sbjct: 186 DQVDNVIRDIYKYSKPGYIFVPADFADMSVTCDNLVNVPRISQQDCIVYPSENQLSD-II 244

Query: 231 STLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGG 290
           + +   I  +K P IL D    R+ V     KLI  T   +F T MGK  IDE +P + G
Sbjct: 245 NKITSWIYSSKTPAILGDVLTDRYGVSNFLNKLICKTGIWNFSTVMGKSVIDESNPTYMG 304

Query: 291 VYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYK-TKNVVEFHSDHIKIRNA- 348
            Y G      V E  E  DLVL  G  +++ N G ++++YK    +++FH ++I++ +  
Sbjct: 305 QYNGKEGLKQVYEHFELCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRLVDTR 364

Query: 349 -----TFPGVQMKFVLQSLLNK--VGAVVKDYKPVPVPELPAPNAAVDP----STPLKQQ 397
                 F G+    +L+ L  +  V  +   Y               DP    S+ + Q 
Sbjct: 365 QGNEQMFKGINFAPILKELYKRIDVSKLSLQYDSNVTQYTNETMRLEDPTNGQSSIITQV 424

Query: 398 WLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMA 457
            L   + +FL  GD+V+ ETG+  F +    FP+    ISQ  + SIG A  A LG  +A
Sbjct: 425 HLQKTMPKFLNPGDVVVCETGSFQFSVRDFAFPSQLKYISQGFFLSIGMALPAALGVGIA 484

Query: 458 AEEL------------DKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTI 505
            ++             D   R+ILF G+G+ Q+T QE+ST+++ N+   + + NN GYTI
Sbjct: 485 MQDHSNAHINGGNVKEDYKPRLILFEGDGAAQMTIQELSTILKCNIPLEVIIWNNNGYTI 544

Query: 506 EKLIHGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLA----EDKDFNKNSK 561
           E+ I GPT  YN++ +W    L   FG  D +    +     +KLA    E K+ NK S 
Sbjct: 545 ERAIMGPTRSYNDVMSWKWTKLFEAFGDFDGKYTNSTLIQCPSKLALKLEELKNSNKRSG 604

Query: 562 IRLIELMLPVMDAPESL 578
           I L+E+ L  +D PE L
Sbjct: 605 IELLEVKLGELDFPEQL 621

>Skud_4.651 Chr4 (1157087..1158994) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  323 bits (829), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 215/618 (34%), Positives = 320/618 (51%), Gaps = 66/618 (10%)

Query: 21  VSQNKPEITMSE---ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIY----EVEGMR 73
           V+Q +P +  +E   I+ G Y+F RL      +VFG+PGDFNL LL+ +Y    E  G++
Sbjct: 10  VNQKEPHLVSNELATISFGEYIFRRLLSTGTKSVFGVPGDFNLSLLEYLYAPSVESAGLK 69

Query: 74  WAGNCNELNASYAADAYARI-KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVP- 131
           W G CNELNA+YAAD Y+R    + CL+TTFGVGELSALNG+AGS+AE+V VLHIVGV  
Sbjct: 70  WIGTCNELNAAYAADGYSRYSNNIGCLVTTFGVGELSALNGVAGSFAENVKVLHIVGVAK 129

Query: 132 ---SVSAQAKQLLLHH---TLGNGDFT-----VFHRMSAN-ISETTAMITDLATAPSEID 179
              S S   +   +HH    L   +F      V+H M  + ++ + A + D+ TA  ++D
Sbjct: 130 SIDSRSDNFRDRNMHHLVPQLHGSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACDQVD 189

Query: 180 RCIRTTYIRQRPVYLGLPSNFVDQMVPA-SLLDTP----IDLALKPNDQQAEEEVISTLL 234
             IR  Y   +P Y+ +P++F D  V   +L++ P     D    P+  Q  + ++  + 
Sbjct: 190 NVIRDIYKYSKPGYIFVPADFADMSVTCENLINVPHISQQDCITYPSQIQLFD-ILDRIT 248

Query: 235 EMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVG 294
             +  +K P IL D    R+ V     KLI  T   +F T MGK  IDE +P++ G Y G
Sbjct: 249 SWMYSSKTPAILGDVLTDRYGVSEILNKLIYATGIWNFSTVMGKSVIDEANPKYMGQYNG 308

Query: 295 TLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYK-TKNVVEFHSDHIKIRNATFPGV 353
                 V E  ES DLVL  G  +++ N G ++++YK    +++FH ++I+  +  +   
Sbjct: 309 KEGLRQVYEHFESCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPNYIRFVDTKYGHE 368

Query: 354 QMKFVLQSLLNKVGAVVKDYKPVPVPELPA----------------PNAAVDPSTPLKQQ 397
           QM       +N    +++ YK + V  L                   +   D S  + Q 
Sbjct: 369 QMF----EGINFAPVLMELYKGIDVSRLSLQYDSGVTSYTNETMQLEDPTNDQSNNITQV 424

Query: 398 WLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMA 457
            L   + +FL  GD+V+ ETG+  F +    FP     ISQ  + SIG A  A LG  +A
Sbjct: 425 HLQKVMPKFLSPGDVVVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIA 484

Query: 458 AEELDKSK------------RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTI 505
            ++   +             R+ILF G+G+ Q+T QE+ST+++ ++   +F+ NN GYTI
Sbjct: 485 MQDFPNAHISDENIGEGYKPRLILFEGDGAAQMTIQELSTILKCHITIDIFIWNNNGYTI 544

Query: 506 EKLIHGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEW-----NKLAEDKDFNKNS 560
           E+ I GPT  YN++ +W    LL  FG  D +    ST  E+      KL E K  N   
Sbjct: 545 ERAIMGPTRAYNDVMSWKWTKLLEAFGDFDRKHTN-STVIEYPSKLAMKLEELKSSNTRD 603

Query: 561 KIRLIELMLPVMDAPESL 578
            I L+E+ L V+D PE L
Sbjct: 604 GIELVEVKLGVLDFPEQL 621

>Suva_2.554 Chr2 (984966..986873) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  322 bits (824), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 214/628 (34%), Positives = 328/628 (52%), Gaps = 60/628 (9%)

Query: 21  VSQNKPEITMSE---ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIY----EVEGMR 73
           + Q++P +  ++   +  G Y+F RL  +   +VFG+PGDFNL LL+ +Y    E +G++
Sbjct: 10  IDQDEPHVVFNQSATMPFGEYIFRRLFSIGTKSVFGVPGDFNLSLLEYLYAPSVESDGLQ 69

Query: 74  WAGNCNELNASYAADAYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVP- 131
           W G CNELNA+YAAD Y+R    + CLITT+GVGELSALNGIAGS+AE+V VLHIVGV  
Sbjct: 70  WVGTCNELNAAYAADGYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAK 129

Query: 132 ---SVSAQAKQLLLHH---TLGNGDFT-----VFHRM-SANISETTAMITDLATAPSEID 179
              S S   K+  LHH    L + +F      V+H M   N++ + A + D+ TA  ++D
Sbjct: 130 STDSRSNNFKERNLHHLVPRLHDSNFKGPNHKVYHDMIKDNVACSVAYLEDIETACDQVD 189

Query: 180 RCIRTTYIRQRPVYLGLPSNFVDQMVPASLLDTPIDL-------ALKPNDQQAEEEVIST 232
             IR  Y   +P Y+ +P++F D  V    LD  I++        +  + +     +I  
Sbjct: 190 AVIRDIYRYSKPGYVFVPADFPDMSV---RLDNLINVPHISQQDCITSSSETQLFNIIDK 246

Query: 233 LLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVY 292
           +   +  ++ P IL D    R+ V     KLI  ++  +F T MGK  IDE +P + G+Y
Sbjct: 247 ITTWMYSSRTPAILGDVLTDRYGVSDILNKLIYASKIWNFTTVMGKSVIDESNPSYMGLY 306

Query: 293 VGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYK-TKNVVEFHSDHIKIRNA--- 348
            G      V E  ES DL+L  G  +++ N G +S++YK    +++FH ++I+  +    
Sbjct: 307 NGKEGLKQVYEHFESCDLILHFGVDINEINNGHYSFTYKPNAKIIQFHPNYIRFVDTRYG 366

Query: 349 ---TFPGVQMKFVLQSLLNKVG----AVVKDYKPVPVPE--LPAPNAAVDPSTPLKQQWL 399
               F GV    VLQ L   +     ++  D +  P     +   +   D ST + Q  L
Sbjct: 367 EEQIFEGVNFVPVLQELYQCIDVSKLSLQYDSRVTPYTNETMKLEDPTNDQSTDITQIHL 426

Query: 400 WNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAE 459
              + +FL  GD+V+ ETG+  F +    FP     ISQ  + SIG A  A LG  +A +
Sbjct: 427 QKVIPKFLNPGDVVVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIAMQ 486

Query: 460 ELDKSK------------RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEK 507
           +   +             R+ILF G+G+ Q+T QE+ST++++++   + + NN GYTIE+
Sbjct: 487 DHPNTHINGGNINEGYKPRLILFEGDGAAQMTIQELSTILKFHIPIEIVIWNNNGYTIER 546

Query: 508 LIHGPTAEYNEIQNWNHLDLLPTFGAKDYE----AIRVSTTGEWNKLAEDKDFNKNSKIR 563
            I GPT  YN+I +W    L   FG  D +     I  +T+    KL + K+ +   +I 
Sbjct: 547 AIMGPTRSYNDIMSWKWTKLFEAFGDFDGKYTNNTIIETTSKLALKLKDLKNSSTRDRIE 606

Query: 564 LIELMLPVMDAPESLVKQAQLTAATNAK 591
           L+E+ L V+D PE L    +  A    K
Sbjct: 607 LLEVKLGVLDFPEQLRCMVEAAALKRNK 634

>Smik_4.649 Chr4 (1154670..1156577) [1908 bp, 635 aa] {ON} YDR380W
           (REAL)
          Length = 635

 Score =  320 bits (819), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 218/619 (35%), Positives = 324/619 (52%), Gaps = 68/619 (10%)

Query: 21  VSQNKPEIT---MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIY----EVEGMR 73
           V+QN+P +    ++ I  G Y+F RL  +   +VFG+PGDFNL LL+ +Y    E  G+R
Sbjct: 10  VNQNEPHLVSNQLATIPFGEYIFRRLLSIGTKSVFGVPGDFNLSLLEYLYSPNVESAGLR 69

Query: 74  WAGNCNELNASYAADAYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVP- 131
           W G CNELNA+YAAD Y+R    + CLITT+GVGELSALNGIAGS+AE+V VLHIVGV  
Sbjct: 70  WVGTCNELNAAYAADGYSRYSNKIGCLITTYGVGELSALNGIAGSFAENVKVLHIVGVAK 129

Query: 132 ---SVSAQAKQLLLHH---TLGNGDFT-----VFHRMSAN-ISETTAMITDLATAPSEID 179
              S S   K+  LHH    + N +F      V+H M  + ++ + A + D+ TA  ++D
Sbjct: 130 SIDSRSNNFKERNLHHLVPQVHNSNFKGPNHKVYHDMVKDRVACSVAYLEDIETACVQVD 189

Query: 180 RCIRTTYIRQRPVYLGLPSNFVDQMVPA-SLLDTP----IDLALKPNDQQAEEEVISTLL 234
             IR  +   +P Y+ +P++F D  V A +L+  P     D    P + Q  + +I  + 
Sbjct: 190 NVIRDIFKYSKPGYIFVPADFADMSVAADNLVKVPHISQQDCITYPPEVQLLD-IIDKIT 248

Query: 235 EMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVG 294
             +  +K P IL D    R+ V     +LI  T+  +F T MGK  IDE +P + G Y G
Sbjct: 249 SWMYSSKTPAILGDVLTDRYGVSNILNELIYTTKIWNFSTVMGKSVIDESNPTYMGQYNG 308

Query: 295 TLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYK-TKNVVEFHSDHIKIRNATFPGV 353
                 V +  ES DLVL  G  +++ N G ++++YK    +++FH ++I+  +  +   
Sbjct: 309 KEGLKQVYKHFESCDLVLHFGVDINEINNGHYTFTYKPNAKIIQFHPEYIRFVDTKYGDE 368

Query: 354 QMKFVLQSLLNKVGAVVKDYKPVPVPELP----------------APNAAVDPSTPLKQQ 397
           QM       +N V  + + YK + V  L                   +   D S+ + Q 
Sbjct: 369 QMF----EGVNFVPVLKELYKLIDVARLSLQYDSNVTSYTNETMQIEDLTDDQSSIITQA 424

Query: 398 WLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMA 457
            L   +  FL  GD+V+ ETG+  F +    FP     ISQ  + SIG A  A LG  +A
Sbjct: 425 HLQKVMPGFLNPGDVVVCETGSFQFSVRDFAFPTQLKYISQGFFLSIGMALPAALGVGIA 484

Query: 458 AEEL------------DKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTI 505
            ++             D   R+ILF G+G+ Q+T QE+ST+++ N+   + + NN GYTI
Sbjct: 485 MQDYSNAHINGSNVKEDYKPRLILFEGDGAAQMTIQELSTILKCNVPLEIIIWNNNGYTI 544

Query: 506 EKLIHGPTAEYNEIQNWNHLDLLPTFGAKDYEAIRVSTT------GEWNKLAEDKDFNKN 559
           E+ I GPT  YN+I +W    L   FG  D++    S+T          KL E K+  + 
Sbjct: 545 ERAIMGPTRSYNDIMSWKWTKLFEAFG--DFDGKHTSSTLIEFPSKLALKLKELKNSARR 602

Query: 560 SKIRLIELMLPVMDAPESL 578
           ++I L+E+ L V+D PE L
Sbjct: 603 NQIELLEVKLGVLDFPEQL 621

>KLTH0F15510g Chr6 complement(1265767..1267644) [1878 bp, 625 aa]
           {ON} similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 625

 Score =  318 bits (816), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 204/606 (33%), Positives = 319/606 (52%), Gaps = 61/606 (10%)

Query: 32  EITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVE----GMRWAGNCNELNASYAA 87
            I LG+Y+FER+      T+FG+PGDFNL LL+ IY  E    G++W G CNELNA+YAA
Sbjct: 21  RIPLGQYIFERIVSSGTRTIFGVPGDFNLSLLEHIYNPEVALKGIKWIGTCNELNAAYAA 80

Query: 88  DAYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGV-PSV----SAQAKQLL 141
           D Y+R    + CLITT GVGELSALNGIAG++AE V +LHIVGV PS     SAQ+   +
Sbjct: 81  DGYSRYTNKIGCLITTLGVGELSALNGIAGAFAEDVKILHIVGVAPSQFYEGSAQSSHNV 140

Query: 142 LHHTLGNGDFTVF---HRM-----SANISETTAMITDLATAPSEIDRCIRTTYIRQRPVY 193
            H      D  +    HR+        +S ++  + D+++A  +ID  I   Y   +P Y
Sbjct: 141 HHLVPAVFDSNIHAPNHRVYRDMVDKRVSCSSLFLDDISSACDQIDTVISDIYRYSKPGY 200

Query: 194 LGLPSNFVDQMVPASLLDTPIDLALKP-------NDQQAEEEVISTLLEMIKDAKNPVIL 246
           + +P++F D++V A  L+    + L+        ND + +E +   +LE +  +  P I+
Sbjct: 201 IFIPADFTDKLVDARNLEKRPAILLRDVVSGFCINDHKCQE-LAEYILESMYSSSRPAII 259

Query: 247 ADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVE 306
           AD    R+D+ +  ++L++ T   +F + MGK  +DE +  F GVY G+ S   V +  +
Sbjct: 260 ADILCDRYDLTSSLRELVNKTHVWNFASSMGKSILDENNLGFRGVYNGSESQDQVLKDFQ 319

Query: 307 SADLVLSVGALLSDFNTGSFSYSYKT-KNVVEFHSDHIKI------RNATFPGVQMKFVL 359
           + D +L VG + ++ NTG +SY +    N+VE H  ++        +N    G     VL
Sbjct: 320 TCDFLLHVGVVKNEMNTGHYSYKFSNHSNIVELHPSYVNFIDADTGKNRYVTGQYFFKVL 379

Query: 360 QSLLN-----KVGAVVKDYKPVPVPELPAPNAAVDPSTPLKQQWLWNQVGQFLQEGDIVL 414
             +       K+    ++  P    E   P     P + +   +L     +FL  GD+ +
Sbjct: 380 DMMTQMIDPTKLHLGYQESIPSRTQEYCGP-----PHSSVTHSYLQTHFPKFLSSGDVFV 434

Query: 415 TETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEEL------------- 461
            +TG+  FG+    FP++   ISQ  + SIG A    LG  +  ++              
Sbjct: 435 VDTGSFQFGVRDYRFPSDLKYISQSFYLSIGMALPCALGVGLGMQDYPSNHIISSALVQR 494

Query: 462 DKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYNEIQN 521
           +   R+IL  G+G+ Q+T QE+++ +R+ +   LF+ NN GYT+E+ I GP   YN+I  
Sbjct: 495 NYQPRLILCEGDGAAQMTIQELTSFLRYKVPIDLFIWNNGGYTVERAIKGPNRPYNDIMA 554

Query: 522 WNHLDLLPTFGAKDYE---AIRVSTTGEWNKLAED-KDFNKNSK-IRLIELMLPVMDAPE 576
           W   +LL  FG    E   + +VS+  + ++L +  +  +K SK +RL+E+ML VMD PE
Sbjct: 555 WEWTELLRVFGDPKLENSVSQKVSSADQMSELLKTFRSSDKRSKLVRLVEVMLGVMDFPE 614

Query: 577 SLVKQA 582
            L   A
Sbjct: 615 QLKAMA 620

>Kpol_1062.12 s1062 complement(31361..33253) [1893 bp, 630 aa] {ON}
           complement(31361..33253) [1893 nt, 631 aa]
          Length = 630

 Score =  315 bits (806), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 196/594 (32%), Positives = 305/594 (51%), Gaps = 49/594 (8%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIY------EVEGMRWAGNCNELNASYA 86
           +  G Y+F+RL      ++FG+PGD+NL LL+ +Y      +   + W G CNELNA+YA
Sbjct: 24  LRFGDYIFKRLNSCGTKSIFGVPGDYNLNLLELMYPNGTANKTSEINWIGCCNELNAAYA 83

Query: 87  ADAYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHT 145
           AD Y+R    + C++TT GVGELSA+NGI+GS+AEHV VLHIVG+PS          HH 
Sbjct: 84  ADGYSRYTNKLGCIVTTCGVGELSAMNGISGSFAEHVKVLHIVGIPSTEKFKTGGNFHHL 143

Query: 146 LGN--------GDFTVFHRM-SANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGL 196
           L N         ++ VF  M   ++S +T  I +L TA  E D  IR  Y   +P Y+ +
Sbjct: 144 LPNFKESNLNKPNYKVFAEMVQGSVSCSTKFIENLDTACQEFDDLIRDIYKYSKPGYMFV 203

Query: 197 PSNFVDQMV-PASLLDTPI-----DLALKPNDQQAEEEVISTLLEMIKDAKNPVILADAC 250
           P N+    V P +L +TP       + + P+  +  + +   +   +  A+ P I+AD  
Sbjct: 204 PENYFKLYVNPKNLYETPSITLQDCITMSPDKMEMADGLTDFIFSYLYHAEKPAIIADTL 263

Query: 251 ASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADL 310
             R+   +   + I  T   +F T MGK  +DE    + GVY G      V++A+ + DL
Sbjct: 264 TDRYSGSSLLNEFIQKTNIWNFSTLMGKSILDESTETYKGVYNGKDGCEKVQKAISTCDL 323

Query: 311 VLSVGALLSDFNTGSFS---YSYKTKNVVEFHSDHIKI------RNATFPGVQMKFVLQS 361
           +L  G   ++ N+G+++   Y  K   ++EFH  +I++          F GV+  ++L+ 
Sbjct: 324 ILHFGVEKNEVNSGTYTFEDYYSKVSFIIEFHPQYIRMIDMQSKSTQLFGGVEFTYILKR 383

Query: 362 LLNKVGA--VVKDYKPVPVPELPAPNAAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGT 419
           +L  V    +  +Y             AV  +  + Q  +   +  +++ GD+VL +TGT
Sbjct: 384 MLKMVNPSNLHLNYPTSDESSTKTDQEAV-ANNQITQDHISTTMESYIKPGDVVLCDTGT 442

Query: 420 SAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSK------------RV 467
             F +    F +    +SQ  + SIGYA  + LG  +A  +   S             R+
Sbjct: 443 FQFSLRDFKFSSQVKLVSQFFYLSIGYALPSALGVGIAMRDYPNSHIKDEQLKENTKPRL 502

Query: 468 ILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYNEIQNWNHLDL 527
           ILF G+G+ Q+T QE+STM+R+ +   +F+ NN GYTIE+ I GPT  YN+IQ WN   L
Sbjct: 503 ILFEGDGAAQMTVQELSTMLRYEVPMDIFLWNNDGYTIERAIQGPTRSYNDIQPWNWTYL 562

Query: 528 LPTFG-AKDYEAI--RVSTTGEWNKLAEDKDFNKNSKIRLIELMLPVMDAPESL 578
              FG AK+  A   +V TT E + +  +      + I  +E+ L +MD P+ L
Sbjct: 563 FKAFGDAKENFAKNHKVETTKELDNILTELRSKDQNNINFVEVTLGIMDMPKIL 616

>ACR211W Chr3 (716693..718582) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR380W (ARO10)
          Length = 629

 Score =  313 bits (803), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 207/608 (34%), Positives = 321/608 (52%), Gaps = 57/608 (9%)

Query: 31  SEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYE----VEGMRWAGNCNELNASYA 86
           +E+ LG Y+F RL      TVFG+PGDFN+ LL+ +Y      EG++W G CNELNA+YA
Sbjct: 28  AEMPLGEYMFRRLMSAGTKTVFGVPGDFNMGLLEHMYGEAVCAEGLQWIGTCNELNAAYA 87

Query: 87  ADAYAR-IKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLL---L 142
           AD Y+R    + C++TT GVGELSALNG+AG++AEHV VLHIVGV   +AQ    L   +
Sbjct: 88  ADGYSRYCNKIGCVVTTLGVGELSALNGVAGAFAEHVKVLHIVGVSMRAAQTHPELHGNV 147

Query: 143 HH---TLGNGDFT-----VFHRM-SANISETTAMITDLATAPSEIDRCIRTTYIRQRPVY 193
           HH    L N +F      V+  M S  +S     + DL TA  +ID  IR  +   +P Y
Sbjct: 148 HHLVPRLRNSNFKAPNHKVYSEMVSGRVSCCCEFLEDLETACDQIDHVIREIWRHGKPGY 207

Query: 194 LGLPSNFVDQMVPA-SLLDTPIDL----ALKPNDQQAEEEVISTLLEMIKDAKNPVILAD 248
           L +P++  +  V + +L+  P  +     L+  +  A + +   +L+ +  +  P IL D
Sbjct: 208 LFVPADMPNMKVSSRNLVQAPTIMLESAVLERTNLAACDRIGIEILQHLYQSSTPAILCD 267

Query: 249 ACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESA 308
               R  +  + ++L+++T   +F T MGK  +DE  P + GVY G   S      ++  
Sbjct: 268 GLCDRFGLTGDVRRLVELTGMWNFSTIMGKSILDETQPHYKGVYYGA-GSKERNALLQEC 326

Query: 309 DLVLSVGALLSDFNTGSFSYSYKTKN-VVEFHSDHIKI-RNA---TFPGVQMKFVLQSLL 363
           DL+L +G +  + NT  +++ +  ++ ++E H +++ + RN          +  VL+S+L
Sbjct: 327 DLILYLGPVKDEVNTWKYTFQFNPQSMIIELHPEYVSLTRNGEQTILNSGHLLPVLRSIL 386

Query: 364 NKVGAVVKDYK-PVPVPELPAPNA-AVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSA 421
             +      +  P     +P  +  A D   P+ Q  L + + + L  GD+++ +TGT  
Sbjct: 387 AHLNVANLSFNYPTAKKRVPREHQYAAD--EPITQGMLQHMIPECLNPGDVMVVDTGTFQ 444

