Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLTH0B01166gna 1ON57757724560.0
Kwal_33.15545na 1ON57657421680.0
SAKL0G14916gna 1ON58157818330.0
NDAI0I02660na 1ON59456217720.0
Kpol_358.3na 1ON57553517690.0
NCAS0D02260na 1ON59756517400.0
Suva_16.40na 1ON60653517190.0
Ecym_2480na 1ON58653717070.0
YPL265W (DIP5)na 1ON60853517050.0
Smik_6.473na 1ON60653516920.0
KLLA0E16281gna 1ON60553416890.0
Skud_16.12na 1ON60753516870.0
TPHA0M00130singletonON61158016710.0
CAGL0A01199gna 1ON61353616440.0
TBLA0A07060na 1ON62552716140.0
KAFR0B06430singletonON59353816100.0
ACL135Wna 1ON58853815810.0
KNAG0L02460singletonON58853515770.0
KNAG0L02470singletonON63849915550.0
YOR348C (PUT4)7.44ON6275228211e-101
Smik_15.5327.44ON6315348131e-100
Ecym_80357.44ON5634987973e-98
NDAI0A006101.83ON5655017963e-98
ZYRO0D17908gna 1ON5185327873e-97
NCAS0E022607.44ON5935027872e-96
Kwal_26.69407.44ON5705087852e-96
SAKL0C02662g1.83ON5485007822e-96
SAKL0B10956g7.44ON5725317843e-96
CAGL0E05632g7.44ON5985087863e-96
KLLA0C02343g1.83ON5815357828e-96
Smik_5.241.83ON5905027802e-95
CAGL0J08184g1.83ON5724947764e-95
Suva_5.41.83ON5905027767e-95
Skud_5.261.83ON5905027741e-94
TDEL0C061801.83ON5835027741e-94
SAKL0C02684gsingletonON5884857732e-94
Suva_8.4027.44ON6835337792e-94
Skud_15.5157.44ON6265227753e-94
Kpol_367.77.44ON5845357713e-94
TBLA0A054601.84ON6085487733e-94
Ecym_10871.83ON5705397703e-94
NDAI0E038007.44ON6215557735e-94
Ecym_10881.84ON5675027686e-94
TDEL0A08030singletonON5144477638e-94
YEL063C (CAN1)1.83ON5905027671e-93
CAGL0J08162g1.84ON5974957681e-93
Kpol_2000.641.84ON6105367682e-93
TDEL0H040707.44ON5775107643e-93
KNAG0F004801.84ON5974997653e-93
SAKL0C02640gsingletonON5485007613e-93
Kwal_23.4026singletonON5344917588e-93
Skud_14.711.84ON6124997594e-92
TDEL0C061701.84ON5734947556e-92
Skud_14.701.83ON5734947556e-92
TPHA0H028507.44ON6015527542e-91
KAFR0D039401.83ON5975077532e-91
TBLA0A054501.83ON6064887515e-91
Suva_14.751.84ON6114997507e-91
ZYRO0F16632g1.84ON6075017508e-91
ZYRO0F16654g1.83ON5805067461e-90
TPHA0B044801.83ON6035027481e-90
KLTH0F02398g1.83ON5555467442e-90
KLTH0D01474g7.44ON6245027492e-90
AFR156W7.44ON5585417442e-90
KNAG0C05920singletonON5994997462e-90
TPHA0B044701.84ON5995467463e-90
NCAS0A006101.84ON6075487463e-90
NCAS0A006001.83ON5445047413e-90
NDAI0F041901.84ON5994997444e-90
SAKL0C02728g1.84ON5624857415e-90
SAKL0F09790gsingletonON5585277397e-90
NCAS0B085701.83ON5324977379e-90
YNL268W (LYP1)1.84ON6115027431e-89
YNL270C (ALP1)1.83ON5734987391e-89
Smik_14.671.83ON5734987391e-89
Kwal_33.134011.83ON5595527353e-89
KNAG0E003907.44ON5995357383e-89
Smik_14.681.84ON6114957361e-88
KNAG0C007901.83ON5794957252e-87
KLLA0F23419g7.44ON5735067224e-87
Suva_14.731.83ON4974587149e-87
KLTH0F02420g1.84ON6215027203e-86
Kpol_2000.651.83ON5954847113e-85
AFR667C1.84ON5635297051e-84
Kwal_33.134111.84ON5605057014e-84
KAFR0D007001.83ON5745566963e-83
NDAI0F042001.83ON5665476937e-83
SAKL0F16544gsingletonON5675176929e-83
TBLA0C01240singletonON6295176942e-82
AFR668W1.83ON5564846831e-81
KLLA0C02365g1.84ON5795026842e-81
KLTH0F04048gsingletonON5835396772e-80
ZYRO0C18502g7.44ON5755036632e-78
TDEL0E05750singletonON5485356507e-77
Suva_13.517singletonON5474896491e-76
KAFR0C051607.44ON5845086493e-76
TDEL0D00200singletonON5674806457e-76
Smik_6.482na 2ON5584856431e-75
Skud_11.2751.244ON6024966415e-75
Kwal_8.590na 3ON6294866411e-74
KLLA0B14685gna 4ON5714656361e-74
Kwal_23.2817na 4ON5804976283e-73
KLTH0A00308gsingletonON5414896244e-73
ZYRO0D03762g1.244ON6004966232e-72
KLTH0B00154gna 3ON5564866167e-72
YKR039W (GAP1)1.244ON6024966172e-71
NDAI0D021605.158ON5874996135e-71
Smik_11.3021.244ON5534766105e-71
SAKL0D04664g1.244ON5935006066e-70
KLTH0E15642g1.244ON5964966058e-70
KLLA0A11770g5.158ON5815026021e-69
Kpol_543.791.244ON6054966023e-69
Ecym_47895.158ON5885506003e-69
TPHA0A047005.158ON5694935961e-68
TDEL0C00930singletonON5954975934e-68
YGR191W (HIP1)5.158ON6035455928e-68
YCL025C (AGP1)1.50ON6335045902e-67
Skud_16.2na 2ON4964535804e-67
SAKL0G14014g5.158ON6055015865e-67
NCAS0A071105.158ON5925445856e-67
KNAG0C02140singletonON5984975848e-67
TPHA0B010901.244ON6064965841e-66
KLLA0A06886gsingletonON5874965822e-66