Query: 422 FGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDK------------SKRVIL 469
           F +    FP +   ISQ  + SIG A  A LG   A  E  +            + R++L
Sbjct: 445 FSVFDMKFPTDLKCISQSFYLSIGMALPAALGVACAMREFPRLHLGPKLANEGYTPRLVL 504

Query: 470 FTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYNEIQNWNHLDLLP 529
             G+G+ Q+T QE+ST +R+ L   + + NN GYT+E++I GPT  YN+I +W+   LL 
Sbjct: 505 CEGDGAAQMTIQELSTFIRYELPVEVLLWNNDGYTVERVIKGPTRSYNDIMSWDWTKLLR 564

Query: 530 TFGAKD---YEAIRVSTTGEWNKLAED----KDFNKNSKIRLIELMLPVMDAP---ESLV 579
            FG  D    E++RV    ++N L E     K   K SKIRL+E++L  MD     + L 
Sbjct: 565 VFGDFDGTRSESVRVK---DFNSLIEHLSSWKSDKKRSKIRLMEVILDKMDISATLKELA 621

Query: 580 KQAQLTAA 587
           KQ Q  AA
Sbjct: 622 KQFQHNAA 629

>ZYRO0G04378g Chr7 complement(350070..351911) [1842 bp, 613 aa] {ON}
           similar to uniprot|Q06408 Saccharomyces cerevisiae
           YDR380W ARO10 Phenylpyruvate decarboxylase catalyzes
           decarboxylation of phenylpyruvate to phenylacetaldehyde
           which is the first specific step in the Ehrlich pathway
          Length = 613

 Score =  312 bits (799), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 199/619 (32%), Positives = 323/619 (52%), Gaps = 58/619 (9%)

Query: 21  VSQNKPEITMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVE----GMRWAG 76
           VS    +I    I  G Y+F++L Q    ++FG+PGD+NL LL+ +Y+      G RW  
Sbjct: 4   VSYESQDIRTKRIPFGEYLFKKLVQSGSKSIFGVPGDYNLPLLEHLYDDSVKDIGCRWIA 63

Query: 77  NCNELNASYAADAYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSA 135
            CNELNA+YAAD Y+R    ++ LITT+GVGELSA+NG+AGS AE+V VLHIVGV  V +
Sbjct: 64  CCNELNAAYAADGYSRYTNKLATLITTYGVGELSAINGVAGSSAENVKVLHIVGV--VKS 121

Query: 136 QAKQLLLHHTL---------GNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTY 186
            A +   HH +         G      +  +   ++ +   + D+ TAP ++D+ I   Y
Sbjct: 122 DAPECNYHHLIPQLQHSNFIGPNRKICYDMVKDRVACSAEYLEDIETAPEKVDKVITEIY 181

Query: 187 IRQRPVYLGLPSNFVDQMVPASLLDTPIDL--ALKPNDQQAEEEVISTLLEMIKDAKNPV 244
              +P YL +P++F D++V  + L+  I+L  +++    +  + ++  +L+ I  ++ P 
Sbjct: 182 KHSKPGYLFVPADFADKLVDTTCLNNEINLCNSIERTPSEKLDSIVDGVLQWIYQSQTPA 241

Query: 245 ILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEA 304
           ILAD    R  + ++  + I+ TQ  +F T MGK  IDE +PR+ G+Y G   +  V+  
Sbjct: 242 ILADGNVDRFGLISQLNQFIERTQMVNFTTIMGKSIIDETNPRYQGLYAGKSCTDLVRSK 301

Query: 305 VESADLVLSVGALLSDFNTGSFSYSYKTK-NVVEFHSDHIKIRNAT------FPGVQMKF 357
             S DL+L  G   ++ N  +  + Y  +  V+EFH  +I++ +        F  V    
Sbjct: 302 FLSCDLILHFGVEKNEVNYCAQGFPYGPQAKVIEFHQSYIRLFDTLNGDEQLFENVNFVD 361

Query: 358 VLQSLLNKVG----------AVVKDYKPVPVPELPAPNAAVDPSTPLKQQWLWNQVGQFL 407
           VL +L  ++           A+   Y+P  +      N   + ++ + Q +L  +  + L
Sbjct: 362 VLTALHQRIDISKLNLQYDKAIFTTYEPSQL------NLPEEDTSDVTQIYLQKKFPEIL 415

Query: 408 QEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEE------L 461
             GDI++++TG+  FG+     P  +  ++Q  W SIG    A LG  +  ++       
Sbjct: 416 APGDILVSDTGSFQFGVRDYKLPTQSKFMAQSTWLSIGMGLPAALGVGIGMQDYPRIHIC 475

Query: 462 DKSK-------RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTA 514
           D+SK       +++L  G+G+ Q+T QE++TM+R+++   +FV NN GYTIE+ I G  +
Sbjct: 476 DQSKVPAGYKPKLVLGVGDGAAQMTVQELTTMLRYHVDINVFVWNNNGYTIERAIMGENS 535

Query: 515 EYNEIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAED-KDFNKNSK-IRLIELMLPVM 572
           +YN+I  W    L   FG  D +    S      +L +  +D NK  K I L+E+ L VM
Sbjct: 536 DYNDIMPWRWTKLFEAFGDFDGKYSNSSLVKTRQELDQKIEDINKGGKGIELVEVKLGVM 595

Query: 573 DAPESLVKQAQLTAATNAK 591
           D P  L  Q  L+   NAK
Sbjct: 596 DYPAQL--QMMLSNMKNAK 612

>TBLA0A02670 Chr1 complement(648495..650417) [1923 bp, 640 aa] {ON}
           Anc_5.456 YDR380W
          Length = 640

 Score =  312 bits (800), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 210/619 (33%), Positives = 322/619 (52%), Gaps = 64/619 (10%)

Query: 22  SQNKPEITMSE-ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIY---------EVEG 71
           + N  ++ M++ IT G Y+F+RL  +   +VFG+PGDFNL LL+ +Y         E   
Sbjct: 11  TANSYDLQMNDSITFGHYIFQRLLSLGTKSVFGVPGDFNLPLLEYLYDDFQSPDTKEKTS 70

Query: 72  MRWAGNCNELNASYAADAYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGV 130
           +RW G CNELN++Y+AD Y+R    +SCLITTFGVGELSA+NG++GS+AE++ VLHIVGV
Sbjct: 71  IRWVGGCNELNSAYSADGYSRYTNKISCLITTFGVGELSAINGVSGSFAENIKVLHIVGV 130

Query: 131 PSV----SAQAKQLLLHHTLGNGD--------FTVFHRMSAN-ISETTAMITDLATAPSE 177
           PS     S   K   LHH + + D          V+H M  + IS +T +++D+  A   
Sbjct: 131 PSTKITESPVQKNWNLHHLVPSMDCPNFNPPNHNVYHDMIKDKISCSTHILSDITKAADM 190

Query: 178 IDRCIRTTYIRQRPVYLGLPSNFVDQMVPA-SLLDTP---IDLALKPNDQQAE------E 227
           +D+ I   Y   RP YL +PSNF D +V   +L+D P   +D AL  N   +       +
Sbjct: 191 VDQVILDIYKYSRPGYLFVPSNFPDMLVSTKNLIDRPTITMDDALALNSIDSNFSLSHMK 250

Query: 228 EVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPR 287
           ++   +L+++  ++ P ++ D    R+  K    + I+ T+  +FVTP+ K +IDE +  
Sbjct: 251 DLTRRILKILYKSETPAVVCDMLVDRYGGKKLINEFINRTKIRNFVTPLSKSTIDETNEN 310

Query: 288 FGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYKTK-----------NVV 336
           + G+Y G  S+  V E  E++DLVL  G   ++ NTG +S+SY               VV
Sbjct: 311 YVGLYNGKQSNAKVIEHFENSDLVLHYGVFSNEVNTGVYSHSYGPNTTLIQLNPTYLRVV 370

Query: 337 EFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDPSTPLKQ 396
           E+ + H       +  V    +L+ LL  +     ++K  P+          +    + Q
Sbjct: 371 EYENGHHS--ELIYRDVNFLHILKQLLKDIDLSKLNFKYQPLATRVKQETIENSDGKITQ 428

Query: 397 QWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVM 456
             L          GDI++ +TG   F I    F +    I+Q  + SIG A    LG  +
Sbjct: 429 ASLGQAFPSTFNPGDILVADTGAFQFSIRDFVFHSQMKYITQGFYLSIGMALPCALGVGV 488

Query: 457 AAEEL------DKSK-------RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGY 503
           A ++       DKSK       R+IL  G+G+ Q+T QE+STM+R  +   +++ NN GY
Sbjct: 489 AMQDYPLEHVYDKSKLPKNYTPRLILCEGDGAAQMTVQELSTMIREKISIEIYLWNNDGY 548

Query: 504 TIEKLIHGPTAEYNEIQNWNHLDLLPTFG---AKDYEAIRVSTTGEW-NKLAEDKDFNKN 559
           TIE+ I GPT  YN+I  WN   LL +FG    K   ++ + T  +   KL + K+ + N
Sbjct: 549 TIERAIMGPTRSYNDIAAWNWTTLLNSFGDINGKLTNSVTIETQSDLVAKLKDLKEGDNN 608

Query: 560 SKIRLIELMLPVMDAPESL 578
             I  +E+ML  +D P  L
Sbjct: 609 KCIEFMEVMLGKVDYPPQL 627

>Kpol_440.4 s440 (9465..11375) [1911 bp, 636 aa] {ON} (9465..11375)
           [1911 nt, 637 aa]
          Length = 636

 Score =  309 bits (791), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 198/600 (33%), Positives = 319/600 (53%), Gaps = 54/600 (9%)

Query: 32  EITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEG---MRWAGNCNELNASYAAD 88
           +I LG Y+  RL  +   + FG+PGDFNL LL+ +Y  +G   + W G CNELNASYAAD
Sbjct: 16  KIPLGEYLVRRLLSIGSKSAFGVPGDFNLPLLEFLYNKDGDEIINWIGCCNELNASYAAD 75

Query: 89  AYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGV-PSVSAQAKQLL---LH 143
            Y+R    + CLITT+GVGELSA+NGI GSYAE++ +LHIVGV P+  ++ + L    LH
Sbjct: 76  GYSRYTNKIGCLITTYGVGELSAINGITGSYAENIKILHIVGVAPTFISEDENLKYKNLH 135

Query: 144 H--------TLGNGDFTVFHRMSAN-ISETTAMITDLATAPSEIDRCIRTTYIRQRPVYL 194
           H         + + +F ++++M  + IS  +  +TD+ T+  +ID  I   +   +P Y+
Sbjct: 136 HLIPDKEFPNINSPNFKIYYQMVKDKISCASEYLTDIETSCDKIDDVIVQIFKHSKPGYI 195

Query: 195 GLPSNFVDQMVPA-SLLDTP-IDLA--LKPNDQQAEEEVISTLLEMIKDAKNPVILADAC 250
            +PS+F +++V + +L++ P I+L+  L     +  + + + ++++I ++++P I+ D  
Sbjct: 196 FIPSDFSNKLVSSKNLINVPSINLSDCLNKTPMEKIDNLTNEIIDLIGNSQSPAIIGDVL 255

Query: 251 ASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADL 310
             R          I +T+F +F T MGK  IDE    + G Y+G      V   +   D+
Sbjct: 256 TDRFGCTKLLNDFIQMTKFWNFSTMMGKSVIDESGQAYMGTYIGLGGLTTVYNKILKCDI 315

Query: 311 VLSVGALLSDFNTGSFSYSY-KTKNVVEFHSDHIKIRNAT---------FPGVQMKFVLQ 360
            L  G  +++ N+G++S+ + K   ++E + +++KI             +P V M  +L+
Sbjct: 316 FLIFGLEMNEMNSGNYSFKFPKGSQIIEINPNYLKITKCHDTENQIVDFYPNVSMTHILE 375

Query: 361 SLLNKVGA------VVKDYKPVPVPELPAPNAAVDPSTPLKQQWLWNQVGQFLQEGDIVL 414
            L+ KV          K  K     EL  P    D    + Q  L  ++  FL  GD+++
Sbjct: 376 GLIAKVNIHDANTNYDKSVKSYDTSELVLPLQQEDEEK-ITQVHLQRELPNFLNPGDVLV 434

Query: 415 TETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDK----------- 463
            ETG+  F +    FP+N   ISQ  + SIG A  A LG  +A ++  K           
Sbjct: 435 CETGSFQFAVQDFKFPSNLKYISQGFYLSIGMALPAALGVGIAMKDYPKFHLNDHSLARN 494

Query: 464 -SKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYNEIQNW 522
            + R+IL  G+G+ Q+T QE++TM+R  +   +F+ NN GYT+E+ I GP   YN+I  W
Sbjct: 495 YTPRLILLEGDGAAQMTVQELTTMLRHKIPMEIFLWNNNGYTVERAIEGPFRSYNDIMPW 554

Query: 523 NHLDLLPTFGAKDYEAIRVSTTGEWNKLAED----KDFNKNSKIRLIELMLPVMDAPESL 578
           N   LL   G  + E  R  T  + ++L+E     K+   N+ I+LIE+ L   D P  L
Sbjct: 555 NWTKLLNVLGDPNNEFNRCVTIDKKSQLSEKFKELKEGKDNNCIQLIEVQLDTHDIPRQL 614

>TPHA0J02680 Chr10 (593893..595839) [1947 bp, 648 aa] {ON} Anc_5.456
           YDR380W
          Length = 648

 Score =  304 bits (778), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 207/627 (33%), Positives = 316/627 (50%), Gaps = 75/627 (11%)

Query: 31  SEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIY-------EVEGMRWAGNCNELNA 83
           + ITL  Y+F RL+     ++FG+PGDFNL LL+ +Y       EVE + W G CNELNA
Sbjct: 15  NSITLAEYIFRRLRSSGTYSLFGVPGDFNLPLLESLYHKTADGKEVELLNWIGCCNELNA 74

Query: 84  SYAADAYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSA-QAKQLL 141
           +YAAD Y+R    + CL+TTFGVGE+SALNGI G+  E+V VL+IVG+P      + Q  
Sbjct: 75  AYAADGYSRYTNKIGCLVTTFGVGEISALNGIVGAAVENVKVLNIVGIPPTHILNSSQYN 134

Query: 142 LHHTLGN--------GDFTVFHRMSANISETTAMITDLATAPSE--------IDRCIRTT 185
           +HH++ N         ++  +  M  N         +L+   ++        ID+ I+  
Sbjct: 135 IHHSIPNLKNSNSGVPNYKTYCDMVLNNITNNVEFLELSDIKNQNSNQVCNKIDQLIKNI 194

Query: 186 YIRQRPVYLGLPSNFVDQMVPASLL----DTPIDLALKPN----DQQAEEEVISTLLEMI 237
           +I  +P YL +PSN  + MV ++ L       +D ALK       +  E ++I  + +++
Sbjct: 195 FISSKPGYLFVPSNMTNMMVSSANLTLLPQINLDWALKSTRSNLSETIENDIIEEISQLL 254

Query: 238 KDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLS 297
             +K P IL D    R D + +  +LI      +F T +GK  IDE + RF G Y G  S
Sbjct: 255 YKSKKPCILCDVFIDRFDCRIQVNQLISKLNIWNFSTMLGKSIIDEDNDRFMGTYNGVTS 314

Query: 298 SPAVKEAVESADLVLSVGALLSDFNTGSFSYSYKTKNV-VEFHSDHIKI--RNATFPGVQ 354
              VK+  ES DL+L +G   ++ NTG +S+SY    V +E   D+IKI   +     + 
Sbjct: 315 DSYVKDNFESCDLILHLGIETNEMNTGCYSFSYLPDAVIIEVGKDYIKISKHDGKISKII 374

Query: 355 MKFVLQSLLNKVGAVVKDYKPV-----PVPELPA------------PNAAVDPSTPLKQQ 397
              +L+ ++ K+   + D K        V   P              N        + Q 
Sbjct: 375 NDIMLRDVIQKLLHFIDDSKCTYSFDNNVESFPTYKNKLISKKSLENNVESKAQQTVTQD 434

Query: 398 WLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMA 457
            L  ++     +GD+V+ ETG+  F I    FP  T  I+Q  + SIG A  A LG  + 
Sbjct: 435 DLQVEIQTLFDKGDVVVVETGSFQFAIPDMIFPKETKLINQGFYLSIGMALPASLGVGIG 494

Query: 458 AEEL------DKS-----KRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIE 506
             +       D S     K++ILF G+G+ Q+T QE+S+++R+ +   +F+ NN GYT+E
Sbjct: 495 MRDYPNCHINDNSEDATPKKLILFEGDGAAQMTIQELSSLLRYRIPIDIFIWNNNGYTVE 554

Query: 507 KLIHGPTAEYNEIQNWNHLDLLPTFGAKDYE-----AIRVSTTGEWN-KLAEDKDFNKNS 560
           ++  G    YN+I  W  ++LL  FG  D+E     +  +ST  E   K+ E K+ N   
Sbjct: 555 RIFEGEKRSYNDIMPWKWVNLLKVFG--DHEKTFSKSTTISTVQELRCKIDELKNANPQK 612

Query: 561 KIRLIELMLPVMDAPESL---VKQAQL 584
            I LIE+ L  MD P++L   V+Q +L
Sbjct: 613 IIELIEVKLGEMDIPKNLKHIVEQMKL 639

>KNAG0C04790 Chr3 complement(932051..933964) [1914 bp, 637 aa] {ON}
           Anc_5.456 YDR380W
          Length = 637

 Score =  303 bits (776), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 194/600 (32%), Positives = 312/600 (52%), Gaps = 56/600 (9%)

Query: 32  EITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEV----EGMRWAGNCNELNASYAA 87
           +I LG+Y+F+R+      ++FG+PGDFNL LL+ +YE     +G+RW G CNELNA+YAA
Sbjct: 27  KIPLGKYLFQRVLSAGTKSIFGVPGDFNLPLLEHLYERDLVEQGLRWIGTCNELNAAYAA 86

Query: 88  DAYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTL 146
           D ++R    + CLITT+GVGELSALNG+AG++AE+V +LHIVGV   SA+ +   +HH +
Sbjct: 87  DGFSRYSNKIGCLITTYGVGELSALNGVAGAFAENVKMLHIVGVAKSSAKHENKNIHHLI 146

Query: 147 GNGDFTVFHR---------MSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLP 197
            N   + F R         +   +  +   + ++  A  +ID+ IR  Y   +P Y+ +P
Sbjct: 147 PNLHDSNFKRPNHKVYYEMVKDRVCCSAEYLENIDQACDQIDKVIRDIYRYSKPGYIFIP 206

Query: 198 SNFVDQMVPAS-LLDTP-IDL--ALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASR 253
            +FV+++V  + LL TP IDL  +L   D+    EV   + + I  + NP ++ D    R
Sbjct: 207 VDFVNELVETTNLLVTPVIDLESSLARPDEVTVIEVAQMIADWIYQSGNPGLVGDVLTDR 266

Query: 254 HDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLS 313
           +D        I +T+  +F T  GK  IDE +P + G+Y G      V +     DLVL+
Sbjct: 267 YDATKMLNDFIQLTKMWNFTTVNGKSIIDESNPWYMGLYNGDEGVSTVIDRFHKCDLVLN 326

Query: 314 VGALLSDFNTGSFSYSYK-TKNVVEFHSDHIKIRNAT------FPGVQMKFVLQSLLNKV 366
            G  +++ N G +++ YK    +VE H  +++  +        F G+   FVL+ L+N++
Sbjct: 327 FGLDINEINHGHYTFKYKPNSKIVELHPTYVRFLDTEYGTERLFKGLNFVFVLKELINRI 386

Query: 367 G--AVVKDY----KPVPVPELPAPNAAVD--PSTPLKQQWLWNQVGQFLQEGDIVLTETG 418
                +  Y    +     E+  P    D   ++ + Q  L   +  +L  GDIV+ ETG
Sbjct: 387 NPKECMFSYDLSVRKFCSEEIKTPEDGNDDAEASTITQNKLSKMIPDYLNPGDIVVCETG 446

Query: 419 TSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEEL-------------DKSK 465
           +  F +     P     +SQ  + SIG A  A +G  +A ++              +   
Sbjct: 447 SFQFAMRDIVLPPQVKYMSQGFFLSIGTALPAAVGVGIALQDYPNQHINNFGAVDHNYKP 506

Query: 466 RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYNEIQNWNHL 525
           R+IL  G+G+ Q+T QE+++M+R+ +   + + NN GYT+E+ I GPT  YN+I  W+  
Sbjct: 507 RLILLEGDGAAQMTVQELTSMIRFQIPIEIMLWNNNGYTVERAILGPTRSYNDIMPWDWT 566

Query: 526 DLLPTFGAKDYE-------AIRVSTTGEWNKLAEDKDFNKNSKIRLIELMLPVMDAPESL 578
            L   FG  D+E       AI  ++           + N++  I ++E+ L VMD P  L
Sbjct: 567 KLFAAFG--DFEGKYTRSTAIETTSKLLLKLNQLKNEGNRDI-IEMVEVKLGVMDYPHQL 623

>TDEL0D02450 Chr4 complement(477063..479090) [2028 bp, 675 aa] {ON}
           Anc_5.456 YDR380W
          Length = 675

 Score =  303 bits (777), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 203/609 (33%), Positives = 316/609 (51%), Gaps = 60/609 (9%)

Query: 31  SEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEV-------EGMRWAGNCNELNA 83
           ++I  G YVF+RL  V V ++FG+PGD+N+RLL+ +Y+        + + W G CNELNA
Sbjct: 60  AQIPFGLYVFKRLLSVGVKSIFGVPGDYNMRLLEHMYDESLVDTAGDKLEWVGCCNELNA 119

Query: 84  SYAADAYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-----VPSVSAQA 137
           +YAAD Y+R    + C+ITT+GVGEL A++G+AG++AE V VLHIVG     V  +  + 
Sbjct: 120 AYAADGYSRYSNEIGCVITTYGVGELGAISGLAGAFAESVKVLHIVGIVDYEVNDLGPEM 179

Query: 138 KQLLLHHTLGN--------GDFTVFHRMSAN-ISETTAMITDLATAPSEIDRCIRTTYIR 188
           +   LHH L           D+ V+  M  + ++ +   + DL TA  ++D+ I   Y  
Sbjct: 180 RSHNLHHLLPRLNDSNFVGPDYRVYAEMVKDKVACSVEYLDDLETACDKVDKVIEDIYKY 239

Query: 189 QRPVYLGLPSNFVDQMVPA-SLLDTP-IDLALKPNDQQAEEEVIST--LLEMIKDAKNPV 244
            +P YL +P +FVD++V   +L++ P I L         +E  I T  +L ++  + +P 
Sbjct: 240 SKPGYLFVPRSFVDELVSTKNLIEKPTITLRECIEKSPVDEAKIVTEKILRLLNQSASPA 299

Query: 245 ILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEA 304
           ++ D    R+ ++ E    I+      F T  GK  IDE  P + G Y G  S+P V E 
Sbjct: 300 VIGDMFTDRYGLRVELNDFINKANIVGFSTVQGKSIIDESSPLYMGAYNGMTSAPTVSEK 359

Query: 305 VESADLVLSVGALLSDFNTGSFSYSYKTK-NVVEFHSDHIKIRNAT------FPGVQMKF 357
           + + DLVL  G   ++ N G++++ +K+   +VE H  +I+  + T      + GV    
Sbjct: 360 LLACDLVLHFGIEKNEVNYGNYNFPHKSDAKIVELHPQYIRFYDNTTKKEEIYKGVSFVD 419

Query: 358 VLQSLLNKVGAVVK-------DYKPVPVPEL--PAPNAAVDPSTPLKQQWLWNQVGQFLQ 408
           +L  LLN+   + +        +K   + EL     +   D ++ + Q  L   +  +L 
Sbjct: 420 IL-DLLNQSPELSELSFQYNSKFKAYTIEELNLDERDFGNDETSDITQGTLQKSMPNYLN 478

Query: 409 EGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEEL------D 462
            GD+++++TGT  F I     P+    I+Q  + SIG A  A LG  +A  +       D
Sbjct: 479 PGDVLISDTGTFQFAIRDFSLPSQVKYITQGFYLSIGMALPAALGVGIAMRDYPMHHVWD 538

Query: 463 KSK-------RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAE 515
             K       +VILF G+G+ Q+T QE+STM+R  +   +F+ NN GYTIE++I GPT  
Sbjct: 539 VEKIPFGYEPKVILFEGDGAAQMTVQELSTMIRHQVPIEIFLWNNNGYTIERVIEGPTRP 598

Query: 516 YNEIQNWNHLDLLPTFG---AKDYEAIRVSTTGEW-NKLAEDKDFNKNSKIRLIELMLPV 571
           YN+IQ W    LL  FG    K   A  + T  +  NKL+E K  +    I  +E+ L  
Sbjct: 599 YNDIQPWKWTKLLEAFGDFDGKHSRATVLETRSQLENKLSELKYKDHRRGIDFMEVKLAT 658

Query: 572 MDAPESLVK 580
           MD P  L K
Sbjct: 659 MDVPSQLQK 667

>TBLA0A06420 Chr1 complement(1577160..1579076) [1917 bp, 638 aa]
           {ON} Anc_5.456 YDR380W
          Length = 638

 Score =  297 bits (761), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 188/613 (30%), Positives = 317/613 (51%), Gaps = 72/613 (11%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVE----GMRWAGNCNELNASYAAD 88
           + LG Y++ +L Q+   T+FG+PGDFNL LL+ +Y  +    G++W G CNELNA+YAAD
Sbjct: 26  LPLGEYLYLKLAQIGTKTIFGVPGDFNLSLLELLYTQKVKDSGLKWVGCCNELNAAYAAD 85

Query: 89  AYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLG 147
            Y+R    + C++TT+GVGELSALNGIAG++AE++ +LH+VGVP          +HH + 
Sbjct: 86  GYSRYTNRVGCVVTTYGVGELSALNGIAGAFAENIKLLHVVGVPPTKYNTLNHNIHHLVP 145

Query: 148 NGDFT--------VFHRM-SANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPS 198
              ++        V+  M +  +    A ITDL  A  +I+  I+  +    P Y+ +P+
Sbjct: 146 RLKYSNLLAPNKEVYMEMVNEKVCCFYANITDLNQARWQIEIAIKHIFQYNLPAYIFIPT 205

Query: 199 NFVDQMVPASL-----------LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILA 247
           +F D ++P S+           ++  +++ L P+ +     V   +L ++  +K P I+ 
Sbjct: 206 DFQDALIPISVNEHLSREDIMPIEEIVEIPLLPSLEMVS--VCDYILSLLYSSKTPCIIG 263

Query: 248 DACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVES 307
           D    R  V  +   LI  T+  +F T M KG ++E +P + GVY G LS   + + ++ 
Sbjct: 264 DILVERFGVTKQINDLIHKTKLWNFSTFMSKGVLNESNPYYQGVYFGKLSQDHIVKKIQM 323

Query: 308 ADLVLSVGALLSDFNTGSFSYSYKTKNV-VEFHSDHIKIRN------ATFPGVQMKFVLQ 360
            DL++  G + ++ NTG +S++YK  +V ++ H D+++I          + G++ +    
Sbjct: 324 CDLIIHFGVVENEINTGYYSFNYKPDSVLIQIHPDYVRITQFQHNIRTDYKGIEFRTF-- 381

Query: 361 SLLNKVGAVVKDYKPVPVPEL------PAPNAAVDP-----STPLKQQWLWNQVGQFLQE 409
                V  V K  +P  +         P+ +A + P       P+   +L   + +++  
Sbjct: 382 -----VDMVTKGVQPNSINTTYNRLFSPSSHAYLFPLEQEEDGPISHDYLETIIPRYINP 436

Query: 410 GDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEE---LDKSK- 465
           GD+V+ ETG+  F +  T   ++   I+Q  + SIG A  A LG  MA  +   L  SK 
Sbjct: 437 GDVVVCETGSIQFTMVNTRLSSDVEYITQGFYLSIGMAIPASLGIGMAMRDYPNLHLSKK 496

Query: 466 ------------RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPT 513
                       R+IL  G+G+ Q+T QEI+ ++++ +   + +LNN+GYTIE+ I G  
Sbjct: 497 SSHSNVPPNYKPRLILLEGDGAAQMTVQEITNIIKYKIPIEILLLNNQGYTIERAIKGAD 556

Query: 514 AEYNEIQNWNHLDLLPTFGAKDYEAIR----VSTTGEWNKLAEDKDFNKNSKIRLIELML 569
            E+N+I  WN   LL   G    E        STT  + KL + KD+        +E++L
Sbjct: 557 KEFNDICEWNWPQLLNGLGGNLDETKNKYKFFSTTELYEKLKQLKDYPGKETFSFVEVIL 616

Query: 570 PVMDAPESLVKQA 582
             ++ P +L+K A
Sbjct: 617 NKLNIPTTLIKMA 629

>KLLA0E02707g Chr5 (251220..253115) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q06408 Saccharomyces cerevisiae YDR380W ARO10
           Phenylpyruvate decarboxylase catalyzes decarboxylation
           of phenylpyruvate to phenylacetaldehyde which is the
           first specific step in the Ehrlich pathway
          Length = 631

 Score =  295 bits (755), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 188/597 (31%), Positives = 311/597 (52%), Gaps = 50/597 (8%)

Query: 29  TMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYE----VEGMRWAGNCNELNAS 84
            +  I  G YVFERL      ++FG+PGDFNL LL+ +Y+      G++W G CNELN +
Sbjct: 28  VVKNIPFGHYVFERLLNSGAKSIFGVPGDFNLPLLEYLYDEDLVANGLQWIGTCNELNGA 87

Query: 85  YAADAYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGV-PSVSAQAKQLL- 141
           YAAD Y+R    + C+ITT+GVGELSALNG+AG++AE V VLHI+GV PS   + +Q   
Sbjct: 88  YAADGYSRYTNKLGCVITTYGVGELSALNGVAGAFAEDVKVLHIIGVSPSRFRENEQFRS 147

Query: 142 --LHHTLGNGDF-------TVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPV 192
             +HH +   D          F  +   +  ++A + D+ TA   +D+ I       +P 
Sbjct: 148 HNVHHLVPAIDSQQPPNHQVYFDMVKDRVCCSSAFLDDINTAADRLDQVIVDICKNSKPG 207

Query: 193 YLGLPSNFVDQMVP-ASLLDTPI---DLALKP-NDQQAEEEVISTLLEMIKDAKNPVILA 247
           Y+ +P +F D++V   +L+  PI   D  ++   D+ A +     LL+ I ++  P + +
Sbjct: 208 YVFIPVDFADKLVSNKNLIQNPIIDMDTVIESYKDENATKIAGDRLLQWIYESNAPSVFS 267

Query: 248 DACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVES 307
           D    R +++ E ++ I+     ++ T MGK ++DE++P++ G+Y G  +   ++  V+S
Sbjct: 268 DLLVDRFNLRKELRQFIETADVWNYNTAMGKSTLDERNPKYLGLYKGAETGKEMQATVDS 327

Query: 308 ADLVLSVGALLSDFNTGSFSYSYK--------TKNVVEFHSDHIKIRNA-TFPGVQMKFV 358
           +DL+L  G   ++ N G +S+ +         + N+++F    IK +NA T        V
Sbjct: 328 SDLILHFGPAKNEINCGYYSFHFNENARIIELSNNIIQFID--IKDKNASTVEEANFVSV 385

Query: 359 LQSLLNKVGAVVKDYKPVPVPELPAPNAAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETG 418
           L+ + + +      +   PVP+    +   D +  + Q+ L   +  +  +GD+++ ETG
Sbjct: 386 LKYVNDNLDKSKLSFSYPPVPK-SNHSCEYDNNDSITQKSLKEIIPNYFNDGDVLIVETG 444

Query: 419 TSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSK------------- 465
           +  FG+    F      I+Q  + SIG A  A LG      +  +S              
Sbjct: 445 SFQFGVPNMQFAREMKYITQSFYLSIGMALPAALGVGCGMRDYPRSHIVDQALVPKDYIP 504

Query: 466 RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYNEIQNWNHL 525
           R+IL  G+G+ Q+T QE ++ +R+ +   + V NN GYT+E+ I+GPT  YN+I  +   
Sbjct: 505 RLILCEGDGAAQMTIQEFASYIRYKIPMEILVWNNNGYTVERAINGPTRSYNDIAPFKWT 564

Query: 526 DLLPTFG---AKDYEAIRVSTTGEWNKLAED-KDFNKNSKIRLIELMLPVMDAPESL 578
            LL  FG    K  E++ V    E  +L    K   + + I+L E+MLPVMD P+ L
Sbjct: 565 ALLNVFGDFENKFNESVTVEKNDELVQLLNKWKSCKERANIKLAEVMLPVMDIPQEL 621

>SAKL0D00220g Chr4 complement(18466..20199) [1734 bp, 577 aa] {ON}
           uniprot|Q6XAE8 Saccharomyces kluyveri Pyruvate
           decarboxylase-like protein
          Length = 577

 Score =  290 bits (743), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 194/587 (33%), Positives = 304/587 (51%), Gaps = 51/587 (8%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVE--GMRWAGNCNELNASYAA 87
           MS + LG Y+F RL QV   TVFG+PGDFNL LL+ +Y  +   ++W GN NELNA YAA
Sbjct: 1   MSTMQLGTYLFYRLSQV-TKTVFGVPGDFNLNLLEHVYNFDESQIKWCGNANELNAGYAA 59

Query: 88  DAYARIKGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLL---HH 144
           D Y+RI    C ITT+GVGELSALN ++G++AE+  VLHIVG  S+ A+     L   HH
Sbjct: 60  DGYSRINKFGCFITTYGVGELSALNAVSGAFAENAPVLHIVGTSSMLAKRGACPLNQIHH 119

Query: 145 ------TLGNGDFTVFHRMSANISETTAMITD--LATAPSEIDRCIRTTYIRQRPVYLGL 196
                 T    D  V+ +++   S  T  ++D  L     +ID  I + +   +P YL +
Sbjct: 120 LIPPKKTYEAPDHKVYEKLAEPFSIHTESLSDENLEKIQDQIDSVIESIFCHMKPGYLFI 179

Query: 197 PSNFVDQMVPASL-----LDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACA 251
           PSN  D  +P  L      D    L + P    A  E++S  L+ I  ++NP  + D   
Sbjct: 180 PSNLPDAEIPVDLNKQLNFDFITKLRVDP---HATSEMVSLTLKRIYSSRNPGFIVDQFM 236

Query: 252 SRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLV 311
            R D++ +    ++   F  + T   +G  DE  P F GV+   LS+    E ++  D +
Sbjct: 237 -RFDLE-KLNLFLEKFNFYCYNTTTARGFADESLPNFHGVFNNELSTNGTLEILDQNDFI 294

Query: 312 LSVGALLSDFNTGSF----SYSYKTKNVVEFHSDHIKI--RNATFPGVQMKFVLQSLLNK 365
           L +G   ++ N  S+    S     K+V+    D+ ++        G+      + LL +
Sbjct: 295 LHLG---TNINEVSYFVGGSTPLDKKDVIFIGKDYAQVGTNGHIITGINCHVFFEELLQR 351

Query: 366 VGAVVKDYKPVPVPELPAPNAAV-------DPSTPLKQQWLWNQVGQFLQEGDIVLTETG 418
           + +     K +P  +     A         D S  + Q  L   V   L+E D+++ E  
Sbjct: 352 MNS-----KTMPKVKTRKSTALYNNGYTVDDDSKTVTQANLSQVVSAQLRENDVIINEMC 406

Query: 419 TSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVILFTGEGSLQL 478
           +  F +    +      + Q  +GSIGYA  A LGA +A ++  KS RVILF G+GS Q+
Sbjct: 407 SFMFEMPNIKYSKGCQFVGQPFYGSIGYALPATLGASLAIKDYKKSGRVILFQGDGSAQM 466

Query: 479 TAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYNE-IQNWNHLDLLPTFGAKDYE 537
           T QE+++ +R+ + P +F+LNN GY++E++I GPT  YN+ I +W+  ++L  FG ++ +
Sbjct: 467 TLQELASYIRFEIDPIIFMLNNSGYSVERVIKGPTRSYNDIIVDWDWCNILSVFGDRNGD 526

Query: 538 ---AIRVSTTGEW-NKLAEDKDFNKNSKIRLIELMLPVMDAPESLVK 580
              + +V   GE  N L +  D++ + KI+++E++L  MD P    K
Sbjct: 527 RSTSYKVEKLGELKNVLTKRLDYS-DGKIKMVEIILDRMDVPFGFKK 572

>TPHA0E01600 Chr5 complement(325811..327766) [1956 bp, 651 aa] {ON}
           Anc_5.456 YDR380W
          Length = 651

 Score =  284 bits (727), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 195/602 (32%), Positives = 310/602 (51%), Gaps = 54/602 (8%)

Query: 29  TMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEG------MRWAGNCNELN 82
           T + I  G+Y+F RL+     +VFG+PGD+NL LL+++Y+ E       ++W G CNELN
Sbjct: 34  TPNRIPFGKYIFRRLQSCGTKSVFGVPGDYNLNLLEQMYDEEDSITPNEIQWIGCCNELN 93

Query: 83  ASYAADAYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLL 141
           A+YAAD Y+R    + CLITT+GVGELSA+NGIAG++ E+V +LHIVGV S         
Sbjct: 94  AAYAADGYSRYTNKIGCLITTYGVGELSAINGIAGAFTENVKLLHIVGVVSQDKMKSGRN 153

Query: 142 LHHTLGNGD--------FTVFHRMSAN-ISETTAMITDLATAPSEIDRCIRTTYIRQRPV 192
            HH + N +        + +   M  N IS +T  + ++ATA  + D  +R  +   +P 
Sbjct: 154 FHHLIPNKENANLQAPNYQICKDMIDNKISCSTKFLDNIATACDDFDDLLRDIFKNSKPG 213

Query: 193 YLGLPSNFVDQMVP-ASLLDTP-IDLALKPNDQQAEEEVISTLLEMIKD----AKNPVIL 246
           +L +P  F + MV  A+L   P I L           + I  L ++ KD    +K P I+
Sbjct: 214 FLFIPEEFSNLMVSDANLFLVPKITLEDSIIPSPISYDSIDRLTQITKDLIYQSKRPAII 273

Query: 247 ADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVE 306
            D    R        +LI  T   +F T MGK  I+E +  + G++ G      V + + 
Sbjct: 274 GDILVDRFGGTTILNELIQNTGIWNFSTIMGKSIINEANENYIGLFSGDDGKQEVNDKIR 333

Query: 307 SADLVLSVGALLSDFNTGSFS---YSYKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSL- 362
             DL+L  G   ++ N+G ++   Y  K   ++EFHS++IKI++ +   V +   L  + 
Sbjct: 334 QCDLILHFGIDTNEVNSGVYTLENYYPKNAKIIEFHSNYIKIKDNSTSRVDLYKNLNFIH 393

Query: 363 ----LNKV---GAVVKDYKPVPVPELPAPNAAVDPSTP-LKQQWLWNQVGQFLQEGDIVL 414
               LNK+     ++ DY P     +    +  + S   + Q ++ + + + L  GDI+L
Sbjct: 394 VLKRLNKILDTSKLLFDY-PYISKNIQTECSDDEKSNKVITQDYIKDAILKLLNPGDILL 452

Query: 415 TETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEE------------LD 462
            +TGT  F +     P     ISQ  + SIG A  A LG  +  ++            + 
Sbjct: 453 CDTGTFQFSVRDYQLPPQVKYISQSFYLSIGMALPASLGVGIGMKDYPNIHIKPDDSIIK 512

Query: 463 KSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYNEIQNW 522
              ++IL  G+G+ Q+T QEIST++R+ +   +F+ NN GYTIE+ I GPT +YN+IQ W
Sbjct: 513 TQPKLILCEGDGAAQMTIQEISTLIRYKIPISIFLWNNDGYTIERAIRGPTRDYNDIQPW 572

Query: 523 NHLDLLPTF--GAKDY-EAIRVSTTGEWNKL---AEDKDFNKNSKIRLIELMLPVMDAPE 576
           N   L+ +F    K + +  +V+   E+  L    +  +FN++S +  IE+ L  +D P 
Sbjct: 573 NWTMLIKSFETNIKSFIKTYKVTEQQEFKNLLTKIKQNNFNEDS-LNFIEVQLGRLDVPH 631

Query: 577 SL 578
            L
Sbjct: 632 IL 633

>KLTH0D00418g Chr4 complement(37778..39463) [1686 bp, 561 aa] {ON}
           similar to uniprot|P16467 Saccharomyces cerevisiae
           YLR134W PDC5 Minor isoform of pyruvate decarboxylase
          Length = 561

 Score =  265 bits (677), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 169/565 (29%), Positives = 274/565 (48%), Gaps = 19/565 (3%)

Query: 34  TLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARI 93
           T+G Y+  RL Q  +   F +PGD+NL LLD++ E   +     CNELN S+AA+ YAR 
Sbjct: 3   TVGNYLATRLVQAGIKNHFTVPGDYNLVLLDKLQEHPELEEVNCCNELNCSFAAEGYART 62

Query: 94  KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTV 153
           KG++ ++ TF VG  SA NGI  +Y E++ V+ I G P+ +  +   LLHHT+G  ++  
Sbjct: 63  KGIAAVVVTFSVGAFSAFNGIGSAYGENLPVILISGSPNTNDSSDHRLLHHTIGTHNYDY 122

Query: 154 FHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMV-PASLLDT 212
            + M+  I+     I     APS ID  IR    +++P Y+ +P+N    +  P   + +
Sbjct: 123 QYEMAKQITCAAVQIKYPEDAPSLIDYAIRECLAKKKPCYIEVPTNMASAICAPPGPISS 182

Query: 213 PIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSF 272
            ++    P D     + ++  ++ I     P +LA       D +    +L +  +    
Sbjct: 183 LVNSVPTPKD--VLSQAVNASVDFINSHLKPTLLAGPKLKCADAQKAFLRLAEALKCAVA 240

Query: 273 VTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYKT 332
           V P  K    E HP+F GVY G +S+      +E +DL +  G + +D++T  ++    +
Sbjct: 241 VQPAAKSMFPEDHPQFAGVYWGQVSTKKADAILEWSDLTICAGCIFTDYSTTGWTALQPS 300

Query: 333 KNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVK---DYKPVPVPELPAPNAAVD 389
            + +E  +D+++    +F  + +   L  L  +V    K   +Y    + + P    A D
Sbjct: 301 SHRLEADADNVRFPGHSFDQIGLANFLNVLAERVSENDKSLIEYN--RLRQSPPLIKAAD 358

Query: 390 PSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATG 449
           P   + ++ +  Q+ Q +     +  ETG S F   Q   P       ++ WG IG++  
Sbjct: 359 PKAAITRKEMARQIQQLITPKTTLFAETGDSWFNGVQMDLPKGALFEVEMQWGHIGWSVP 418

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLI 509
           A LG  + A +    +R+I   G+GS Q+TAQE+S MVR      +F++NN GYTIE  I
Sbjct: 419 ASLGYAVGAPD----RRIITMVGDGSFQMTAQEVSLMVRLRKPIIIFLINNYGYTIEVEI 474

Query: 510 H-GPTAEYNEIQNWNHLDLLPTFGAKD--YEAIRVSTTGEWNKLAEDKDFNKNSKIRLIE 566
           H GP   YN I+NWN+  L+  F A +   +  +  T GE     E    N  S   LIE
Sbjct: 475 HDGP---YNNIKNWNYAALMEVFNANEGSGKGFKARTGGELADAIEKAQANV-SGPTLIE 530

Query: 567 LMLPVMDAPESLVKQAQLTAATNAK 591
           + +   D    L+      A  NA+
Sbjct: 531 IQINRDDCTNELITWGHFVALANAR 555

>TDEL0C07020 Chr3 complement(1283600..1285282) [1683 bp, 560 aa]
           {ON} 
          Length = 560

 Score =  259 bits (661), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 169/567 (29%), Positives = 275/567 (48%), Gaps = 23/567 (4%)

Query: 34  TLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARI 93
           T+G Y+  RL +V +   F +PGD+NL LLD++     +      NELN S+AA+ YAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 94  KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTV 153
           KG++ ++ TF VG  SA NGI  +Y E++ V+ I G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 154 FHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLDTP 213
              M+  I+     I     APS ID  IR    +++P Y+ +P+N   Q   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTNMSTQ---SCALPGP 180

Query: 214 IDLAL--KPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPS 271
           I+  L   P++ +     +    ++I     P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 272 FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYK 331
            V P  K    E HP++ GVY G +S+      ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 332 TKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVG----AVVKDYKPVPVPELPAPNAA 387
             + +E  SD++K  +  +  +++   L +L  KV     +VV+  +  PVP  PA  AA
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVP--PAIKAA 358

Query: 388 VDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYA 447
            +PS  + +Q +  Q+   +     +  ETG S F   Q   P       ++ WG IG++
Sbjct: 359 -EPSAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWS 417

Query: 448 TGACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEK 507
             AC G  + A +    + ++   G+GS Q+T QE++ M+R      +F++NN GYTIE 
Sbjct: 418 VPACFGYSVGAPD----REIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEV 473

Query: 508 LIH-GPTAEYNEIQNWNHLDLLPTFGAKD--YEAIRVSTTGEWNKLAEDKDFNKNSKIRL 564
            IH GP   YN I+NWN+  L+  F A D   +  +V T  E ++  +    N      L
Sbjct: 474 EIHDGP---YNNIKNWNYAALMEAFNANDGHGKGFQVKTGAELSEAIKKAKSNTRGPT-L 529

Query: 565 IELMLPVMDAPESLVKQAQLTAATNAK 591
           IE+ +   D    L+      A  NA+
Sbjct: 530 IEIQINRDDCTNELISWGHYVALANAR 556

>TDEL0F00150 Chr6 (12055..13737) [1683 bp, 560 aa] {ON} 
          Length = 560

 Score =  258 bits (660), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 173/569 (30%), Positives = 278/569 (48%), Gaps = 27/569 (4%)

Query: 34  TLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARI 93
           T+G Y+  RL +V +   F +PGD+NL LLD++     +      NELN S+AA+ YAR 
Sbjct: 4   TVGSYLATRLSEVGIENHFVVPGDYNLALLDKLQAHPKLEEVNCSNELNCSFAAEGYARS 63

Query: 94  KGMSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTV 153
           KG++ ++ TF VG  SA NGI  +Y E++ V+ I G P+ +      LLHHT+G  +F  
Sbjct: 64  KGVAAVVVTFSVGAFSAFNGIGSAYGENLPVILIAGSPNTNDSIDHNLLHHTIGTHNFDY 123

Query: 154 FHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLDTP 213
              M+  I+     I     APS ID  IR    +++P Y+ +P+N   Q   +  L  P
Sbjct: 124 EFEMAKKITCAAVQIKHAKDAPSLIDFAIRECLAKKKPCYIEVPTNMSTQ---SCALPGP 180

Query: 214 IDLAL--KPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPS 271
           I+  L   P++ +     +    ++I     P +LA         +    +L +      
Sbjct: 181 IEGVLYQSPSEPKTLTAAVDAANKLIGSRLKPTLLAGPKLKSAGAEKAFLRLAEALGCAV 240

Query: 272 FVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYK 331
            V P  K    E HP++ GVY G +S+      ++ +DL +  G + +D++T  ++    
Sbjct: 241 AVLPAAKSLFPEDHPQYAGVYWGNVSTKKADAILQWSDLTICAGCVFTDYSTTGWTSLQP 300

Query: 332 TKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVG----AVVKDYKPVPVPELPAPNAA 387
             + +E  SD++K  +  +  +++   L +L  KV     +VV+  +  PVP  PA  AA
Sbjct: 301 ATHRIEVDSDNVKFPDHYYGHIKLADFLDALAKKVSKNDKSVVEYQRLRPVP--PAIKAA 358