Suva_11.2731.244ON6014965822e-66
NCAS0B079001.244ON6194965823e-66
KAFR0E018505.158ON5604635783e-66
Kwal_27.126811.244ON5934975803e-66
CAGL0K05753g1.50ON6605385843e-66
Skud_7.5255.158ON6034985787e-66
Ecym_60211.244ON6004975779e-66
NDAI0B052201.244ON6114965789e-66
ZYRO0F13838g8.342ON8365575881e-65
NDAI0A006401.50ON6415095781e-65
Suva_2.716singletonON6034985752e-65
KAFR0C004003.284ON5824995732e-65
Smik_16.1155.158ON6034625743e-65
Suva_3.1891.50ON6335045753e-65
NCAS0D018705.158ON5954625733e-65
CAGL0B03773g5.158ON6054995725e-65
NDAI0F043901.50ON6675515721e-64
NDAI0C029505.158ON6094665682e-64
Smik_3.531.50ON6334995683e-64
KAFR0D00510na 5ON6175025674e-64
CAGL0B01012g1.50ON6235055665e-64
Kwal_26.9612singletonON5435075615e-64
KAFR0D04130na 5ON6445085667e-64
Suva_7.4855.158ON6035085639e-64
Kpol_2000.921.50ON6375025641e-63
Kpol_1010.325.158ON5995015621e-63
KLLA0A06930g1.244ON5874965602e-63
KNAG0C005901.50ON6345085622e-63
KAFR0D005001.50ON6175015595e-63
Skud_3.381.50ON6334995605e-63
KNAG0F002701.50ON6345615597e-63
YBR068C (BAP2)3.284ON6094935578e-63
TPHA0A002405.158ON6034625561e-62
NDAI0G060301.368ON5995135561e-62
TPHA0E036601.50ON6474985581e-62
SAKL0D02970g3.284ON6015015551e-62
SAKL0D00836gna 6ON6015005542e-62
CAGL0L03267g1.244ON5974975542e-62
Kwal_33.132041.50ON6075045542e-62
KAFR0D04120na 7ON6485075563e-62
SAKL0C01232gsingletonON6134995534e-62
KNAG0G009005.158ON6135365524e-62
AGR319W5.158ON6265065518e-62
AAR038W3.397ON5664915471e-61
Ecym_26643.285ON5755055462e-61
KAFR0D041401.50ON6375045473e-61
KLTH0B02046g5.158ON5895035443e-61
Kpol_526.103.397ON5805015435e-61
TBLA0A051801.50ON6765485461e-60
Skud_2.2603.397ON5984885411e-60
TBLA0I020103.285ON6285045422e-60
TBLA0A05190na 7ON6675615432e-60
YBR132C (AGP2)3.397ON5964885392e-60
AFR698C1.50ON6095075402e-60
YFL055W (AGP3)na 8ON5584675363e-60
Kpol_543.78singletonON6054965393e-60
Smik_2.2723.397ON5974885374e-60
TDEL0F046608.342ON8405545484e-60
Kwal_33.14276na 6ON5965005374e-60
KAFR0A011203.284ON5924925366e-60
Smik_13.1singletonON5234865317e-60
Suva_4.3813.397ON5904895359e-60
TDEL0F02830na 9ON5614995321e-59
Suva_4.3073.284ON6094935351e-59
NCAS0I015303.284ON5955015331e-59
ZYRO0C17182g3.397ON5785005312e-59
Kpol_1065.133.284ON5965025323e-59
YDR508C (GNP1)1.50ON6635085353e-59
TDEL0E05700singletonON5845035304e-59
SAKL0D02948gna 10ON5945025304e-59
KLLA0F27093gsingletonON5634675284e-59
NCAS0A089201.368ON5995195304e-59
SAKL0D02926g3.285ON5835015294e-59
TPHA0B047501.50ON6395025316e-59
Smik_2.2013.284ON6094935297e-59
KNAG0B012703.397ON5924545287e-59
Skud_2.1913.284ON6095475297e-59
KNAG0H011503.284ON6174905307e-59
Suva_16.18na 11ON5835455278e-59
KNAG0J022003.284ON6074915289e-59
AGR040C3.285ON5735005269e-59
Suva_2.6881.50ON6615015301e-58
Smik_12.2na 12ON5835345261e-58
TDEL0C053403.397ON5754895242e-58
Kwal_33.154075.158ON5875015252e-58
Ecym_10561.50ON6065145253e-58
AEL030W1.368ON5825545234e-58
Skud_4.7841.50ON6635015274e-58
KLLA0D16830g8.342ON8325595334e-58
KLTH0F01584g1.50ON5964995235e-58
SAKL0C13992gsingletonON5524905205e-58
Smik_4.7901.50ON6635085266e-58
Skud_6.2na 8ON5584865206e-58
YLL061W (MMP1)na 12ON5835405217e-58
AFR230C1.244ON6045015227e-58
KLTH0F01606gna 7ON6045065227e-58
TBLA0B077605.158ON6584625249e-58
KLLA0C01606g1.50ON6205075211e-57
SAKL0C01650g1.50ON6134995211e-57
SAKL0H15092g8.342ON8505615301e-57
KAFR0D00520na 7ON5985015182e-57
NDAI0A074903.284ON5964935164e-57
KNAG0A050408.342ON8345585265e-57
Skud_2.1923.285ON6195005165e-57
Kpol_1052.163.284ON6135005166e-57
SAKL0B08734g3.397ON5584935136e-57
AER405Cna 11ON4974725071e-56
TDEL0C065101.50ON6425085151e-56
ZYRO0A00308gsingletonON5644865083e-56
KNAG0L00110na 8ON5714905083e-56
Ecym_8297na 13ON5695045067e-56
NCAS0J00140na 8ON5584895041e-55
Kwal_33.13215na 7ON5985065061e-55
KLTH0F11286g3.397ON5824425042e-55
AGR039Cna 10ON5865005042e-55
Kpol_534.221.368ON5925125042e-55
NCAS0A106803.284ON5934925042e-55
KNAG0J022103.285ON5814905032e-55
KLLA0A10813g1.368ON5844585014e-55
Ecym_34303.397ON5594994987e-55
Kpol_2002.441.50ON6275165028e-55
CAGL0C00539g3.397ON5935105008e-55
Skud_4.3003.284ON6044925008e-55
KLTH0G11726g8.342ON8245555089e-55
Kwal_23.38473.397ON5794634981e-54