Query: 388 VDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYA 447
            +PS  + +Q +  Q+   +     +  ETG S F   Q   P       ++ WG IG++
Sbjct: 359 -EPSAAITRQEMARQIQGIINSKTTLFAETGDSWFNGVQMDLPKGAKFEVEMQWGHIGWS 417

Query: 448 TGACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEK 507
             AC G  + A +    + ++   G+GS Q+T QE++ M+R      +F++NN GYTIE 
Sbjct: 418 VPACFGYSVGAPD----REIVTMVGDGSFQMTVQEVAQMIRLKQPILIFLINNYGYTIEV 473

Query: 508 LIH-GPTAEYNEIQNWNHLDLLPTFGAKD--YEAIRVSTTGEWNKLAED-KDFNKNSK-I 562
            IH GP   YN I+NWN+  L+  F A D   +  +V T  E   LAE  K    N++  
Sbjct: 474 EIHDGP---YNNIKNWNYAALMEAFNANDGHGKGFQVKTGAE---LAEAIKKAKSNTRGP 527

Query: 563 RLIELMLPVMDAPESLVKQAQLTAATNAK 591
            LIE+ +   D    L+      A  NA+
Sbjct: 528 TLIEIQINRDDCTNELISWGHYVALANAR 556

>NDAI0A04450 Chr1 complement(1006559..1008244) [1686 bp, 561 aa]
           {ON} Anc_5.456
          Length = 561

 Score =  249 bits (636), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 179/559 (32%), Positives = 285/559 (50%), Gaps = 55/559 (9%)

Query: 87  ADAYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVP-SVSAQAKQLL--- 141
           AD ++R    + CLITT+GVGELSALNGIAG+++E+V VLHIVGV  SV ++++      
Sbjct: 3   ADGFSRYSNKIGCLITTYGVGELSALNGIAGAFSENVKVLHIVGVARSVHSRSQDYNNQN 62

Query: 142 LHH---TLGNGDFT-----VFHRMSAN-ISETTAMITDLATAPSEIDRCIRTTYIRQRPV 192
           LHH    L + +F      V+  M  + ++ +   + D+ TA  E+D+ I   Y   +P 
Sbjct: 63  LHHLVPRLHDSNFVGPNHKVYLEMIKDRVACSVTYLEDINTACDEVDKVIMDIYRYSKPG 122

Query: 193 YLGLPSNFVDQMV-PASLLDTP---IDLALKPNDQQAEEEVISTLLEMIKDAKNPVILAD 248
           Y+ +P +F D +V P++L   P   ++  +        +E++  +L+ I ++K P I+ D
Sbjct: 123 YVFVPVDFSDMLVDPSNLFKRPEITLENCVSYAPSPVVDELVRMVLQYIYESKCPSIIGD 182

Query: 249 ACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESA 308
               R    +    LI +T   +F T MGK  IDE +  + G+Y G  S   V E    +
Sbjct: 183 VLCDRFGASSMVNNLIQLTSMWNFATVMGKSIIDESNVMYMGLYNGNESIETVTERFLQS 242

Query: 309 DLVLSVGALLSDFNTGSFSYSYKTK-NVVEFHSDHIKIRNAT------FPGVQMKFVLQS 361
           DLVL  G  + + N G ++ +YK    V+EFHS++I+  +A+      F GV    VL+ 
Sbjct: 243 DLVLHFGIQVHEINNGHYTINYKEDAKVIEFHSEYIRFFDASTGNEKVFKGVNFVQVLER 302

Query: 362 LLNKVGAVVKDYK-PVPVPELPAP--NAAVDPS--TPLKQQWLWNQVGQFLQEGDIVLTE 416
           L+  +     +++ P  + +      N   +P+  T + Q +L   V  +L  GD+++ E
Sbjct: 303 LIQTINVNKLNFEYPSNIEKFATDEVNLPTEPTEITKVTQNYLQKSVPHYLNPGDVLVCE 362

Query: 417 TGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEEL--------------- 461
           TG+  F I     P+    I+Q  + SIG A  A  G  +A ++                
Sbjct: 363 TGSFQFAIRDFVLPSQLKYITQGFFLSIGMALPAAFGVGIAMQDYPRCHISKDHPSHVEI 422

Query: 462 --DKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYNEI 519
             D   R+IL  G+G+ Q+T QE+++MVR+ +   + +LNN GYTIE+ I GPT  YN++
Sbjct: 423 PDDYEPRLILIEGDGAAQMTIQELTSMVRFQVPIEIMILNNNGYTIERAIRGPTRSYNDV 482

Query: 520 QNWNHLDLLPTFGAKDYEAIR-VSTTGEWN-----KLAEDKDFNKNSKIRLIELMLPVMD 573
            +W+   LL  FG  D++  R VS   E       KL + K+  K + I L+E+ L  MD
Sbjct: 483 MSWDWTKLLEAFG--DFKKQRTVSAKIETRSKLAMKLKQLKNKGKLNLIELVEIKLDTMD 540

Query: 574 APESLVKQAQLTAATNAKS 592
            P+ L       A T   S
Sbjct: 541 FPKQLQSMVDAAAFTRKCS 559

>Skud_7.383 Chr7
           complement(638760..638846,638850..638882,638886..638903,
           638917..639036) [258 bp, 86 aa] {ON} YGR087C (REAL)
          Length = 86

 Score = 78.2 bits (191), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 44/92 (47%), Positives = 55/92 (59%), Gaps = 6/92 (6%)

Query: 415 TETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVILFTGEG 474
           TETG S    NQ     + + ISQVLW  I +A GA L    +AE++D   R ILF+G+ 
Sbjct: 1   TETGASTLASNQAILLKDAHDISQVLWRPIRFANGATL----SAEDIDPG-RAILFSGDR 55

Query: 475 SLQLTAQEISTMVRWNLKPYLFVLNNKGYTIE 506
            L LT QE+ T +RW LKPYLFV NN    +E
Sbjct: 56  PL-LTVQEMPTTIRWRLKPYLFVPNNDKRHVE 86

>YMR108W Chr13 (484084..486147) [2064 bp, 687 aa] {ON}
           ILV2Acetolactate synthase, catalyses the first common
           step in isoleucine and valine biosynthesis and is the
           target of several classes of inhibitors, localizes to
           the mitochondria; expression of the gene is under
           general amino acid control
          Length = 687

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 122/512 (23%), Positives = 208/512 (40%), Gaps = 68/512 (13%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           +T G+   E + + +V TVFG PG   L + D I+  +   +    +E  A + A+ YAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 93  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVSAQAKQLLLHHTLGNGD 150
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 151 FTVFHRMSANISETTAMITDLATAPSEIDRCIR-TTYIRQRPVYLGLPSNFVDQMVPASL 209
                 +S + ++   M+  +   P  I+      T  R  PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 210 LDTPIDL-------ALKPNDQQAEEEV----ISTLLEMIKDAKNPVILADACASRH-DVK 257
           L  PI         AL     +A++E     I+   ++I  AK PV+   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRAQDEFVMQSINKAADLINLAKKPVLYVGAGILNHADGP 317

Query: 258 AETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGAL 317
              K+L D  Q P   T  G GS D++ P+   + +G         AV++ADL+++VGA 
Sbjct: 318 RLLKELSDRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAVQNADLIIAVGAR 376

Query: 318 LSDFNTGSFS-------------------YSYKTKNVVEFHSDHIKIRN--ATFPGVQMK 356
             D  TG+ S                   +    KN+ +     I +     T  G  M 
Sbjct: 377 FDDRVTGNISKFAPEARRAAAEGRGGIIHFEVSPKNINKVVQTQIAVEGDATTNLGKMMS 436

Query: 357 FVL-----QSLLNKVGAVVKDYKPVPVPELPAPNAAVDPSTPLKQ-QWLWNQVGQFLQEG 410
            +           ++    K+Y    + E   P + + P T +K+   + N  G+ +   
Sbjct: 437 KIFPVKERSEWFAQINKWKKEYPYAYMEE--TPGSKIKPQTVIKKLSKVANDTGRHV--- 491

Query: 411 DIVLTETGTSAFGINQTHFPNNTYG-ISQVLWGSIGYATGACLGAVMAAEELDKSKRVIL 469
            IV T  G       Q     N +  I+    G++GY   A +GA +A  E      VI 
Sbjct: 492 -IVTTGVGQHQMWAAQHWTWRNPHTFITSGGLGTMGYGLPAAIGAQVAKPE----SLVID 546

Query: 470 FTGEGSLQLTAQEISTMVRWNLKPYLFVLNNK 501
             G+ S  +T  E+S+ V+      + +LNN+
Sbjct: 547 IDGDASFNMTLTELSSAVQAGTPVKILILNNE 578

>CAGL0K03465g Chr11 (320030..322063) [2034 bp, 677 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108w Acetolactate synthase
          Length = 677

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 120/522 (22%), Positives = 218/522 (41%), Gaps = 64/522 (12%)

Query: 21  VSQNKPEITMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNE 80
           V+  K + +   +T G+   E + + +V TVFG PG   L + D I+  +  ++    +E
Sbjct: 70  VATQKMDNSFVGLTGGQIFNEMMARNNVDTVFGYPGGAILPVYDAIHNSDKFKFVLPKHE 129

Query: 81  LNASYAADAYARIKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVSAQAK 138
             A + A+ YAR  G    ++ T G G  + +  +A + A+ + ++   G VP+ +    
Sbjct: 130 QGAGHMAEGYARASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGTD 189

Query: 139 QLLLHHTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIR-TTYIRQRPVYLGLP 197
                  +G         +S + ++   M+ ++A  P  I+   +  T  R  PV + LP
Sbjct: 190 AFQEADIVG---------ISRSCTKWNVMVKNVAELPLRINEAFQIATSGRPGPVLVDLP 240

Query: 198 SNFVDQMVPASLLDTPI------------DLALKPNDQQAEEEVISTLLEMIKDAKNPVI 245
            +     V A++L TPI             L     DQ   E  I    ++I  AKNPV+
Sbjct: 241 KD-----VTAAILRTPIPVKSTLPSTALQQLTAGVQDQFVIEN-IKKSADLINIAKNPVL 294

Query: 246 -LADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEA 304
            +     +  D     K+L +  Q P   T  G G+ D++ P+   + +G         A
Sbjct: 295 YVGGGILNNVDGPRLVKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLA 353

Query: 305 VESADLVLSVGALLSDFNTGSFS-YSYKTKN--------VVEFHSDHIKIRNATFPGVQM 355
           V+++DL+++VGA   D  TG+ + ++ + +         ++ F      I       V +
Sbjct: 354 VQNSDLIIAVGARFDDRVTGNITKFAPEARKAALEGRGGIIHFEITPKNINKVVEAQVAV 413

Query: 356 KFVLQSLLNKVGAVVKDYKPVP---------VPELP------APNAAVDPSTPLKQQWLW 400
           +    S L+K+  +V   K  P           E P       P + + P T + +    
Sbjct: 414 EGDAASNLSKLIPLVFPVKERPEWFEKINKWKKEFPYSYSLETPGSRIKPQTAIAK---L 470

Query: 401 NQVGQFLQEGDIVLTETGTSAFGINQT-HFPNNTYGISQVLWGSIGYATGACLGAVMAAE 459
           +++     +  IV T  G       Q   + N    I+    G++GY   + +GA +A  
Sbjct: 471 SKIANATSKEVIVTTGVGQHQMWAAQHWTWKNPRTFITSGGLGTMGYGLPSAIGAQVAKP 530

Query: 460 ELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNK 501
           +      VI   G+ S  ++ QE+S+ V+ N    + VLNN+
Sbjct: 531 D----ALVIDIDGDASFNMSLQELSSAVQANAPVKILVLNNE 568

>Smik_13.297 Chr13 (467578..469641) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 78.2 bits (191), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 118/512 (23%), Positives = 205/512 (40%), Gaps = 68/512 (13%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           +T G+   E + + +V TVFG PG   L + D I+  +   +    +E  A + A+ YAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 93  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVSAQAKQLLLHHTLGNGD 150
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTTAIGTDAFQEADVVG--- 208

Query: 151 FTVFHRMSANISETTAMITDLATAPSEIDRCIR-TTYIRQRPVYLGLPSNFVDQMVPASL 209
                 +S + ++   M+  +   P  I+      T  R  PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 210 LDTPIDL-------ALKPNDQQAEEEV----ISTLLEMIKDAKNPVILADACASRH-DVK 257
           L  PI         AL       ++E     I+   ++I  AK PV+   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHTQDEFVMQSINKAADLINLAKKPVLYVGAGILNHIDGP 317

Query: 258 AETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGAL 317
              K+L    Q P   T  G GS D++ P+   + +G         A+++ADL+++VGA 
Sbjct: 318 RLLKELSGRAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGAR 376

Query: 318 LSDFNTGSFS-------------------YSYKTKNVVEFHSDHIKIRNATFPGVQ--MK 356
             D  TG+ S                   +    KN+ +     I +       ++  M 
Sbjct: 377 FDDRVTGNISKFAPEARRAAAEGRGGIIHFEVSPKNINKVVQTQIAVEGDATTNIEKMMS 436

Query: 357 FVL-----QSLLNKVGAVVKDYKPVPVPELPAPNAAVDPSTPLKQ-QWLWNQVGQFLQEG 410
            +          +++    K Y    + E   P + + P T +K+   + N  G+ +   
Sbjct: 437 KIFPVKERSEWFDQINKWKKKYPYAFMKE--TPGSKIKPQTVIKKLSKIANDTGRHV--- 491

Query: 411 DIVLTETGTSAFGINQT-HFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVIL 469
            IV T  G       Q   + N    I+    G++GY   A +GA +A  E      VI 
Sbjct: 492 -IVTTGVGQHQMWAAQHWTWKNPRTFITSGGLGTMGYGLPAAIGAQVAKPE----SLVID 546

Query: 470 FTGEGSLQLTAQEISTMVRWNLKPYLFVLNNK 501
             G+ S  +T  E+S+ V+      + VLNN+
Sbjct: 547 IDGDASFNMTLTELSSAVQAGTPVKILVLNNE 578

>TBLA0I01400 Chr9 (303028..305160) [2133 bp, 710 aa] {ON} Anc_2.441
           YMR108W
          Length = 710

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 119/524 (22%), Positives = 218/524 (41%), Gaps = 59/524 (11%)

Query: 18  SNRVSQNKPEI--TMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWA 75
           +N  + + P++  TM  +T G    E +++ +V TVFG PG   L + D IY  E  ++ 
Sbjct: 97  ANAKNADSPDLDHTMIGMTGGEIFNEMMRRKNVDTVFGYPGGAILPVYDAIYNSENFKFV 156

Query: 76  GNCNELNASYAADAYARIKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSV 133
              +E  A + A+ YAR  G    ++ T G G  + +  +A + A+ V ++   G VP+ 
Sbjct: 157 LPRHEQGAGHMAEGYARASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTS 216

Query: 134 SAQAKQLLLHHTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYI-RQRPV 192
           +           +G         +S + ++   M+  +   P  I+         R  PV
Sbjct: 217 AIGTDAFQEADVIG---------ISRSCTKWNVMVKSVDELPKRINEAFEIAMSGRPGPV 267

Query: 193 YLGLPSNFVDQMVPASLLDTPIDL--------ALKPNDQQAEEEVISTLLE----MIKDA 240
            + LP +     V A++L  PI +        A+   +Q  + + +S  ++    +I  A
Sbjct: 268 LIDLPKD-----VTAAVLKNPIPVLNNSLPYTAISNINQIIQRKFLSENIQETAKLINMA 322

Query: 241 KNPVILADA-CASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSP 299
           K PVI A A   S  +     K+L + +Q P   T    G+ D++ P+   + +G   S 
Sbjct: 323 KKPVIYAGAGILSNLNGPTLLKELSERSQIPVTTTLQALGAFDQQDPKSLDM-LGMHGSA 381

Query: 300 AVKEAVESADLVLSVGALLSDFNTGSFSYSY---------KTKNVVEFHSDHIKIRNATF 350
               A+++ADL++++G    D  TG+ S            K   +V F      I     
Sbjct: 382 VANLAIQNADLIIALGGRFDDRVTGNISKFAPEARKAALEKRGGIVHFEISPKNINKVVE 441

Query: 351 PGVQMKFVLQSLLNKVGAVVK--DYKPVPVPEL-------PAPNAAVDPSTPLKQQWLWN 401
             + ++  +   L  +  ++K  D +P    ++       P       P + +K Q + +
Sbjct: 442 TQIALEGDVTENLEILLPLIKSVDERPEWFAQINQWKKAYPYEYMRETPGSKIKPQTVIS 501

Query: 402 QVGQFLQE-GDIVLTETGTSAFGI---NQTHFPNNTYGISQVLWGSIGYATGACLGAVMA 457
           ++       G  V+  TG     +       + N    I+    G++GY   A +GA +A
Sbjct: 502 RLSDIANSTGKKVIVTTGVGQHQMWTAQHWTWRNPRTFITSGGLGTMGYGLPAAIGAQVA 561

Query: 458 AEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNK 501
             E      VI   G+ S  +T  E+S+ V+ N    + +LNN+
Sbjct: 562 FPE----ALVIDIDGDASFNMTLTELSSAVQANTPIKIMLLNNE 601

>KAFR0A00570 Chr1 complement(101898..103946) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 77.8 bits (190), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 113/527 (21%), Positives = 220/527 (41%), Gaps = 72/527 (13%)

Query: 20  RVSQNKPEITMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCN 79
           +V   K + ++  +T G+   E + + +V TVFG PG   L + D IY+ +  ++    +
Sbjct: 74  KVDPMKMDNSLVGLTGGQIFNEMMARHNVDTVFGYPGGAILPVYDAIYQSKNFKFVLPKH 133

Query: 80  ELNASYAADAYARIKGMSCLI-TTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVSAQA 137
           E  A + A+ YAR  G   ++  T G G  + +  +A + A+ + ++   G VP+ +   
Sbjct: 134 EQGAGHMAEGYARASGKPGIVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTTAIGT 193

Query: 138 KQLLLHHTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIR-TTYIRQRPVYLGL 196
                   +G         +S + ++   MI ++A  P  I+      T  R  PV + L
Sbjct: 194 DAFQEADVVG---------ISRSCTKWNVMIKNVAELPVRINEAFEIATSGRPGPVLVDL 244

Query: 197 PSNFVDQMVPASLLDTPIDLALKPN-----DQQAEEEV----ISTLLEMIKDAKNPVI-L 246
           P +    ++  ++   P+  +L  N       +A++E     I+   ++I  AKNPV+ +
Sbjct: 245 PKDVTAAILRDAI---PVGSSLPSNALSQLTNKAQDEFVLDNINKAADLINLAKNPVLYV 301

Query: 247 ADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVE 306
                   D     K+L +  Q P   + +G G+ D++ P+   + +G         A++
Sbjct: 302 GGGILGNEDGPKLLKQLSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGCATANLAMQ 360

Query: 307 SADLVLSVGALLSDFNTGSFS-------------------YSYKTKNVVEFHSDHIKIRN 347
           +ADL++++G    D  TG+ +                   +    KN+ +     I +  
Sbjct: 361 NADLIIAIGTRFDDRVTGNIAKFAPEARRAALENRGGIIHFEISPKNINKVVEAQIAVEG 420

Query: 348 ATFPGVQMKFVLQSLLNKVGAV---------VKDYKPVPVPELPAPNAAVDPSTPLKQQW 398
                      LQS+L K+  V         +K++K     + P       P++ LK Q 
Sbjct: 421 DATAN------LQSILPKIFPVKERTEWFAKIKEWKT----KYPYSYMKETPNSKLKPQT 470

Query: 399 LWNQVGQFLQE-GDIVLTETGTSA---FGINQTHFPNNTYGISQVLWGSIGYATGACLGA 454
           + +++ +     G  V+  TG      +      + +    I+    G++GY   A +GA
Sbjct: 471 VISKLSKIANATGKEVIVTTGVGQHQMWAAQHWTWKHPRTFITSGGLGTMGYGLPAAIGA 530

Query: 455 VMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNK 501
            +A  +      VI   G+ S  +T  E+S+ V+      + +LNN+
Sbjct: 531 QVAKPD----ALVIDIDGDASFNMTLTELSSAVQAGAPVKILLLNNE 573

>TDEL0B05520 Chr2 complement(980893..982560) [1668 bp, 555 aa] {ON}
           Anc_1.450 YEL020C
          Length = 555

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 117/490 (23%), Positives = 200/490 (40%), Gaps = 55/490 (11%)

Query: 38  YVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGM- 96
           Y  + L+Q  V TVFG+ G   + L D +   +G+++    NE +ASYAA AY  + G  
Sbjct: 8   YFTQLLQQYGVDTVFGIVGIPIVELADTMIG-KGIKFIACRNEQSASYAASAYGYLTGKP 66

Query: 97  SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTVFHR 156
             L+   G G + AL GI  S +    ++ I G                L  G F    +
Sbjct: 67  GVLLVVGGPGLIHALAGIYNSMSNRWPLIVIAGS------------SEDLHKGGFQELDQ 114

Query: 157 MSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPS-NFVDQMVPASLLDTPID 215
           +S  +S+       L T P  I+     TY   R    G P   ++D   P SL+   I+
Sbjct: 115 VSL-LSDHLKFTGKLTTDPDVIELV---TYNAMRLTTTGTPGVTYID--FPGSLISESIE 168

Query: 216 LALKPNDQ------QAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQF 269
            +  P           + E +  +++++   +N  IL        +   E +KLI+    
Sbjct: 169 RSPYPVQSISRIQYMPDTESLQRVVKLLSSDQNKRILVVIGKGAVNASNEVRKLINDYNL 228

Query: 270 PSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLS-DFNTGSFSY 328
           P   TPM KG + + HP          +S A  +A++ A++VL +GA L+   + G+   
Sbjct: 229 PFLSTPMAKGVVPDSHP--------LNASSARSKALKEAEIVLVLGARLNWILHFGAPPK 280

Query: 329 SYKTKNVVEFHSDHIKIRNATFPGV------QMKFVLQSLLNKVGAVVKDYKPVPVPELP 382
                  ++   D   +      GV       +   ++SL+ K+      Y+ +   EL 
Sbjct: 281 WDANTIFIQVDCDPESLGQNNQRGVGYSLCGDIGLTVKSLIEKLKLERWAYQGLS-RELR 339

Query: 383 APNAAVDPSTPLKQQWL------WNQVGQ----FLQEGDIVLTETGTSAFGINQTHFPNN 432
           +           K+Q +      +N+V Q    F+ +   ++   G +     +  FP +
Sbjct: 340 SAIKLNHEKLAKKEQIVHHGRLNYNKVYQCLRTFIDDSRTIIVSEGANTMDQARISFPTD 399

Query: 433 TYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLK 492
            Y   ++  G+     G  LG  +AA+     K ++L  G+ +   +A EI T VR  L 
Sbjct: 400 -YPKHRLDAGT-NATMGIGLGYAIAAKIARPDKSIVLLQGDSAFGFSAMEIETAVRNRLG 457

Query: 493 PYLFVLNNKG 502
             + V+NN G
Sbjct: 458 LVIIVMNNSG 467

>KLLA0B12584g Chr2 complement(1100489..1102564) [2076 bp, 691 aa]
           {ON} highly similar to uniprot|P07342 Saccharomyces
           cerevisiae YMR108W ILV2 Acetolactate synthase catalyses
           the first common step in isoleucine and valine
           biosynthesis and is the target of several classes of
           inhibitors localizes to the mitochondria expression of
           the gene is under general amino acid control
          Length = 691

 Score = 76.6 bits (187), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 122/523 (23%), Positives = 216/523 (41%), Gaps = 70/523 (13%)

Query: 23  QNKPEITMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELN 82
           QN+ + +   +T G    E +++ +V TVFG PG   L + D IY  +   +    +E  
Sbjct: 86  QNQMDDSFIGMTGGEIFHEMMQRHNVDTVFGYPGGAILPVYDAIYNSDKFTFVLPKHEQG 145

Query: 83  ASYAADAYARIKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLL 141
           A + A+ YAR  G    ++ T G G  + +  +A + A+ V ++   G  + SA      
Sbjct: 146 AGHMAEGYARASGKPGVVLVTSGPGATNVVTPMADALADGVPLVVFTGQVATSA------ 199

Query: 142 LHHTLGNGDFTVFH--RMSANISETTAMITDLATAPSEIDRCIR-TTYIRQRPVYLGLPS 198
               +G   F       +S + ++   M+  +   P  I+      T  R  PV + LP 
Sbjct: 200 ----IGTDAFQEADVVGISRSCTKWNVMVKTIEELPRRINEAFEIATSGRPGPVLVDLPK 255

Query: 199 NFVDQMVPASLLDTPIDL-ALKPND------QQAEEEV----ISTLLEMIKDAKNPVILA 247
           +     V A++L  PI + ++ P+D      Q+  +E     IS   ++I  AK P++  
Sbjct: 256 D-----VTAAVLRNPIPMKSILPSDTLNQLTQRVVDEFTLENISRAADLINRAKKPLLYV 310

Query: 248 DACASRHDVKAE-TKKLIDITQFPSFVTPMGKGSID-EKHPRFGGVYVGTLSSPAVKEAV 305
            A     ++  +  K+L D  Q P   T  G G+ + E H       VG   + A   A+
Sbjct: 311 GAGILGSEMGPQYLKQLSDRAQIPVTTTLQGLGAFNQEDHKSLD--MVGMHGNAAANLAI 368

Query: 306 ESADLVLSVGALLSD---FNTGSFSYSY------KTKNVVEFHSDHIKIRNATFPGVQMK 356
           ++ADL++++GA   D    N   F+         K   +V F      I       V ++
Sbjct: 369 QNADLIIALGARFDDRVTLNISKFAPEARKAALEKRGGIVHFEISPKNINKVVEAEVAVE 428

Query: 357 FVLQSLLNKVGAVVKDYKPVPVPELPAPNAAV--------------DPSTPLKQQWLWNQ 402
             +   L K+  +V+      VPE P  +A V               P + +K Q + ++
Sbjct: 429 GDVTRNLEKLLPLVES-----VPERPEWSAQVAKWKQEYPYAYQKETPGSKIKPQTVISK 483

Query: 403 VGQF-LQEGDIVLTETGTSA---FGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAA 458
           +    L+ G   +  TG      +      + +    I+    G++GY   A +GA +A 
Sbjct: 484 LSDLVLKSGRPAIVTTGVGQHQMWAAQHWTWKSPRSFITSGGLGTMGYGLPAAIGAQVAR 543

Query: 459 EELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNK 501
            +      VI   G+ S  +T  E+S+ V+      + +LNN+
Sbjct: 544 PD----AIVIDIDGDASFNMTLMELSSAVQARTPVKVLLLNNE 582

>NDAI0H02380 Chr8 (578157..580214) [2058 bp, 685 aa] {ON} Anc_2.441
          Length = 685

 Score = 76.3 bits (186), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 83/320 (25%), Positives = 147/320 (45%), Gaps = 30/320 (9%)

Query: 23  QNKPEITMSEITL--GRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNE 80
           + +PE+  S + L  G+   E +K+ +V TVFG PG   L + D IY  +  ++    +E
Sbjct: 80  RTEPEMDSSFVGLSGGQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSDAFKFVLPKHE 139

Query: 81  LNASYAADAYARIKGMS-CLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVSAQAK 138
             A + A+ YAR  G +  ++ T G G  + +  +A + A+ + ++   G VP+ +    
Sbjct: 140 QGAGHMAEGYARASGKTGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTD 199

Query: 139 QLLLHHTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIR-TTYIRQRPVYLGLP 197
                  +G         +S + ++   M+  +A  P  I+         R  PV + LP
Sbjct: 200 AFQEADVVG---------ISRSCTKWNVMVRSVAELPLRINEAFEIANSGRPGPVLVDLP 250

Query: 198 SNFVDQMVPASLLDTPIDL-ALKPNDQQ----AEE----EVISTLLEMIKDAKNPVI-LA 247
            +     V A++L  PI + +  P   Q    AEE    E I+   ++I  AK PV+ + 
Sbjct: 251 KD-----VTAAILRNPIPIKSTLPITSQLKSVAEEAYTMESINRAADLINLAKRPVLYVG 305

Query: 248 DACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVES 307
           +   +  D     K+L D  Q P   T  G G+ D++ P+   + +G         A+++
Sbjct: 306 NGIMNNPDGPRLLKELSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAMQN 364

Query: 308 ADLVLSVGALLSDFNTGSFS 327
           ADLV+++GA   D  TG+ +
Sbjct: 365 ADLVIALGARFDDRVTGNIA 384

>TPHA0G02440 Chr7 complement(498107..500182) [2076 bp, 691 aa] {ON}
           Anc_2.441 YMR108W
          Length = 691

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 121/515 (23%), Positives = 206/515 (40%), Gaps = 72/515 (13%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           +T G    E +K+ +V TVFG PG   L + D IY  +   +    +E  A + A+ YAR
Sbjct: 94  LTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIYNSKDFNFVLPRHEQGAGHMAEGYAR 153

Query: 93  IKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVSAQAKQLLLHHTLGNGD 150
             G    ++ T G G  + +  IA + A+ V ++   G VP+ +           +G   
Sbjct: 154 ASGKCGVVLVTSGPGATNVITPIADALADGVPMVVFTGQVPTAAIGTDAFQEADVIG--- 210

Query: 151 FTVFHRMSANISETTAMITDLATAPSEIDRCIR-TTYIRQRPVYLGLPSNFVDQMVPASL 209
                 +S + ++   M+  +   P  I+      T  R  PV + LP +     V AS+
Sbjct: 211 ------ISRSCTKWNVMVKRIEDLPKCINEAFEIATSGRPGPVLVDLPKD-----VQASI 259

Query: 210 LDTPIDLA----------LKPNDQ-QAEEEVISTLLEMIKDAKNPVI-LADACASRHDVK 257
           L TPI +           L  N Q Q  E  I    E+I  AK P++ +     +  +  
Sbjct: 260 LKTPIPIKTTIPSNALRHLTRNVQTQFSEVAIKRAAELINIAKKPILYVGGGILNNPEGP 319

Query: 258 AETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGAL 317
              K+L D  Q P   T    G+ D++ P+   + +G         A+++ADL+++VGA 
Sbjct: 320 RLIKELSDRAQIPVTTTLQALGAFDQEDPKSLDM-LGMHGHAPANLAMQNADLIIAVGAR 378

Query: 318 LSDFNT-------------------GSFSYSYKTKNVVEFHSDHIKIRNATFPGVQMKFV 358
             D  T                   G   +    KN+ +     + I      G  +  +
Sbjct: 379 FDDRVTLNISKFAPEARRAALENRGGIIHFDISAKNINKVVETQVPIEGDA--GANLTKL 436

Query: 359 LQSLLNKVGAVVKDY---------KPVPVPELPAPNAAVDPSTPL-KQQWLWNQVGQFLQ 408
           L S+ +   A  K++         K     +  +P + + P T + K   + N+ G+ + 
Sbjct: 437 LPSIFSVSEAERKEWMETIKTWKEKHPYTYQKESPGSKIKPQTVIAKLSEIANKSGKPI- 495

Query: 409 EGDIVLTETGTSAFGINQ--THFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKR 466
              +V    G       Q  T     T+ IS    G++GY   A +GA +A  +      
Sbjct: 496 ---VVTAGVGQHQMWAAQHWTWKKPRTF-ISSGGLGTMGYGLPAAIGAQVARPD----AI 547

Query: 467 VILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNK 501
           VI   G+ S  +T  E+S+ V+      + +LNN+
Sbjct: 548 VIDIDGDASFNMTLTELSSAVQAGTPIKILLLNNE 582

>NCAS0G03960 Chr7 (733213..734946) [1734 bp, 577 aa] {ON} Anc_1.450
           YEL020C
          Length = 577

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 117/513 (22%), Positives = 206/513 (40%), Gaps = 77/513 (15%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           +T   Y    LKQ ++ TVFG+ G   + L D++ E  G+R+    NE  ASYAA  Y  
Sbjct: 10  LTATEYFVSLLKQYEIDTVFGIVGIPIVELADKMIE-HGIRFISCRNEQAASYAASGYGY 68

Query: 93  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDF 151
           + G  + L+   G G + AL GI  S +    ++ I G  S +++  Q+        G F
Sbjct: 69  LTGKPAVLLVVGGPGLIHALAGIYNSMSNKWPLIVIAG--SSNSETDQV--------GGF 118

Query: 152 TVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPV---YLGLPSNFVD-----Q 203
               ++S  +++       L +            +  Q P+   Y+  P N ++     Q
Sbjct: 119 QDLDQVSL-LNKYVKYTVKLNSINIPTALFNAYNFAIQSPMGVTYIDFPGNLIEGNYKVQ 177

Query: 204 MVPAS-LLDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNP--VILADACASRHDVKAET 260
             PA+  +  P  +   P D     EV   ++E   ++ N   VIL       H    + 
Sbjct: 178 AQPATNPVSIPRRVRCSP-DPNTVNEVAKLIIE---NSSNNVLVILGKGAVEFHK---DI 230

Query: 261 KKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSD 320
            K I+    P   TPM KG + + H     + V +  S A+K+    A++VL +GA L+ 
Sbjct: 231 NKFINTFNLPFLPTPMAKGILPDSH----NLNVSSARSKALKD----ANIVLVLGARLNW 282

Query: 321 FNTGSFSYSYKTKNV-VEFHSD--HIKIRNATFPGVQMKFVLQSLLNKV----------- 366
                 S  +  K + ++  +D  ++ + N T   + +   L   +N +           
Sbjct: 283 ILHFGESPKWNAKAIFIQCDNDPSNLGVNNGTNTNLSLLGDLGLTVNSLSDAFSQITLNW 342

Query: 367 -----------GAVVKDYKPVPVPELPAPNAAVDPSTPLKQQWLWNQVGQFLQEGDIVLT 415
                      G ++K+   +   E       +     L    ++  + + + E   VL 
Sbjct: 343 KYEKGISDEMRGIILKNQFKLQEKE----QRLIKDKDLLNYNVVYGALRKLMDESKTVLV 398

Query: 416 ETGTSAFGINQTHFPNNT------YGISQVLWGSIGYATGACLGAVMAAEELDKSKRVIL 469
             G ++  I +  FP++        G +  +   +GY   ACL  +   +   + K VIL
Sbjct: 399 TEGANSMDIARISFPSSVPKQRLDAGTNATMGIGLGYGIAACLNELRNGK---RGKDVIL 455

Query: 470 FTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKG 502
             G+ +   +  EI T VR+ L   + V+NN G
Sbjct: 456 IQGDSAFGFSGMEIETAVRFKLGLIIVVMNNSG 488

>NCAS0F01500 Chr6 (299388..301442) [2055 bp, 684 aa] {ON} Anc_2.441
           YMR108W
          Length = 684

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 124/527 (23%), Positives = 217/527 (41%), Gaps = 76/527 (14%)

Query: 23  QNKPEITMSEITL--GRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNE 80
           + +P++  S + L  G+   E +K+ +V TVFG PG   L + D IY  E   +    +E
Sbjct: 77  RQEPQMDTSFVGLSGGQIFNEMMKRQNVDTVFGYPGGAILPVYDAIYNSEAFNFVLPKHE 136

Query: 81  LNASYAADAYARIKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVSAQAK 138
             A + A+ YAR  G    ++ T G G  + +  +A + A+ + ++   G VP+ +    
Sbjct: 137 QGAGHMAEGYARASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTD 196

Query: 139 QLLLHHTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYI-RQRPVYLGLP 197
                  +G         +S + ++   M+  +A  P  I+         R  PV + LP
Sbjct: 197 AFQEADVVG---------ISRSCTKWNVMVKSVAELPLRINEAFEIAMSGRPGPVLVDLP 247

Query: 198 SNFVDQMVPASLLDTPIDL-------ALKPNDQQAEEEV----ISTLLEMIKDAKNPVI- 245
            +     V A++L  PI +        L      A+E+     I+   ++I  AK PV+ 
Sbjct: 248 KD-----VTAAILREPIPIKSTLPSGTLTQIKSIAQEDFLADSINRAADLINLAKKPVLY 302

Query: 246 LADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAV 305
           + +   +  D     K+L +  Q P   T  G G+ D++ P+   + +G         A+
Sbjct: 303 VGNGIFNNEDGPRLLKELSERAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAM 361

Query: 306 ESADLVLSVGALLSDFNTGSFSYSYKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNK 365
           ++ADL+++VGA   D  TG         N+ +F  +  +  N    G+    +    +NK
Sbjct: 362 QNADLIIAVGARFDDRVTG---------NIAKFAPEARRAANEGRGGIIHFEISPKNINK 412

Query: 366 V----GAVVKDYKPVPVPELPAPNAAVDPSTPLKQ--QWLWNQVGQFLQE--GDIVLTET 417
           V     AV  D        LPA     + +   K+  QW  +    +++E  G  +  +T
Sbjct: 413 VVEAQVAVEGDAAANIDKMLPAIFPIKERTEWFKEINQWKKDYPYDYMKEVPGGKLKPQT 472

Query: 418 GTSAFG--INQTHFPN-NTYGISQ-VLW-------------------GSIGYATGACLGA 454
             S      N T  P   T G+ Q  +W                   G++GY   + +GA
Sbjct: 473 VISKLSKVANATGRPVIVTTGVGQHQMWTAQHWTWKHPRSFITSGGLGTMGYGLPSAIGA 532

Query: 455 VMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNK 501
            +A  E      VI   G+ S  +T  E+S+ V+      + +LNN+
Sbjct: 533 QVAHPE----ALVIDIDGDASFNMTLTELSSAVQAGTPVKIMILNNE 575

>TPHA0G02885 Chr7 complement(616977..619043) [2067 bp, 688 aa] {ON}
          Length = 688

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 85/328 (25%), Positives = 142/328 (43%), Gaps = 39/328 (11%)

Query: 17  NSNRVSQNK-------PEITMSEITL--GRYVFERLKQVDVTTVFGLPGDFNLRLLDEIY 67
           ++N++SQ+K       PE+  S I L  G    E +K+ +V TVFG PG   L + D IY
Sbjct: 66  STNKISQSKLKELKKNPEMDSSLIGLTGGEIFHEMMKRHNVDTVFGYPGGAILPVYDAIY 125

Query: 68  EVEGMRWAGNCNELNASYAADAYARIKG-MSCLITTFGVGELSALNGIAGSYAEHVGVLH 126
             +   +    +E  A + A+ YAR  G    ++ T G G  + +  +A + A+ V ++ 
Sbjct: 126 NSKDFNFVLPRHEQGAGHMAEGYARASGKCGVVLVTSGPGATNVITPMADALADGVPMVV 185

Query: 127 IVG-VPSVSAQAKQLLLHHTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIR-T 184
             G VP+ +           +G         +S + ++   M+  +   P  I+      
Sbjct: 186 FTGQVPTAAIGTDAFQEADVIG---------ISRSCTKWNVMVKRVEDLPKCINEAFEIA 236

Query: 185 TYIRQRPVYLGLPSNFVDQMVPASLLDTPIDL-------ALKPNDQQA----EEEVISTL 233
           T  R  PV + LP +     V AS+L  PI +       ALK   + A     E  I   
Sbjct: 237 TSGRPGPVLVDLPKD-----VQASILRAPIPIKTTIPSNALKQLTRSAYTQFSEAGIKRA 291

Query: 234 LEMIKDAKNPVI-LADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVY 292
            E+I  AK P++ +     +  +     K+L D  Q P   T    G+ D+  P+   + 
Sbjct: 292 AELINIAKKPILYVGGGILNNPEGPRLIKELSDRAQIPVTTTLQALGAFDQDDPKSLDM- 350

Query: 293 VGTLSSPAVKEAVESADLVLSVGALLSD 320
           +G         A+++ADL+++VGA   D
Sbjct: 351 LGMHGYAPANLAIQNADLIIAVGARFDD 378

>Skud_13.267 Chr13 (459466..461529) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 119/513 (23%), Positives = 205/513 (39%), Gaps = 70/513 (13%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           +T G+   E + + +V TVFG PG   L + D I+  +   +    +E  A + A+ YAR
Sbjct: 92  LTGGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLPKHEQGAGHMAEGYAR 151

Query: 93  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVSAQAKQLLLHHTLGNGD 150
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 151 FTVFHRMSANISETTAMITDLATAPSEIDRCIR-TTYIRQRPVYLGLPSNFVDQMVPASL 209
                 +S + ++   M+  +   P  I+      T  R  PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKTVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 210 LDTPIDL-------ALKPNDQQAEEEV----ISTLLEMIKDAKNPVILADA-CASRHDVK 257
           L  PI         AL      A++E     IS   ++I  AK PV+   A   +  D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSHAQDEFVMQSISKAADLINLAKKPVLYVGAGILNNADGP 317

Query: 258 AETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGAL 317
              K+L +  Q P   T  G GS D++ P+   + +G         AV++ADL+++VGA 
Sbjct: 318 RLLKELSERAQIPVTTTLQGLGSFDQEDPKSLDM-LGMHGCVTANLAVQNADLLIAVGAR 376

Query: 318 LSDFNT-------------------GSFSYSYKTKNVVEFHSDHIKIR-------NATFP 351
             D  T                   G   +    KN+ +     I +        +   P
Sbjct: 377 FDDRVTCNIAKFAPEARRAAAEGRGGIVHFEVVPKNINKVVETQIAVEGDATSNLDKMMP 436

Query: 352 GVQMKFVLQSLLNKVGAVVKDYKPVPVP-ELPAPNAAVDPSTPL-KQQWLWNQVGQFLQE 409
            +   F ++      G + K  K  P    +  P + + P T + K   + N  G+ +  
Sbjct: 437 KI---FPVKERSEWFGQINKWKKEFPYAYMMETPGSKIKPQTVITKLSKIANDTGRHV-- 491

Query: 410 GDIVLTETGTSAFGINQT-HFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVI 468
             IV T  G       Q   + N    I+    G++GY   + +GA +A  E      VI
Sbjct: 492 --IVTTGVGQHQMWAAQHWTWKNPRTFITSGGLGTMGYGLPSAIGAQVAKPE----SLVI 545

Query: 469 LFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNK 501
              G+ S  +T  E+S+ V+      + +LNN+
Sbjct: 546 DIDGDASFNMTLTELSSAVQAGTPVKILILNNE 578

>Suva_13.287 Chr13 (465217..467280) [2064 bp, 687 aa] {ON} YMR108W
           (REAL)
          Length = 687

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 120/514 (23%), Positives = 206/514 (40%), Gaps = 72/514 (14%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           +T G+   E + + +V TVFG PG   L + D I+  +   +    +E  A + A+ YAR
Sbjct: 92  LTGGQIFNEMMSRHNVDTVFGYPGGAILPVYDAIHNSDKFTFVLPRHEQGAGHMAEGYAR 151

Query: 93  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVSAQAKQLLLHHTLGNGD 150
             G    ++ T G G  + +  +A ++A+ + ++   G VP+ +           +G   
Sbjct: 152 ASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVG--- 208

Query: 151 FTVFHRMSANISETTAMITDLATAPSEIDRCIR-TTYIRQRPVYLGLPSNFVDQMVPASL 209
                 +S + ++   M+  +   P  I+      T  R  PV + LP +     V A++
Sbjct: 209 ------ISRSCTKWNVMVKSVEELPLRINEAFEIATSGRPGPVLVDLPKD-----VTAAI 257

Query: 210 LDTPIDL-------ALKPNDQQAEEEV----ISTLLEMIKDAKNPVILADACASRH-DVK 257
           L  PI         AL     + ++E     I+   ++I  AK PV+   A    H D  
Sbjct: 258 LRNPIPTKTTLPSNALNQLTSRTQDEFVLQNINKAADLINLAKKPVLYVGAGILNHADGP 317

Query: 258 AETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGAL 317
              K+L D  Q P   T  G G+ D++ P+   + +G         AV++ADL+++VGA 
Sbjct: 318 RLLKELSDRAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLLIAVGAR 376

Query: 318 LSDFNT-------------------GSFSYSYKTKNVVEFHSDHIKIR-------NATFP 351
             D  T                   G   +    KN+ +     I +        +   P
Sbjct: 377 FDDRVTLNIAKFAPEARRAAAEGRGGIIHFEVSPKNINKVVETQIAVEGDATGNLDKMMP 436

Query: 352 GVQMKFVLQSLLNKVGAVVKDYKPVPVP-ELPAPNAAVDPSTPL-KQQWLWNQVGQFLQE 409
            +   F ++      G + +  K  P    +  P + + P T + K   + N  G+ +  
Sbjct: 437 KI---FPVKERSEWFGQINEWKKKYPYAYMMETPGSKIKPQTVITKLSKIANDTGRHV-- 491

Query: 410 GDIVLTETGTSAFGINQ--THFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRV 467
             IV T  G       Q  T     T+  S  L G++GY   A +GA +A  +      V
Sbjct: 492 --IVTTGVGQHQMWAAQHWTWKTPRTFITSGGL-GTMGYGLPAAIGAQVAKPD----SLV 544

Query: 468 ILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNK 501
           I   G+ S  +T  E+S+ V+      + VLNN+
Sbjct: 545 IDIDGDASFNMTLTELSSAVQAGTPVKILVLNNE 578

>NCAS0A04320 Chr1 complement(873722..875791) [2070 bp, 689 aa] {ON}
           Anc_2.441 YMR108W
          Length = 689

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 120/514 (23%), Positives = 206/514 (40%), Gaps = 72/514 (14%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           +T G+   E + + +V T+FG PG   L + D I++ +  ++    NE  A + A+ YAR
Sbjct: 94  LTGGQIFHEMILRNNVDTIFGYPGGAILPVYDAIHDSKSFQFILPKNEQGAGHMAEGYAR 153

Query: 93  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVSAQAKQLLLHHTLGNGD 150
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 154 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 210

Query: 151 FTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYI-----RQRPVYLGLPSNFVDQMV 205
                 +S + ++   M+  +   P    RCI   +      R  PV + LP +     V
Sbjct: 211 ------ISRSCTKWNVMVRTVDDMP----RCINEAFEIAMSGRPGPVLVDLPKD-----V 255

Query: 206 PASLLDTPIDL-------ALKPNDQQAEEEVISTLLE----MIKDAKNPVILADA-CASR 253
            A++L  PI +       AL    + A +E     +E    +I  AK PV+   A   + 
Sbjct: 256 TAAILRNPIPVKSTLPSSALSQITKLAHDEFTMENIERAAALINIAKKPVLYVGAGILNN 315

Query: 254 HDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLS 313
            D     K+L D  Q P   T  G G+ D++ P+   + +G         AV++ADLV++
Sbjct: 316 VDGPRIIKELSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGCATANLAVQNADLVIA 374

Query: 314 VGALLSDFNTGSFS-------------------YSYKTKNVVEFHSDHIKIRNATFPGVQ 354
           +G    D  TG+ +                   +    KN+ +     + +       V+
Sbjct: 375 LGTRFDDRVTGNITKFAPEARRAAMEGRGGIIHFEISPKNISKVVETQVAVEGDATANVE 434

Query: 355 MK----FVLQSLLNKVGAVVKDYKPVPVPEL-PAPNAAVDPSTPL-KQQWLWNQVGQFLQ 408
                 F ++      G + K  K  P   +   P + + P T + K   L N  G+ + 
Sbjct: 435 KMLTKIFPVRERNEWFGMINKWKKQYPYDYMRETPTSKIKPQTVITKLSKLANDSGRPV- 493

Query: 409 EGDIVLTETGTSAFGINQT-HFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRV 467
              IV T  G       Q   + N    IS    G++GY   A +GA +A  E      V
Sbjct: 494 ---IVTTGVGQHQMWTAQHWTWKNPRSFISSGGLGTMGYGLPAAIGAQVAKPE----ALV 546

Query: 468 ILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNK 501
           I   G+ S  ++  E+S+ V+      + +LNN+
Sbjct: 547 IDIDGDASFNMSLTELSSAVQAGTPVKVLILNNE 580

>Kpol_297.12 s297 complement(20788..22803) [2016 bp, 671 aa] {ON}
           complement(20788..22803) [2016 nt, 672 aa]
          Length = 671