KAFR0F02250singletonON5544954961e-54
Sklu_YGOB_Anc_1.3681.368ON5414174951e-54
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLTH0B01166g
         (577 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   950   0.0  
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   839   0.0  
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   710   0.0  
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   687   0.0  
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   686   0.0  
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              674   0.0  
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   666   0.0  
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   662   0.0  
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   661   0.0  
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   656   0.0  
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   655   0.0  
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   654   0.0  
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     648   0.0  
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   637   0.0  
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   626   0.0  
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   624   0.0  
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   613   0.0  
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             612   0.0  
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             603   0.0  
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   320   e-101
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   317   e-100
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   311   3e-98
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   311   3e-98
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   307   3e-97
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     307   2e-96
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   306   2e-96
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   305   2e-96
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   306   3e-96
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   307   3e-96
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   305   8e-96
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   305   2e-95
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   303   4e-95
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   303   7e-95
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   302   1e-94
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   302   1e-94
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   302   2e-94
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   304   2e-94
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   303   3e-94
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   301   3e-94
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   302   3e-94
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   301   3e-94
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     302   5e-94
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   300   6e-94
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            298   8e-94
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   300   1e-93
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   300   1e-93
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   300   2e-93
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   298   3e-93
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                299   3e-93
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   297   3e-93
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   296   8e-93
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   296   4e-92
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   295   6e-92
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   295   6e-92
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   295   2e-91
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   294   2e-91
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   293   5e-91