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 112/527 (21%), Positives = 214/527 (40%), Gaps = 78/527 (14%)

Query: 23  QNKPEITMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELN 82
           Q K + ++  +T G    E + + +V TVFG PG   L + D IY  +  ++    +E  
Sbjct: 66  QLKMDKSLIGLTGGEIFHEMMIRNNVDTVFGYPGGAILPVYDAIYNSDKFKFVLPRHEQG 125

Query: 83  ASYAADAYARIKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVSAQAKQL 140
           A + A+ Y+R  G    ++ T G G  + +  +A + A+ + ++   G VP+ +      
Sbjct: 126 AGHMAEGYSRASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTDAF 185

Query: 141 LLHHTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIR-TTYIRQRPVYLGLPSN 199
                +G         +S + ++   M+  +   P  I+      T  R  PV + LP +
Sbjct: 186 QEADVIG---------ISRSCTKWNVMVKSVEELPRRINEAFEIATSGRPGPVLVDLPKD 236

Query: 200 FVDQMVPASLLDTPIDL-----------ALKPNDQQAEEEVISTLLEMIKDAKNPVILAD 248
                V A++L  PI +            +K    +  EE +S    +I  AK PV+   
Sbjct: 237 -----VTAAILRNPIPVNSTLPSNALNQLVKNAHNEFTEESLSKAASLINIAKRPVLYVG 291

Query: 249 ACASRHDVKAE-TKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVES 307
                H+      ++L +  Q P   + +G G+ D++ P+   + +G         A+++
Sbjct: 292 GGILNHEEGPRLLRELSERAQIPVTTSLLGLGAFDQEDPKSLDM-LGMHGHAPANLAIQN 350

Query: 308 ADLVLSVGALLSDFNTGSFS-------------------YSYKTKNVVEFHSDHIKIRNA 348
           ADL+++VGA   D  TG+ +                   +    KN+ +     + +   
Sbjct: 351 ADLIIAVGARFDDRVTGNIAKFAPEARRAALENRGGIIHFEITAKNINKVVDTQVAVEGD 410

Query: 349 TFPGVQMKFVLQSLLNKVGAV---------VKDYKPVPVPELPAPNAAVDPSTPLKQQWL 399
                     L+ LL  + AV         ++D+K     + P      +P + +K Q +
Sbjct: 411 AAAN------LEKLLPNIFAVKERKDWFDLIEDWK----QKYPYSYMKEEPGSRIKPQTI 460

Query: 400 WNQVGQFLQEGD---IVLTETGTSAFGINQ--THFPNNTYGISQVLWGSIGYATGACLGA 454
             ++ +   E +   IV T  G       Q  T     T+  S  L G++G+   + +GA
Sbjct: 461 IAKLSKLANESNRETIVTTGVGQHQMWAAQHWTWKHPRTFITSGGL-GTMGFGLPSAIGA 519

Query: 455 VMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNK 501
            +A  +      VI   G+ S  +T  E+++ V+ +    + +LNN+
Sbjct: 520 QVAKPD----SMVIDIDGDASFNMTLMEMTSAVQASAPVKVLLLNNE 562

>ZYRO0E03454g Chr5 complement(270926..272575) [1650 bp, 549 aa] {ON}
           similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020C Hypothetical ORF
          Length = 549

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 114/491 (23%), Positives = 197/491 (40%), Gaps = 61/491 (12%)

Query: 38  YVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGM- 96
           Y    L+   V TVFG+ G   + L D + E  G+++    NE +ASYAA AY  + G  
Sbjct: 6   YFTRVLQNYGVDTVFGIVGIPIVELADTMIE-HGIKFIACRNEQSASYAASAYGYLTGKP 64

Query: 97  SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTVFHR 156
             L+   G G + AL GI  S +    +L + G    S++A+          G F    +
Sbjct: 65  GVLLVVGGPGIIHALAGIYNSMSNKWPLLVLAG----SSEAQH--------RGGFQELDQ 112

Query: 157 MSANISETTAMITDLATAPSEI---DRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLDTP 213
           +S  +         L ++  ++   D      Y      YL +P N +   V    L  P
Sbjct: 113 VSL-LKPYVKFSGQLNSSNIDVLTYDALRLVQYTTAGATYLDIPGNLIGSTVKKDSL-PP 170

Query: 214 IDLALKPN---DQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFP 270
           +     P    D  A +EV     ++I+     V++     + H    E ++ +D  Q P
Sbjct: 171 VKNIYVPKSSPDPSAVQEVT----DLIRKNPENVLVVVGKGAVH-ASQEIRQFVDRFQLP 225

Query: 271 SFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSY 330
              TPMGKG + + HP           S A   A++ A +VL +GA L+     + +  +
Sbjct: 226 FLPTPMGKGVVPDSHP--------LNVSSARSRALQEAKVVLVLGARLNWILHFASAPKW 277

Query: 331 KTKNV-VEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVK-------DYKPVPV-PEL 381
               + ++  SD   + +  F    +     SL   +G  V+       DY    + P L
Sbjct: 278 NPDALFIQVDSDTTTLGHNNFKSQHL-----SLWGDIGLTVRLITASLGDYHSQGLSPSL 332

Query: 382 P---APNAA-------VDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPN 431
               A NAA          S+ L    ++  +   + +   ++   G +     +  FP 
Sbjct: 333 QSNIARNAAKLKSQESQQVSSRLNYNVVYAHLRPLINDESTIIVSEGANTMDKARVSFPT 392

Query: 432 NTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNL 491
           + Y + ++  G+     G  +G  +AA+  +  K V++  G+ +   +A +I T  R  L
Sbjct: 393 D-YPLQRLDAGT-NATMGVGMGYALAAKVSNPDKTVLVIQGDSAFGFSAMDIETATRSGL 450

Query: 492 KPYLFVLNNKG 502
              + V+NN G
Sbjct: 451 ALIVIVMNNGG 461

>ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 700

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 121/532 (22%), Positives = 216/532 (40%), Gaps = 74/532 (13%)

Query: 16  LNSNRVSQNKPEITMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWA 75
           L+    SQ + + +   +T G+   E +++ DV TVFG PG   L + D I+E +   + 
Sbjct: 87  LHKKLKSQQEMDSSFIGLTGGQIFHEMMRRHDVDTVFGYPGGAILPVYDAIHESDAFNFI 146

Query: 76  GNCNELNASYAADAYARIKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVS 134
              +E  A + A+ YAR  G    ++ T G G  + +  +  + A+ V ++   G  + S
Sbjct: 147 LPRHEQGAGHMAEGYARATGRPGVVLVTSGPGATNVVTPMTDALADGVPLIVFTGQVATS 206

Query: 135 AQAKQLLLHHTLGNGDFTVFH--RMSANISETTAMITDLATAPSEIDRCIRTTYI-RQRP 191
           A          +G   F       +S + ++   M+ ++   P  I+         R  P
Sbjct: 207 A----------IGTDAFQEADVVGISRSCTKWNVMVKNVEELPKRINEAFEIAMSGRPGP 256

Query: 192 VYLGLPSNFVDQMVPASLLDTPIDL-ALKPND------QQAEEEVISTLLEMIKD----A 240
           V + LP +     V A++L  PI   +  P+D      ++A++E  S  ++   D    A
Sbjct: 257 VLVDLPKD-----VTAAVLRNPIPTKSTLPSDSLAQLTKRAQDEFTSNNVKRAADLVNVA 311

Query: 241 KNPVILADA-CASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSP 299
           K P++   A   +  D     K+L +  Q P   T  G G+ D++  +   + +G     
Sbjct: 312 KKPILYVGAGIFNNPDGPRLLKELSERAQIPVTTTLQGLGAFDQEDTKSLDM-LGMHGCA 370

Query: 300 AVKEAVESADLVLSVGALLSDFNTGSFS-------------------YSYKTKNVVEFHS 340
               A+++ADL+L+VGA   D  T + S                   +    KN+ +   
Sbjct: 371 TANLAIQNADLILAVGARFDDRVTCNISKFAPEARRAALEGRGGIVHFEMTPKNISKVVE 430

Query: 341 DHIKIRNATFPGVQMKFVL-------QSLLNKVGAVVKDYKPVPVPEL-PAPNAAVDPST 392
             + +       +Q    L       Q   N++    K+Y   P+  +   P + + P T
Sbjct: 431 TQVAVHGDAATNIQKLIPLVFGVKERQEWFNQISQWKKEY---PLDYMHETPGSKIKPQT 487

Query: 393 PL-KQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYG--ISQVLWGSIGYATG 449
            + K   + N  G+ +    IV T  G       Q H+   T    I+    G++GY   
Sbjct: 488 VISKLSDIANATGKEV----IVTTGVGQHQMWAAQ-HWTWKTPRSFITSGGLGTMGYGLP 542

Query: 450 ACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNK 501
           A +GA +A      +  V    G+ S  +T  E+S+ V+      + VLNN+
Sbjct: 543 AAIGAQIA----KPNALVFDIDGDASFNMTLTELSSAVQAKTPIKILVLNNE 590

>SAKL0E03740g Chr5 (302160..304199) [2040 bp, 679 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 679

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 77/311 (24%), Positives = 137/311 (44%), Gaps = 32/311 (10%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           +T G+   E +++  V TVFG PG   L + D IY      +    +E  A + A+ YAR
Sbjct: 84  LTGGQIFHEMMQRHKVDTVFGYPGGAILPVYDAIYNSNAFNFVLPKHEQGAGHMAEGYAR 143

Query: 93  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDF 151
             G    ++ T G G  + +  +A + A+ V ++   G  S +A          +G   F
Sbjct: 144 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVSTTA----------IGTDAF 193

Query: 152 TVFH--RMSANISETTAMITDLATAPSEIDRCIR-TTYIRQRPVYLGLPSNFVDQMVPAS 208
                  +S + ++   M+  +   P  I+      T  R  PV + LP +     V A+
Sbjct: 194 QEADVVGISRSCTKWNVMVKSIEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTAA 248

Query: 209 LLDTPI--------DLALKPNDQQAEEEVISTLL---EMIKDAKNPVILADACASRHDVK 257
           +L  PI        D  L+   +  +E  ++++    ++I  AK P++        H+  
Sbjct: 249 VLRNPIPTKSTLPSDALLQITKRAVDEFTMNSIAKASDLINVAKKPLLYVGGGILGHENG 308

Query: 258 AE-TKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGA 316
            +  K+L +  Q P   T  G G+ D++ P+   + +G   S A   AV++ADL++++GA
Sbjct: 309 PKFLKELSERAQIPVTTTLQGLGAFDQEDPKSLDM-LGMHGSAAANTAVQNADLIIALGA 367

Query: 317 LLSDFNTGSFS 327
              D  T + S
Sbjct: 368 RFDDRVTCNIS 378

>TPHA0B03940 Chr2 (928983..930710) [1728 bp, 575 aa] {ON} Anc_1.450
           YEL020C
          Length = 575

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 125/533 (23%), Positives = 225/533 (42%), Gaps = 84/533 (15%)

Query: 30  MSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADA 89
           MS I++  Y+   LK+ D+ TVFG+ G   +  L E +   G+++    NE +ASYAA  
Sbjct: 1   MSGISVPDYISTVLKKYDIDTVFGIVG-IPIVELAESFITNGIKFISFRNEQSASYAASL 59

Query: 90  YARIKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAK-----QLLLH 143
           Y  +      L+T  G G + AL GI  S   +  ++ I G   + +Q K     Q L H
Sbjct: 60  YGYLNNKPGVLLTVGGPGLIHALAGIYNSIENNWPLIVITG--GIESQQKYKNGFQELNH 117

Query: 144 HTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQRPV-YLGLPSNFVD 202
             L N     + + +  +S       DL    S     +R + +  + V +L +P + + 
Sbjct: 118 IALLNS----YMKFTGELSTEN---IDLLVYES-----MRNSMLSPKGVSFLEIPGDLIH 165

Query: 203 QMVPASLLDT-----PI---DLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRH 254
           + V  ++ D+     PI    L   PND    E        M K  +N +++    A   
Sbjct: 166 KSVGKNIGDSLAKHKPILVDALTFIPNDDILLETAKFLYDAMRKRDQNMLVIVGKGAI-- 223

Query: 255 DVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSV 314
              +  +  I+    P   TPM KG I++ +     + V +  S A+K+    AD++L  
Sbjct: 224 GASSALRHFINCFNLPFLPTPMAKGIIEDSNE----LNVSSGRSMALKD----ADVILVF 275

Query: 315 GALLSDFNTGSFSYSYKTKNVVEFHSDHIKIRNATFP-GVQMKFVLQ-SLLNKVGAVVKD 372
           GA L+      +  + K K+ V+F    I++ N T   G+  +  LQ SL+  + + VK 
Sbjct: 276 GAKLNWIL--HYGDTPKFKDNVKF----IQVDNNTKTIGLNNQRGLQNSLIGDIESTVKK 329

Query: 373 ---------------YKPV--PVPELPAPNA------------AVDPSTPLKQQWLWNQV 403
                          YK +   + E    NA             V  +  L    ++ ++
Sbjct: 330 LTMMINHLQNGQMITYKGLSKAIKEKILSNAIKLNEKENATPRVVPNANSLNYNVVFGRL 389

Query: 404 GQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDK 463
               ++ + +L   G +   + +  FP + +   ++  G++    G  LG  ++ +    
Sbjct: 390 KTLFKDEETILVTEGANTMDVARISFPTD-FPQHRIDCGTLA-TMGIGLGYAISTKLSKP 447

Query: 464 SKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEY 516
           +K V+L  G+ +   +  E+ T VR+NL   + ++NN G     + HG T ++
Sbjct: 448 NKSVVLIQGDSAFGFSGLELETSVRFNLGLIVVIMNNSG-----IYHGTTKDH 495

>KNAG0E02360 Chr5 complement(470361..472442) [2082 bp, 693 aa] {ON}
           Anc_2.441 YMR108W
          Length = 693

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 83/352 (23%), Positives = 149/352 (42%), Gaps = 45/352 (12%)

Query: 3   DLILYCDFYKTRNLNSNRVSQNKPEI--------TMSEITLGRYVFERLKQVDVTTVFGL 54
           DL      YK  N +S + S+   ++        ++  +T G+   E + + +V TVFG 
Sbjct: 59  DLDPATSLYKASNESSIKRSKLSDKLRSATELDNSLVGLTGGQIFNEMMSRHNVDTVFGY 118

Query: 55  PGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGM-SCLITTFGVGELSALNG 113
           PG   L + D IY  E  ++    +E  A + A+ YAR  G    ++ T G G  + +  
Sbjct: 119 PGGAILPVYDAIYGSENFKFVLPKHEQGAGHMAEGYARASGKPGVVLVTSGPGATNVVTP 178

Query: 114 IAGSYAEHVGVLHIVG-VPSVSAQAKQLLLHHTLGNGDFTVFHRMSANISETTAMITDLA 172
           +A + A+ V ++   G VP+ +           +G         +S + ++   M+ ++A
Sbjct: 179 MADALADGVPMVVFTGQVPTNAIGTDAFQEADVVG---------ISRSCTKWNVMVKNVA 229

Query: 173 TAPSEIDRCIRTTYI-RQRPVYLGLPSN----FVDQMVP-----------ASLLDTPIDL 216
             P  I+         R  PV + LP +     + + +P           A+   T  D 
Sbjct: 230 ELPKRINEAFEIAMSGRPGPVLVDLPKDVTAAVLREAIPTESTLPSLNGGATTGATVFDE 289

Query: 217 ALKPNDQQAEEEVISTLLEMIKDAKNPVI-LADACASRHDVKAETKKLIDITQFPSFVTP 275
            L P         I+   ++I  AK PV+ + +   +  D     K+L D  Q P   T 
Sbjct: 290 FLAP--------AINKAADLINLAKKPVLYVGNGILNNEDGPRLLKELSDRAQIPVTTTL 341

Query: 276 MGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFS 327
            G G+ D++ P+   + +G         A+++ADL+++VGA   D  TG+ +
Sbjct: 342 QGLGAFDQEDPKSLDM-LGMHGCATANLAIQNADLIIAVGARFDDRVTGNIT 392

>NDAI0E02050 Chr5 complement(414418..416490) [2073 bp, 690 aa] {ON}
           Anc_2.441
          Length = 690

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 112/512 (21%), Positives = 199/512 (38%), Gaps = 70/512 (13%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           +T G+   E + + +V TVFG PG   L + D I++     +    NE  A + A+ YAR
Sbjct: 95  LTGGQIFHEMILRNNVDTVFGYPGGAILPVYDAIHDSSAFNFVLPKNEQGAGHMAEGYAR 154

Query: 93  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVSAQAKQLLLHHTLGNGD 150
             G    ++ T G    + +  +A + A+ V ++   G VP+ +           LG   
Sbjct: 155 ASGKPGVVLVTSGPAATNVITPMADALADGVPMVVFTGQVPTSAIGTDAFQEADVLG--- 211

Query: 151 FTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYIRQR-PVYLGLPSNFVDQMVPASL 209
                 +S + ++   M+  +   P  I+        R+  PV + LP +     V A++
Sbjct: 212 ------ISRSCTKWNVMVRSVEEMPRRINEAFEIAMSRRPGPVLVDLPKD-----VTAAI 260

Query: 210 LDTPIDL-------ALKPNDQQAEEEVI----STLLEMIKDAKNPVILADA-CASRHDVK 257
           L  PI +       AL    + A +E I        ++I  AK PV+   A   +  +  
Sbjct: 261 LRNPIPVKTTLPSGALSQLTKLAHDEFILENIKKAADLINIAKKPVLYVGAGILNNMEGP 320

Query: 258 AETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGAL 317
              K L    + P   T  G G+ D++ P      +G         AV+++DL+++VG  
Sbjct: 321 RILKDLSQRAKIPVTTTIQGLGAFDQEDP-LSLDMLGMHGCATANLAVQNSDLIIAVGTR 379

Query: 318 LSDFNTGSFS-------------------YSYKTKNVVEFHSDHIKIRNATFPGVQMKFV 358
             D  TG+ S                   +    KN+ +     + +       ++    
Sbjct: 380 FDDRVTGNISKFAPEARRAALEGNGGIIHFEISPKNINKVVEAQVAVEGDAAANIEK--- 436

Query: 359 LQSLLNKVGA------VVKDYKPVPVPELPAPNAAVDPSTPLKQQWLWNQVGQFLQE-GD 411
           + S++  V A       +K +K     E P       P + LK Q +  ++ +     G 
Sbjct: 437 MLSMIFPVRARSEWLNTIKQWKK----EFPYDYMRETPESKLKPQTVITKLSKLANSTGK 492

Query: 412 IVLTETGTSAFGINQTHF---PNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVI 468
            V+  TG     +    +    N    I+    G++GY   A +GA +A  E      VI
Sbjct: 493 PVIVTTGVGQHQMWTAQYWTWKNPRSFITSGGLGTMGYGLPAAIGAQVAKPE----ALVI 548

Query: 469 LFTGEGSLQLTAQEISTMVRWNLKPYLFVLNN 500
              G+ S  ++  E+S+ V+      + +LNN
Sbjct: 549 DIDGDASFNMSLTELSSAVQAGTAVKVLILNN 580

>Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar to
           Ashbya gossypii AEL055C
          Length = 544

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 111/501 (22%), Positives = 203/501 (40%), Gaps = 91/501 (18%)

Query: 43  LKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGM-SCLIT 101
           LKQ  V  VFG+ G   + + +   E  G+R+ G  NE + SYAA AY  + G    L+ 
Sbjct: 11  LKQYGVEVVFGIVGIPIVEVAESFVE-HGIRFIGCRNEQSCSYAASAYGYLTGKPGVLLV 69

Query: 102 TFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTVFHRMSANI 161
             G G + AL G+  S+     +L + G    S++ +       L     +V  R     
Sbjct: 70  VGGPGVIHALAGVYNSFVNKWPLLVLAG----SSENEYYEGFQEL--DQLSVMSRWCKFY 123

Query: 162 SE-TTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPAS-LLDTPIDLA-- 217
               T  ++ L      +   ++T+ ++    Y+ +P   +++   +S  L   +++A  
Sbjct: 124 GRINTGNLSHL------VYTAMKTSMLQNAVTYIDIPGGLIEEKAKSSDELPKKMEIAHI 177

Query: 218 -LKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPM 276
              P+ Q+ +E  ++T+++  K      IL        +  AE +  ++  Q P   TPM
Sbjct: 178 RCGPDIQRVKE--VATIMQSGKK-----ILVVVGRGSANYPAEVRAFLEKYQLPFLPTPM 230

Query: 277 GKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLS----------------- 319
            KG + + H     + V    S A+K    SA++VL +GA L+                 
Sbjct: 231 AKGIVPDTHE----LNVNGARSLALK----SAEVVLILGARLNWILHFGLEPKWSDDACF 282

Query: 320 ---DFNTGSFSYSYKTKNVVEFHSD---HIKIRNATFP------GVQMKFVLQSLLNKVG 367
              D +  +   +         HSD    I+  +   P      GV  K +  S ++  G
Sbjct: 283 IQVDRDLSALGTNNPRGVNFSVHSDIGLFIEACDNVLPKTWKNDGVDEKIL--SKIHSNG 340

Query: 368 AVVKDYKPVPVPELPAPNAAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQT 427
             +K+ + +P              + L+   ++ ++ +F+ +   ++   G +   I + 
Sbjct: 341 KAMKEKEIIP------------EGSALRYHGVYAKLREFIDDKSTIMVLEGANTMDIARV 388

Query: 428 HFPNN------TYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTAQ 481
            FP +        G S  +   IGYA        MAA+  + SK V+   G+ +   +A 
Sbjct: 389 SFPTSYQKHRLDAGTSATMGVGIGYA--------MAAKVANPSKFVVALEGDSAFGFSAM 440

Query: 482 EISTMVRWNLKPYLFVLNNKG 502
           E+ T+ R  L   + V+NN G
Sbjct: 441 ELETIARNKLGIVVVVMNNGG 461

>KNAG0A06250 Chr1 complement(948840..950882) [2043 bp, 680 aa] {ON}
           Anc_2.441 YMR108W
          Length = 680

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 76/322 (23%), Positives = 140/322 (43%), Gaps = 32/322 (9%)

Query: 21  VSQNKPEITMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNE 80
           +S  K + ++  +T G+   E + + +V TVFG PG   L + D I+E    ++    +E
Sbjct: 72  ISNPKLDSSLIGMTGGQIFHEMMIRNNVDTVFGYPGGAILPVYDAIHESSAFKFVLPKHE 131

Query: 81  LNASYAADAYARIKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVSAQAK 138
             A + A+ YAR  G    ++ T G G  + +  +A + A+ + ++   G VP+ +    
Sbjct: 132 QGAGHMAEGYARASGKPGVVLVTSGPGATNVVTPMADALADGIPMVVFTGQVPTSAIGTD 191

Query: 139 QLLLHHTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYI-RQRPVYLGLP 197
                  LG         +S + ++   M+ ++A  P  I+         R  PV + LP
Sbjct: 192 AFQEADVLG---------ISRSCTKWNIMVKNVAEMPKRINEAFDIAMSGRPGPVLVDLP 242

Query: 198 SNFVDQMVPASLLDTPI------------DLALKPNDQQAEEEVISTLLEMIKDAKNPVI 245
            +     V A++L  PI            +L    +D   +E  I    ++I  AK PV+
Sbjct: 243 KD-----VTAAILRNPIPVESTLPTSTLKNLVGDMHDAFTKER-IEKAAKLINIAKKPVL 296

Query: 246 -LADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEA 304
            +     +  +     K L D  Q P   T  G G+ D++ P+   + +G   S     +
Sbjct: 297 YVGGGILNNPEGPKLLKTLSDRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAVANLS 355

Query: 305 VESADLVLSVGALLSDFNTGSF 326
           +++ADL++++G    D  TG+ 
Sbjct: 356 IQNADLIIAIGTRFDDRVTGNL 377

>TDEL0A02160 Chr1 complement(389068..391116) [2049 bp, 682 aa] {ON}
           Anc_2.441 YMR108W
          Length = 682

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 118/529 (22%), Positives = 213/529 (40%), Gaps = 72/529 (13%)

Query: 19  NRVSQNKPEITMSEITL--GRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAG 76
           N+  +  P++  S I L  G+   E + + +V TVFG PG   L + D I++ +   +  
Sbjct: 71  NQKLRTDPQMDSSFIGLTGGQIFHEMMIRHNVDTVFGYPGGAILPVYDAIHDSKSFNFVL 130

Query: 77  NCNELNASYAADAYARIKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVS 134
             +E  A + A+ YAR  G    ++ T G G  + +  +A + A+ V ++   G VP+ +
Sbjct: 131 PRHEQGAGHMAEGYARASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPTSA 190

Query: 135 AQAKQLLLHHTLGNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIRTTYI-RQRPVY 193
                      +G         +S + ++   M+  +   P  I+         R  PV 
Sbjct: 191 IGTDAFQEADVVG---------ISRSCTKWNVMVRSIEELPLRINEAFEIAVSGRPGPVL 241

Query: 194 LGLPSNFVDQMVPASLLDTPI------------DLALKPNDQQAEEEVISTLLEMIKDAK 241
           + LP +     V A++L  PI             L  +  D+   E ++ T  +++  AK
Sbjct: 242 VDLPKD-----VTAAILKNPIPTKTTLPSNSLAQLTKRAMDESTNENIVRT-ADLLNKAK 295

Query: 242 NPVILADACASRHDVKAE-TKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPA 300
            PV+   A    +    +  K+L +  Q P   T    G+ D++ P+   + +G      
Sbjct: 296 TPVLYVGAGILNNPAGPKLLKELSERAQIPVTTTIQALGAFDQQDPKSLDM-LGMHGCAT 354

Query: 301 VKEAVESADLVLSVGALLSD---FNTGSFSYSYKTK------NVVEFHSDHIKIRNATFP 351
              A+++ADL+L+VG+   D    N   F+   +         +V F      I      
Sbjct: 355 ANMAIQNADLILAVGSRFDDRVTLNISKFAPEARRAALENRGGIVHFEICPKNISKVVET 414

Query: 352 GVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVD--------------PSTPLKQQ 397
            V ++    S + K+  +V     VPV E     A ++              P + +K Q
Sbjct: 415 QVAVEGDAASNIEKLLPLV-----VPVKERTEWFAQIEEWKEKYPYAYQKETPGSKIKPQ 469

Query: 398 WLWNQVGQFLQEGD---IVLTETGTSAFGINQ--THFPNNTYGISQVLWGSIGYATGACL 452
            + +++     + D   IV T  G       Q  T     ++  S  L G++GY   A +
Sbjct: 470 TVISKLSDLANKSDKEVIVTTGVGQHQMWAAQYWTWKSPRSFITSGGL-GTMGYGLPAAI 528

Query: 453 GAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNK 501
           GA +A  +      VI   G+ S  +T  E+S+ V+      + +LNN+
Sbjct: 529 GAQVAKPD----ALVIDIDGDASFNMTLMELSSAVQAKTPVKILLLNNE 573

>Kwal_26.7582 s26 (427437..429476) [2040 bp, 679 aa] {ON} YMR108W
           (ILV2) - acetolactate synthase [contig 54] FULL
          Length = 679

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 131/301 (43%), Gaps = 32/301 (10%)

Query: 36  GRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKG 95
           G+   E +++  V TVFG PG   L + D IY  +   +    +E  A + A+ YAR  G
Sbjct: 87  GQIFHEMMRRHKVDTVFGYPGGAILAVYDAIYNSKYFNFVLPKHEQGAGHMAEGYARASG 146

Query: 96  M-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTVF 154
               ++ T G G  + +  +A + A+ V ++   G  + S          ++G   F   
Sbjct: 147 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATS----------SIGTDAFQEA 196

Query: 155 H--RMSANISETTAMITDLATAPSEIDRCIRTTYI-RQRPVYLGLPSNFVDQMVPASLLD 211
               +S + ++   M+  +   P  I+         R  PV + LP +     V +++L 
Sbjct: 197 DVIGISRSCTKWNVMVKTVEELPRRINEAFEIAVSGRPGPVLVDLPKD-----VTSAILK 251

Query: 212 TPIDL-------AL----KPNDQQAEEEVISTLLEMIKDAKNPVI-LADACASRHDVKAE 259
           TPI +       AL    K   Q+  +  I  + ++I  AK P++ +      R D    
Sbjct: 252 TPIPVNSTLPFDALSKLTKATAQEFTKANIQKVADLINIAKKPLLYVGGGIFGREDGPKL 311

Query: 260 TKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLS 319
            ++L D  Q P   T  G G+ D++ P+   + +G   S     +V++ADL++++GA   
Sbjct: 312 LRQLADRAQIPVTTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARFD 370

Query: 320 D 320
           D
Sbjct: 371 D 371

>AEL305C Chr5 complement(69381..71387) [2007 bp, 668 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR108W
           (ILV2)
          Length = 668

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 115/516 (22%), Positives = 210/516 (40%), Gaps = 68/516 (13%)

Query: 29  TMSEITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAAD 88
           +M   + G    E +++ +V TVFG PG   L + D IY  +   +    +E  A + A+
Sbjct: 69  SMIGFSGGEIFHEMMRRHNVDTVFGYPGGAILPVYDAIYNSDAFNFVLPKHEQGAGHMAE 128

Query: 89  AYARIKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVSAQAKQLLLHHTL 146
            YAR  G    ++ T G G  + +  +A + A+ V ++   G VP  +           +
Sbjct: 129 GYARASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPKAAIGTDAFQEADVV 188

Query: 147 GNGDFTVFHRMSANISETTAMITDLATAPSEIDRCIR-TTYIRQRPVYLGLPSNFVDQMV 205
           G         +S + ++   M+  +   P  I+      T  R  PV + LP +     V
Sbjct: 189 G---------ISRSCTKWNVMVNHVEELPRRINEAFEIATSGRPGPVLVDLPKD-----V 234

Query: 206 PASLLDTPIDLA--------LKPNDQQAEEEVISTLLE---MIKDAKNPVILADACASRH 254
            A++L +PI LA         +   Q A+ + + +L +   +I  A+ PV+   A     
Sbjct: 235 TAAILRSPIPLASALPSTTLAQLTRQAADIDGVRSLADASRLINMAQKPVLYVGAGILNS 294

Query: 255 DVKAE-TKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLS 313
               E  ++L +  Q P   T    G+ D++  +   + +G   S A    V++ADL+++
Sbjct: 295 TRGPEFLRELAEKAQIPVTTTLQALGAFDQEDSKSVDM-LGMHGSAAANLTVQNADLIIA 353

Query: 314 VGALLSDFNTGSF---------SYSYKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLN 364
           +GA   D  TG+          +   +   +V F      I       V ++  + + L 
Sbjct: 354 LGARFDDRVTGNIAKFAPEAQRAAREQRGGIVHFEISPKNINKVVDAQVAVEGDVTANLE 413

Query: 365 KVGAVVKDYKPVPVP--------------ELPAPNAAVDPSTPLKQQWLWNQVGQFLQE- 409
           K+  ++K     PV               E P   +   P + +K Q +  ++ +     
Sbjct: 414 KLLPLIK-----PVAERKEWLGQIASWKSEYPYDYSRETPGSRIKPQTVITRLSEIANAT 468

Query: 410 GDIVLTETGTSAFGI----NQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSK 465
           G  V+  TG     +    + T     T+  S  L G++G+   A +GA +A  +     
Sbjct: 469 GKEVIVTTGVGQHQMWAAQHWTWKKPRTFITSGGL-GTMGFGLPAAIGAQVAKPD----A 523

Query: 466 RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNK 501
            VI   G+ SL +T  E+S+ V+      + +LNN+
Sbjct: 524 IVIDIDGDASLNMTLMEMSSAVQAGAPVKILLLNNE 559

>Skud_5.76 Chr5 complement(117925..119607) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 108/492 (21%), Positives = 196/492 (39%), Gaps = 49/492 (9%)

Query: 37  RYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGM 96
           ++  + L++  + TVFG+ G   ++L D +    G+++    NE  ASYAA  Y  +   
Sbjct: 7   QHFAQLLQRYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASGYGYVNDK 65

Query: 97  -SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAK---QLLLHHTLGNGDFT 152
              L+   G G + +L GI  S      +L I G  S S   K   Q L   +L      
Sbjct: 66  PGVLLIVGGPGLIHSLAGIYNSMNNRWPLLVIAGSSSQSDIHKGGFQELDQISL----LY 121

Query: 153 VFHRMSANIS-ETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLD 211
            F + +  ++ +   M+T  A     ++ CI+ T       Y+ +P++F++   P    D
Sbjct: 122 PFLKFTGKLTPDNVDMVTQKA-----LNHCIQGT---AGVSYIDVPADFIESEKPLEGND 173

Query: 212 ---TPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQ 268
                + + L P     +   I  ++++I   ++  IL            E ++LI+   
Sbjct: 174 YIANELPMILTPKKCGPDPSQIKEIVQLILHHRDNNILIVIGKGAVKNSHEIRRLINKFN 233

Query: 269 FPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSY 328
            P   TPM KG + +  P           S A  +A+++AD+VL +GA L+       S 
Sbjct: 234 LPFLPTPMAKGIVPDSSP--------LNVSSARSQALKTADVVLVLGARLNWILHFGTSP 285

Query: 329 SYKTKNV-VEFHSDHIKI-RNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNA 386
            +  +++ ++F S+   +  N   PG  +       L+    + +  +  P  +    N 
Sbjct: 286 KWNAESIFLQFDSNPETLGDNNASPGADLSVWGDVGLSVTALMGELERQSPRWKYSGVNQ 345

Query: 387 AVDPSTPLKQQWL----------------WNQVGQFLQEGDIVLTETGTSAFGINQTHFP 430
           A+     L Q  L                +  +   + +   +L   G +   I +  FP
Sbjct: 346 AMREKIQLNQTRLLEKEKVGGAQLNYHQVYGTLRPLIDDYRTILVTEGANTMDIARVSFP 405

Query: 431 NNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWN 490
            +     + L        G  LG  +A++       V+L  G+ +   +A EI T VR  
Sbjct: 406 TDVP--RRRLDAGTNATMGIGLGYALASKASHLELDVVLIQGDSAFGFSAMEIETAVRCQ 463

Query: 491 LKPYLFVLNNKG 502
           L   + V+NN G
Sbjct: 464 LALIIVVMNNSG 475

>Ecym_6107 Chr6 complement(201133..203202) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AEL305C
          Length = 689

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 115/525 (21%), Positives = 208/525 (39%), Gaps = 96/525 (18%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           +T G    E +++  V T+FG PG   L + D IY  +  ++    +E  A + A+ YA+
Sbjct: 94  LTGGEIFHEMMRRHKVDTIFGFPGGAILPVFDAIYSSDVFKFVLPKHEQGAGHMAEGYAK 153

Query: 93  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVG-VPSVSAQAKQLLLHHTLGNGD 150
             G    ++ T G G  + +  +A + A+ V ++   G VP  +           +G   
Sbjct: 154 ASGKPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVPRSAIGTDAFQEADVVG--- 210

Query: 151 FTVFHRMSANISETTAMITDLATAPSEIDRCIR-TTYIRQRPVYLGLPSNFVDQMVPASL 209
                 +S + ++   M+  +   P  I+      T  R  PV + LP +     V AS+
Sbjct: 211 ------ISRSCTKWNVMVNSVEELPRRINEAFEIATSGRPGPVLVDLPKD-----VTASV 259

Query: 210 LDTPIDLALKPNDQQAEE-----------EVISTLLEMIKDAKNPVILADACASRHDVKA 258
           L +PI +         EE           + I+   ++I  AK P++   A    +++  
Sbjct: 260 LKSPIPMTSTLPSNTLEELTRHVVDQHTVKTIANAAKLINMAKKPLLYVGAGILNNELGP 319

Query: 259 ET-KKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGAL 317
           +  K+L +  Q P   T  G G+ D+  P+   + +G   S A   A+++AD+++++GA 
Sbjct: 320 KVLKELAERAQIPVTTTLHGLGAFDQDDPKSLDM-LGMHGSAAANIAIQNADVIVALGAR 378

Query: 318 LSDFNTGSFSYSYKTKNVVEFHSDHIKIRNATFPGVQMKFVLQSLLNKV--------GAV 369
             D  TG         NV +F  +  K       G+    +    +NKV        G V
Sbjct: 379 FDDRVTG---------NVAKFAPEARKAAAEGRGGIVHLEISPKNINKVIDAQVAVEGDV 429

Query: 370 VKDYKPV-----PVPELP--------------------APNAAVDPSTPLKQ-QWLWNQV 403
             +   +     PV   P                     P++ + P T + +   + N  
Sbjct: 430 TANLAKILPLIDPVETRPEWLGQIYKWKEQYPYAYQKETPDSGIKPQTVIARLSEISNST 489

Query: 404 GQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLW--------GSIGYATGACLGAV 455
           G+     D+++T       G+ Q       +   +  W        G++G+   A +GA 
Sbjct: 490 GK-----DVIVTT------GVGQHQMWAAQHWQWKKPWSFITSGGLGTMGFGLPAAIGAQ 538

Query: 456 MAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNN 500
           +A      +  VI   G+ SL +T  E+ST V+      + +LNN
Sbjct: 539 VA----RPNALVIDIDGDASLNMTITELSTTVQAGTPVKILLLNN 579

>KLTH0D04532g Chr4 (417085..419121) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|P07342 Saccharomyces cerevisiae
           YMR108W ILV2 Acetolactate synthase catalyses the first
           common step in isoleucine and valine biosynthesis and is
           the target of several classes of inhibitors localizes to
           the mitochondria expression of the gene is under general
           amino acid control
          Length = 678

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 71/301 (23%), Positives = 131/301 (43%), Gaps = 32/301 (10%)

Query: 36  GRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKG 95
           G+   E +++  V TVFG PG   L + D IY  E   +    +E  A + A+ YAR+ G
Sbjct: 86  GQIFHEMMRRHKVNTVFGYPGGAILAVYDAIYNSEHFNFVLPKHEQGAGHMAEGYARVSG 145

Query: 96  M-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTVF 154
               ++ T G G  + +  +A + A+ V ++   G  + S          ++G   F   
Sbjct: 146 KPGVVLVTSGPGATNVVTPMADALADGVPMVVFTGQVATS----------SIGTDAFQEA 195

Query: 155 H--RMSANISETTAMITDLATAPSEIDRCIRTTYI-RQRPVYLGLPSNFVDQMVPASLLD 211
               +S + ++   M+ ++   P  I+         R  PV + LP +     V +++L 
Sbjct: 196 DVIGISRSCTKWNVMVKNVEELPRRINEAFEIAVSGRPGPVLVDLPKD-----VTSAILR 250

Query: 212 TPIDL-------ALKPNDQQAEEEV----ISTLLEMIKDAKNPVI-LADACASRHDVKAE 259
           TPI +       AL    + A +E     +    ++I  AK P+I +      +      
Sbjct: 251 TPIPVKSTLPSNALSKITKSAAKEFTLANLQRAADLINIAKKPLIYVGGGIFGKEQGPKL 310

Query: 260 TKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLS 319
            ++L +  Q P   T  G G+ D++ P+   + +G   S     +V++ADL++++GA   
Sbjct: 311 LRELAERAQIPVSTTIQGLGAFDQEDPKSLDM-LGMHGSAFANLSVQNADLIIALGARFD 369

Query: 320 D 320
           D
Sbjct: 370 D 370

>YEL020C Chr5 complement(118617..120299) [1683 bp, 560 aa] {ON}
           Protein of unknown function with low sequence identity
           to Pdc1p; mRNA identified as translated by ribosome
           profiling data
          Length = 560

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 125/511 (24%), Positives = 214/511 (41%), Gaps = 53/511 (10%)

Query: 34  TLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARI 93
           T  ++  + L++  + TVFG+ G   ++L D +    G+++    NE  ASYAA AY  I
Sbjct: 4   TATQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGIKFIPCRNEQAASYAASAYGYI 62

Query: 94  KGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAK---QLLLHHTLGNG 149
                 L+   G G + AL GI  S +    +L I G  S S   K   Q L   +L   
Sbjct: 63  SDKPGVLLIVGGPGLIHALAGIYNSMSNRWPLLVIAGSSSQSDIHKGGFQELDQVSL--- 119

Query: 150 DFTVFHRMSANIS-ETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPAS 208
             + F + +  ++ +   MIT  A     ++ CI+ T       Y+ +P++F++   P  
Sbjct: 120 -LSPFLKFTGKLTPDNIDMITQKA-----LNYCIQGT---AGVSYIDVPADFIEYEKPLE 170

Query: 209 LLD---TPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLID 265
             D     + + L PN    +   I  ++++I   KN  IL            E ++L++
Sbjct: 171 GNDRTGNELPMILTPNICGPDPSKIKKVVQLILQHKNKNILIVIGKGAVKNSHEIRRLVN 230

Query: 266 ITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGS 325
               P   TPM KG + +  P           S A  +A++ AD+VL +GA L+      
Sbjct: 231 TFNLPFLPTPMAKGIVPDSSP--------LNVSSARSQALKIADIVLVLGARLNWILHFG 282

Query: 326 FSYSYKTKNV-VEFHSDHIKI-RNATFPGVQMK------FVLQSLLNKVGAVVKDYKPVP 377
            S  + ++++ ++F S+   +  N   PG  +         + +L+ ++      +K   
Sbjct: 283 TSPKWNSESIFIQFDSNPETLGDNNVSPGADLSIWGDIGLSVTALVEELTRQDSCWKYSG 342

Query: 378 VPELPAPNAAVDPSTPLKQ------QWLWNQV----GQFLQEGDIVLTETGTSAFGINQT 427
           V +       ++ +  L++      Q  +NQV       + +   +L   G +   I + 
Sbjct: 343 VKQEIREKIQLNQTRLLRKEKTRGAQLNYNQVYGTLRPLIDDYRTILVTEGANTMDIARI 402

Query: 428 HFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMV 487
            FP  T    + L        G  LG  +A +       V+L  G+ +   +A EI T V
Sbjct: 403 SFP--TDAPRRRLDAGTNATMGIGLGYALACKASHPELDVVLIQGDSAFGFSAMEIETAV 460

Query: 488 RWNLKPYLFVLNNKG-YTIEKLIHG---PTA 514
           R  L   + V+NN G Y  EK I G   PTA
Sbjct: 461 RCQLALVIVVMNNSGIYHGEKDIEGDLPPTA 491

>SAKL0D10934g Chr4 (907649..909301) [1653 bp, 550 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 550

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 73/333 (21%), Positives = 137/333 (41%), Gaps = 43/333 (12%)

Query: 193 YLGLPSNFV------DQMVPASLLDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVIL 246
           Y+ +P N +      ++ +   ++ +P+  +  P        V+S +  +I + ++  IL
Sbjct: 153 YIDIPGNLITEEDCIEERISGKIIISPVRCSPDP-------LVVSEVARLIANNEHKEIL 205

Query: 247 ADACASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVE 306
                   +   E ++ +D  Q P   TPM KG + + HP           S A   A+ 
Sbjct: 206 VVIGKGAVNCANEIRRFVDQFQLPFLPTPMAKGVVPDSHP--------LNVSSARSLALR 257

Query: 307 SADLVLSVGALLS-DFNTGSFSYSYKTKNVVEFHSDHIKIRNATFPGVQMKFV--LQSLL 363
            AD+VL +GA L+   + G       T   V+F     ++ +    G+       +   L
Sbjct: 258 KADVVLLLGARLNWILHFGEPPKWKDTVKFVQFDYTPEELGHNNVAGLNYSLCGDIGLSL 317

Query: 364 NKVGAVVKDYK----------PVPVPELPAPNAAVDPSTPLKQQWLWNQV----GQFLQE 409
            ++G+ +  +K           +   EL       +  T L     +NQV     Q++ +
Sbjct: 318 EELGSKLHAFKYRGLNNAIREKIDTNELKLRGKERETRTALLH---YNQVYALMRQYITD 374

Query: 410 GDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVIL 469
            + +L   G +   + +  FP + Y   ++  G+     G  LG  +AA+  D +K VI 
Sbjct: 375 DETILVTEGANTMDVARISFPTD-YPKRKLDAGT-NATMGIGLGYALAAKASDTTKTVIC 432

Query: 470 FTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKG 502
             G+ +   +A E+ T VR +L   + V+NN G
Sbjct: 433 IQGDSAFGFSAMELETAVRCSLPLVVVVMNNSG 465

>AEL055C Chr5 complement(533904..535541) [1638 bp, 545 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL020C
          Length = 545

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 98/478 (20%), Positives = 190/478 (39%), Gaps = 46/478 (9%)

Query: 43  LKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGM-SCLIT 101
           LKQ  +  VFG+ G   + L +++ E  G+R+    NE + SYAA  Y  +      L+ 
Sbjct: 13  LKQHGIEVVFGIVGIPIVELAEKLAE-HGVRFIACRNEQSCSYAASVYGYLTNKPGALLV 71

Query: 102 TFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTVFH-RMSAN 160
             G G + AL GI  ++     +L I G      +     L        +T F  R+S  
Sbjct: 72  VGGSGVVHALAGIHNAWVNKWPLLVIAGSTEDEYKGGFQELDQLRIVAPWTSFKGRLS-- 129

Query: 161 ISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLDTPIDLALKP 220
           +     M+             ++T  ++    YL +P   ++      L   P+D  ++ 
Sbjct: 130 LDNVNYMVYT----------AVKTAVLQHGVSYLDVPGRLINMDAVGPLASKPVD--IQH 177

Query: 221 NDQQAEEEVISTLLEMIKDAKNP-VILADACASRHDVKAETKKLIDITQFPSFVTPMGKG 279
                +   +    ++++D +N  V++   CA    V    +  ++  + P    PM KG
Sbjct: 178 VRSGPDSSRVQGAAKLLQDGRNILVVVGRGCAEYPGV---VRSFLERYRLPFLPVPMAKG 234

Query: 280 SIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLS-DFNTGSFSYSYKTKNVVEF 338
            + + H     + V    S A+K     A++VL +GA L+   + GS          ++ 
Sbjct: 235 IVPDSHE----LNVNGCRSLALKR----AEIVLVLGARLNWILHYGSAPKWNADATFIQV 286

Query: 339 HSDHIKIRNATFPGVQMKFV--LQSLLNKVGAVVK---DYKPVPVPELPA---------P 384
             D   + +    GV    +  ++  +N + AV+     Y+ V    L            
Sbjct: 287 DRDPATLGHNNSSGVNYSVLSDVELFINAITAVLPQSWQYRGVDNEVLDKIRENGVKLQR 346

Query: 385 NAAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSI 444
            A + P +PL    +++ + + + + + +L+  G +    ++  F   T    + L    
Sbjct: 347 KAQLTPGSPLNYHAVYSLLRKLIDDKNTILSAEGANTMDNSRLWF--GTDYPKRRLDAGT 404

Query: 445 GYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKG 502
           G   G  +G  ++A+  +  K V+   G+ +   +  E+ T VR  +   + V+NN G
Sbjct: 405 GATMGLGVGYALSAKLANPDKFVVALEGDSAFGFSCMELETAVRNKVGLVVVVMNNGG 462

>KNAG0H01580 Chr8 complement(279178..280860) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 111/513 (21%), Positives = 201/513 (39%), Gaps = 78/513 (15%)

Query: 33  ITLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYAR 92
           +T+   +   L+  +V  VFG+ G   + L +E +   G+R+    NE +ASYAA AY  
Sbjct: 3   VTITERITTVLRHYEVDLVFGIVGIPIVTLANE-FITHGIRFVSCRNEQSASYAASAYGY 61

Query: 93  IKGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDF 151
           + G    L+   G G + +L G+  S      ++ + G              H    G F
Sbjct: 62  LTGKPGVLLVVGGPGLIHSLAGVYNSINNRWPLIVLAGSNDHG---------HDQYRGAF 112

Query: 152 TVFHRMS--ANISETTAMITDLATAPSEIDRCIRTTY-----IRQRPVYLGLPSNFVDQM 204
               ++S      + +  +T+       +D  + + Y       +   Y+ +P N ++  
Sbjct: 113 QELDQISLLKPYVKFSGKLTE-----GNVDHVLFSAYNIALQGTKGVTYVDIPGNLIETQ 167

Query: 205 V-----PASLLDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAE 259
                 P  L   P  +   P D    + V S +LE  +D K  V++           A 
Sbjct: 168 AVCAGTPGLLPPVPQPIKCSP-DPHTVKRVASLILEN-RDKKVLVVVGKGS---QGAFAA 222

Query: 260 TKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLS 319
            ++ ID   FP   TPMGKG + ++H            S A   A+  A +VL +GA L+
Sbjct: 223 VRRFIDEFNFPFLPTPMGKGVVPDEHE--------LNVSSARSYALAHAGIVLIMGARLN 274

Query: 320 DFNTGSFSYSYKTK---NVVEFHSDH----IKIRNATFPGVQM----KFVLQSLLNKVGA 368
                   Y+   K   N V    D     +   N    G+ +    ++ +++L N++ +
Sbjct: 275 WI----LHYAGPPKWNPNAVFIQCDSNGETLGQNNQYHAGLSLFGDIEYTVEALSNELRS 330

Query: 369 ------------------VVKDYKPVPVPELPAPNAAVDPSTPLKQQWLWNQVGQFLQEG 410
                             + K+ + +   E   P  +  P   L    ++  +   L++ 
Sbjct: 331 AGGGDYRYGGLSSSIQEKIHKNEQRLRDSEHAVPEESSPPHV-LNYNRVYGIIRPLLEQD 389

Query: 411 DIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKR-VIL 469
             VL   G +     +  FP +T   S++  G+     G  LG  MAA+    + R V+L
Sbjct: 390 RTVLVTEGANTMDKARVSFPAST-PFSRLDAGT-NATMGVGLGYAMAAKLSSGAARDVVL 447

Query: 470 FTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKG 502
             G+ +   +  E+ T+VR+ +   + ++NN G
Sbjct: 448 IQGDSAFGFSGMELETLVRFQVGVVVMIMNNSG 480

>Smik_5.87 Chr5 complement(124637..126319) [1683 bp, 560 aa] {ON}
           YEL020C (REAL)
          Length = 560

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 114/498 (22%), Positives = 201/498 (40%), Gaps = 50/498 (10%)

Query: 37  RYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGM 96
           +Y  E L++  + TVFG+ G   ++L D +   +G+++    NE  ASYAA AY  +   
Sbjct: 7   QYFAELLQRYGIDTVFGIVGIPIVQLADTMVS-KGIKFIPCRNEQAASYAASAYGYVNDK 65

Query: 97  -SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAK---QLLLHHTLGNGDFT 152
              L+   G G + +L GI  S +    +L I G  S     K   Q L   +L     +
Sbjct: 66  PGVLLIVGGPGLIHSLAGIYNSMSNRWPLLVIAGSSSHGDTHKGGFQELDQVSL----LS 121

Query: 153 VFHRMSANIS-ETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPA---S 208
            F + +  ++ +   MIT  A     ++ CI+ T       Y+ +P++F++   P     
Sbjct: 122 PFLKFTGKLAPDNIRMITQKA-----LNHCIQGT---AGVAYIDVPADFIEYEKPLEGNC 173

Query: 209 LLDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQ 268
            +   + + L PN    +   I  ++++I   K   IL            E ++LI+   
Sbjct: 174 HIGDELPVILTPNKCGPDPSRIKEVVQLILKNKENNILVVIGKGAVKNSHEVRRLINKFN 233

Query: 269 FPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSY 328
            P   TPM KG + +  P           S A  +A+++AD+VL +GA L+       S 
Sbjct: 234 IPFLPTPMAKGIVPDSSP--------LNVSSARSQALKTADIVLVLGARLNWILHFGASP 285

Query: 329 SYKTKNV-VEFHSDHIKI-RNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNA 386
            + ++++ ++F S+   +  N   PG  +       L+    + +  +  P  +    + 
Sbjct: 286 KWNSESIFIQFDSNPETLGDNNISPGADLSVWGDIGLSVTALMEEVVRQDPCWKYSGISQ 345

Query: 387 AVDP----------------STPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFP 430
           A+                   T L    ++  +   + +    L   G +   I +  FP
Sbjct: 346 AIQEKIQFNQTRLLKKERTGGTQLNYHQVYGTLRPLIDDYRTFLVTEGANTMDIARVSFP 405

Query: 431 NNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWN 490
            N     + L        G  LG  +A +       V+L  G+ +   +A EI T VR  
Sbjct: 406 TNAP--KRRLDAGTNATMGVGLGYALACKASHPELDVVLIQGDSAFGFSAMEIETAVRCQ 463

Query: 491 LKPYLFVLNNKG-YTIEK 507
           L   + V+NN G Y  EK
Sbjct: 464 LALVIVVMNNSGIYHGEK 481

>Kpol_1061.50 s1061 (141784..143499) [1716 bp, 571 aa] {ON}
           (141784..143499) [1716 nt, 572 aa]
          Length = 571

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 105/502 (20%), Positives = 202/502 (40%), Gaps = 64/502 (12%)

Query: 37  RYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGM 96
           +++ + L + D+ T+FG+ G   + L D  +    +R+    NE +ASYAA  Y  +   
Sbjct: 9   QHITDILLKYDIDTIFGIVGIPVVELADS-FIANNIRFISFRNEQSASYAASVYGYLNNK 67

Query: 97  -SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAK---QLLLHHTLGNGDFT 152
              L+T  G G + +L GI  S      ++ + G    + Q K   Q L H +L      
Sbjct: 68  PGILLTVGGPGLIHSLAGIYNSIENKWPLIVLTGSIESTDQYKHGFQELDHVSL------ 121

Query: 153 VFHRMSANISETTAMITDLATAPSEIDRC----IRTTYIRQRPV-YLGLPSNFVDQMVPA 207
             HR   +I+ T  +      +   IDRC    +R + +  + V ++ +P +     +  
Sbjct: 122 -LHR---HINFTAKL------SLENIDRCFYEAMRNSCLINKGVSFIEIPGDLFHSTIST 171

Query: 208 SLLDTPI---DLALKPNDQQAEEEVIST----LLEMIKDAKNPVILADACASRHDVKAET 260
            ++D  I    ++ K  + Q  +E+I+     LLE I   K   ++     +  D +  T
Sbjct: 172 DVIDKSIVHQPISKKLIEYQPTDELITKVSKFLLENINKNKKNCLVVIGDGAMDDSQKLT 231

Query: 261 KKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLS- 319
           K L      P   TPM +G +    P    + V +  S A+K    +A++VL +G  L+ 
Sbjct: 232 KFLTHF-NLPFITTPMARGIV----PDSSKLNVASARSLALK----NAEIVLLIGTKLNW 282

Query: 320 DFNTGSFSYSYKTKNVVEFHSDHIKIRNATFPGVQMKFV--LQSLLNKVGAVVKDYKPVP 377
             + GS S   +    ++  +    +      G++      +   L+K+   +  +    
Sbjct: 283 ILHFGSSSKWNENTLFIQIDNSPSNLGLNNSKGLEYSLFGNISVTLDKLSRSLIKFNKNK 342

Query: 378 VPELPAPNAAVD-----------------PSTPLKQQWLWNQVGQFLQEGDIVLTETGTS 420
                 P   +                   ++ L    ++  + + L + + ++   G +
Sbjct: 343 QWRYQGPTENIKIKIKENEINLKKKESNHSTSQLNYNEVYGSLRKILNDRETIIVMEGAN 402

Query: 421 AFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTA 480
              I +  F  + Y   ++  G++    G  LG  ++A+     K V+L  G+ +   + 
Sbjct: 403 TMDIARISFKTD-YPQHRLDCGNLA-TMGVGLGYAISAKLSRPDKTVVLIQGDSAFGFSG 460

Query: 481 QEISTMVRWNLKPYLFVLNNKG 502
            EI T VR  L   + V+NN G
Sbjct: 461 MEIETAVRNKLGLIIIVMNNSG 482

>Kwal_34.16116 s34 complement(208847..210508) [1662 bp, 553 aa] {ON}
           YEL020C - Hypothetical ORF [contig 268] FULL
          Length = 553

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 111/508 (21%), Positives = 189/508 (37%), Gaps = 73/508 (14%)

Query: 38  YVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGM- 96
           ++ + L    + TVFG+ G   + + D I     +R+ G  NE  ASYAA AY  + G  
Sbjct: 9   HISDLLASYGIDTVFGIVGIPIVEIADTIISKGKIRFYGFRNEQAASYAASAYGYLTGKP 68

Query: 97  SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTVFHR 156
             L+   G G + AL G+  S +    +L + G                L  G F    +
Sbjct: 69  GVLLVVGGPGLIHALAGVYNSISNKWPLLVLAGS------------SEDLNRGGFQALDQ 116

Query: 157 MSANISETTAMITDLATAPSEIDRCIRTTYIRQRPV------YLGLPSNFVDQMVPASLL 210
           + A +S      + L    S ++  +    +RQ  V      YL +P + ++Q V     
Sbjct: 117 I-AVLSRYVKFSSRLNN--SNVNEMLYNA-LRQSMVGTPGVSYLDIPGDLIEQSVEKEKY 172

Query: 211 DTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFP 270
           +   ++     + Q  ++ +  + ++I +     +L        D   E +K I+  Q P
Sbjct: 173 NCVRNIT--KVEYQPSKDALQRVADLITENSTKSLLCVIGKGATDSSMEVRKFIERFQLP 230

Query: 271 SFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSY 330
              TPM KG + + HP           S A   A+ SAD+VL +GA L+          +
Sbjct: 231 FLPTPMAKGVVPDSHP--------LNVSSARSLALRSADIVLVLGARLNWILHFGEPPKW 282

Query: 331 KTKNV---VEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAA 387
               +   V+  +D +   N+          L S    +GA ++   P     +      
Sbjct: 283 NQNAIFVQVDTSADELGFNNSA-------GTLYSSCGHIGATLQSLTP-----MLKKFKY 330

Query: 388 VDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPN----------NTYGIS 437
              S  + QQ   N+V    +E    LT      +   + H  +          NT  I+
Sbjct: 331 CGLSRSMLQQVEQNKVRLRAKETQKTLTLNYNQVYAAMREHMVDRNTFIVSEGANTMDIA 390

Query: 438 QV----------LWGSIGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMV 487
           +V          L        G  +G  +AA+     K V+   G+ +   +  E+ T  
Sbjct: 391 RVSFPTDYPKLRLDAGTNATMGVGIGYAIAAKLAHPEKSVVCIQGDSAFGFSGLELETAS 450

Query: 488 RWNLKPYLFVLNNKGYTIEKLIHGPTAE 515
           R+ L     V+NN G     + HG  +E
Sbjct: 451 RYQLGIVFVVMNNSG-----IYHGEDSE 473

>KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 551

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 117/514 (22%), Positives = 207/514 (40%), Gaps = 83/514 (16%)

Query: 38  YVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGM- 96
           Y+ E L    +T VFG+ G   + L D +     +++ G  NE  ASYAA AY  + G  
Sbjct: 7   YLSELLHGYGITAVFGIVGIPIVELADAMISHGKVKFYGFRNEQAASYAASAYGYLTGRP 66

Query: 97  SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTVFHR 156
             L+   G G + AL G+  S +    ++ + G    S +            G F    +
Sbjct: 67  GVLLVVGGPGVIHALAGVYNSISNKWPLIVLAGSSEDSNR------------GGFQELDQ 114

Query: 157 MSANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPS-NFVDQMVPASLLDTPID 215
           + A +S+     + L+   S +D+     Y   R   LG P  +++D  +PA+++D  ++
Sbjct: 115 I-ALLSKYVKYSSRLSN--SNVDQSF---YDALRQAVLGTPGVSYLD--IPANVIDQEVE 166

Query: 216 ------------LALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKL 263
                       ++ +P D  A  + ++ LL   +D KN + +    A+ +    + +  
Sbjct: 167 KNESFSRRHIAKISYQPTD--AALQRVAKLLNANRD-KNILCVIGKGATEN--AQQIRPF 221

Query: 264 IDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNT 323
           +D  Q P   TPM KG + + H     + V +  S A+K    SAD+VL +GA L+    
Sbjct: 222 VDEFQLPFLSTPMAKGVVPDSH----ALNVSSARSLALK----SADIVLVLGARLNWIL- 272

Query: 324 GSFSYSYKTKN---VVEFHSDHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKP----- 375
             F  + K KN    ++  +   ++ +    G      L SL   +G  V    P     
Sbjct: 273 -HFGEAPKWKNDAIFIQIDTTAEELGHNNGAG-----TLFSLCGDIGTTVAKLTPLLAGF 326

Query: 376 ------------VPVPELPAPNAAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFG 423
                       +   E        +PS  L    ++  + + + + D ++   G +   
Sbjct: 327 SGRGLFGSLETRIQQNEKRLRARENEPSPALTYNKVYATIRKQIVDKDTIIVSEGANTMD 386

Query: 424 INQTHFPNNTYGISQVLWGSIGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEI 483
           + +  FP +   +   +        G  LG  +AA+     K VI   G+ +   +  E+
Sbjct: 387 VARISFPTDYPKLR--MDAGTNATMGVGLGYAIAAKIAHPQKNVIAIQGDSAFGFSGMEL 444

Query: 484 STMVRWNLKPYLFVLNNKGYTIEKLIHG--PTAE 515
            T  R+ L   + V+NN G     + HG  P AE
Sbjct: 445 ETASRYKLGITVVVMNNSG-----IYHGEDPAAE 473

>Suva_5.68 Chr5 (108954..110639) [1686 bp, 561 aa] {ON} YEL020C
           (REAL)
          Length = 561

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 112/502 (22%), Positives = 206/502 (41%), Gaps = 62/502 (12%)

Query: 34  TLGRYVFERLKQVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARI 93
           T+ ++  + L++  + TVFG+ G   ++L D +    G+++    NE  ASYAA AY  +
Sbjct: 4   TVTQHFAQLLQKYGIDTVFGIVGIPIVQLADTMV-ANGVKFIPCRNEQAASYAASAYGYV 62

Query: 94  KGM-SCLITTFGVGELSALNGIAGSYAEHVGVLHIVGVPS---VSAQAKQLLLHHTLGNG 149
                 L+   G G + +L GI  S +    +L I G  S   V     Q L   +L   
Sbjct: 63  NDKPGVLLIVGGPGLIHSLAGIYNSMSNRWPLLVIAGSSSQNDVYKGGFQELDQISL--- 119

Query: 150 DFTVFHRMSANI-SETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQ----M 204
             + F + +  + S+   M+T  A     ++ CI+ T       Y+  P++ ++     +
Sbjct: 120 -LSPFLKFTGKLTSDNIDMVTRKA-----LNHCIQGTMGVS---YIDFPADLIENEKKSL 170

Query: 205 VPASLLDTPIDLALKPN----DQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAET 260
                L   + + L PN    D    EE++  +L+     KN +I+    A ++    E 
Sbjct: 171 AGNDHLVNELPMILTPNKCGPDPSKIEEIVQLILQ--NRDKNILIVIGKGAVKN--SHEI 226

Query: 261 KKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSD 320
           ++L+     P   TPM KG + +  P           S A  +A+++AD+VL +GA L+ 
Sbjct: 227 RRLVSSFNLPFLPTPMAKGIVPDSSP--------LNVSSARSQALKTADIVLVLGARLNW 278

Query: 321 FNTGSFSYSYKTKNV-VEFHSDHIKI-RNATFPGVQMK------FVLQSLLNKVGAVVKD 372
                 S  +  ++V ++F S    +  N T  G  +         + +L+ ++      
Sbjct: 279 ILQFGSSPRWNAESVFIQFDSHPETLGDNNTSAGAGLSVWGDIGLSVTALMEELARQRPR 338

Query: 373 YK----------PVPVPELPAPNAAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAF 422
           +K           + V E             L    ++  +   +++   +L   G +  
Sbjct: 339 WKYSGVNNALREKIHVNETRLQEKEKMGGAQLNYHQVYGVLRPLIEDYRTILVTEGANTM 398

Query: 423 GINQTHFPNNT--YGISQVLWGSIGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTA 480
            I +  FP +   + +      ++G   G  L +  +  ELD    V+L  G+ +   +A
Sbjct: 399 DIARVSFPTDAPRHRLDAGTNATMGIGLGYALASKASRPELD----VVLIQGDSAFGFSA 454

Query: 481 QEISTMVRWNLKPYLFVLNNKG 502
            EI T VR  L   + V+NN G
Sbjct: 455 MEIETAVRCQLALVIVVMNNSG 476

>KAFR0H02890 Chr8 complement(551945..553627) [1683 bp, 560 aa] {ON}
           Anc_1.450 YEL020C
          Length = 560

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 62/299 (20%), Positives = 126/299 (42%), Gaps = 33/299 (11%)

Query: 226 EEEVISTLLEMIKDAKN---PVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSID 282
           ++  +S +  +I DAK+    V++     S +   +E +  ID    P   TPM KG + 
Sbjct: 192 DQTTVSKISRLIVDAKSQDKKVLVVIGKGSVY-YSSEVRTFIDKFNLPFLPTPMAKGVVP 250

Query: 283 EKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYKTKNV-VEFHSD 341
           + H       +  +SS A   A+ +AD++L  GA L+     + S  +KT  + ++  +D
Sbjct: 251 DNH-------MCNVSS-ARSFALANADIILVFGARLNWILHYAESPKWKTSAIFIQCDND 302

Query: 342 HIKIRNATFPGVQMKFV------LQSLLNKVGAVVKDYKP-VPVPELPAP---------- 384
              + +     V +  +      + S+  ++     DYK   P  EL +           
Sbjct: 303 PETLGHNNMNHVNLSLLGDLDLTITSITEELVKKYPDYKHNTPSKELISKIESNRSKLQE 362

Query: 385 -NAAVDPSTPLKQQWLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGS 443
                D +  L    ++ ++   + +   +L   G +     +  F + ++ + ++  G+
Sbjct: 363 LEKPKDETAELNYNTVYGKISPLIDDESTMLIFEGANTMDKARISF-STSFPLRRLDAGT 421

Query: 444 IGYATGACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKG 502
            G   G  LG +MA+   + +   IL  G+ +   +  EI T+ R+ L   + ++NN G
Sbjct: 422 NG-TMGVGLGYLMASRLANPNLDNILIQGDSAFGFSGMEIETLCRFKLGSVIIIMNNSG 479

>NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {ON}
           Anc_1.450 YEL020C
          Length = 575

 Score = 38.1 bits (87), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 78/349 (22%), Positives = 125/349 (35%), Gaps = 64/349 (18%)

Query: 193 YLGLPSNFVDQ--MVPASLLDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILADAC 250
           Y+  P + +     VP    +  I  A+K +      + ++ LL    D    VI+    
Sbjct: 163 YIDFPEHLISNNVRVPNMKQNISIPRAIKSSADPLVTKEVAQLLRRNSDQNVLVIIGKGA 222

Query: 251 ASRHDVKAETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADL 310
               +        I   QFP   TPMGKG I +  P           S A   A+  +D+
Sbjct: 223 V---NYSKGLSAFIHKYQFPFLPTPMGKGIISDMDP--------LNVSSARSSALSKSDI 271

Query: 311 VLSVGALLSDFNTGSFSYSYKTKNVVEF---HSDHIKIRNATFPGVQMKFVLQSLLNKVG 367
           VL  GA L+      F    K K+ V+F    +D   I N       M+ +  SLL  +G
Sbjct: 272 VLVFGARLNWLL--HFGKPPKWKSTVKFILCDNDPHAIGNNN-----MQSINYSLLGDIG 324

Query: 368 AVVKD------------------------------YKPVPVPELPAPNAAVDPSTPLKQQ 397
            ++ +                              +K          N A+     L   
Sbjct: 325 LIINELTEELDRVENEWGRKYGVTKELRSEILKNQFKLQEKESRSNTNGAL-----LNYH 379

Query: 398 WLWNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMA 457
            ++  + + L   +  L   G +   I +  FP  +    Q L        G  LG  +A
Sbjct: 380 VVYRTLREMLDLKNTFLVTEGANTMDIARISFP--SLKPKQRLDAGTNATMGVGLGYGIA 437

Query: 458 A---EELDKSK-RVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKG 502
           A   ++  KSK  +++  G+ +   +A EI T VR+ L   + V+NN G
Sbjct: 438 ARLSQDYMKSKPDILVIQGDSAFGFSAIEIETAVRFKLGLIIIVINNSG 486

>CAGL0M03245g Chr13 complement(372122..373810) [1689 bp, 562 aa]
           {ON} similar to uniprot|P39994 Saccharomyces cerevisiae
           YEL020c
          Length = 562

 Score = 37.7 bits (86), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 113/284 (39%), Gaps = 36/284 (12%)

Query: 45  QVDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGM-SCLITTF 103
           Q DV  VFG+ G   +    E+  V G+R+ G  NE  ASYAA AY  + G    L+   
Sbjct: 18  QYDVDVVFGIVGIPVVEFAQELQSV-GIRFIGFRNEQAASYAASAYGYLTGKPGVLLVVG 76

Query: 104 GVGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTVFHRMS----- 158
           G G + AL G+  S      +L I G  SV    K          G F    ++S     
Sbjct: 77  GPGVIHALAGVYNSMNNRWPLLIIAG--SVPRDEKY--------QGGFQELDQVSLLKPY 126

Query: 159 -ANISETTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLL--DTPID 215
                E T    D     +  +   + T       Y+  P + +  +V A          
Sbjct: 127 LKFAGELTGTKKDANIVFNAWNSATQGT---PGVSYIDFPGDLITDVVEAIEFYKHETKR 183

Query: 216 LALKPNDQQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTP 275
           +   P+ +   E  +++L++  +D    V+L   C +        +  I+   FP   TP
Sbjct: 184 ITTGPDPRSIAE--VTSLIKEHQDKNILVVLGKGCINS---SLALRHFIEEFNFPFLPTP 238

Query: 276 MGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLS 319
           M KG + + H R          S A  +A++SADLVL  GA L+
Sbjct: 239 MAKGILPDSH-RLN-------VSAARSQALKSADLVLVFGARLN 274

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 33/74 (44%), Gaps = 7/74 (9%)

Query: 449 GACLGAVMAAEELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKL 508
           G  LG  +AA+       ++   G+ +   +  EI T VR+ L     ++NN G     +
Sbjct: 422 GVGLGYAIAAKVHSPELNIVTIQGDSAFGFSGMEIETAVRYRLGIIFIIMNNSG-----I 476

Query: 509 IHG--PTAEYNEIQ 520
            HG  P+   NE Q
Sbjct: 477 YHGSDPSTITNETQ 490

>Smik_10.129 Chr10 complement(203537..208846) [5310 bp, 1769 aa]
           {ON} YJL109C (REAL)
          Length = 1769

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 5/112 (4%)

Query: 201 VDQMVPASLLDTPIDLALKPNDQQAEEEVISTLLEMIKDAKNPVILA--DACASRHDVK- 257
           ++Q+VP  L  +   LA K  D Q     I  +       K P+ILA  +   S  D K 
Sbjct: 231 LNQLVPILLEISAKLLASKSKDCQIAAHTILVVFATALPLKKPIILAAMETILSNLDTKE 290

Query: 258 AETKKLIDITQFPSFVTPMGKGSIDEKHPRFGGVYVGTLSSPAVKEAVESAD 309
           A+   LI I +   F T  GKG++D+  P+   ++     + +V   ++  D
Sbjct: 291 AKHSALITICKL--FQTLRGKGNVDQLPPKIFKIFDSRFDTSSVLAFLDKED 340

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,032,128
Number of extensions: 2727452
Number of successful extensions: 7561
Number of sequences better than 10.0: 137
Number of HSP's gapped: 7486
Number of HSP's successfully gapped: 168
Length of query: 593
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 478
Effective length of database: 40,294,809
Effective search space: 19260918702
Effective search space used: 19260918702
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)