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   293   7e-91
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   293   8e-91
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   291   1e-90
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   292   1e-90
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   291   2e-90
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   293   2e-90
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   291   2e-90
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            291   2e-90
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   291   3e-90
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              291   3e-90
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   290   3e-90
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   291   4e-90
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   290   5e-90
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   289   7e-90
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            288   9e-90
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   290   1e-89
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   289   1e-89
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   289   1e-89
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   287   3e-89
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   288   3e-89
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   288   1e-88
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              283   2e-87
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   282   4e-87
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   279   9e-87
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   281   3e-86
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   278   3e-85
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   276   1e-84
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   274   4e-84
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   272   3e-83
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            271   7e-83
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   271   9e-83
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   271   2e-82
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   267   1e-81
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   268   2e-81
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   265   2e-80
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   259   2e-78
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            254   7e-77
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   254   1e-76
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   254   3e-76
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                253   7e-76
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   252   1e-75
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   251   5e-75
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   251   1e-74
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   249   1e-74
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   246   3e-73
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   244   4e-73
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   244   2e-72
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   241   7e-72
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   242   2e-71
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    240   5e-71
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   239   5e-71
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   238   6e-70
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   237   8e-70
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   236   1e-69
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   236   3e-69
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   235   3e-69
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   234   1e-68
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   233   4e-68
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   232   8e-68
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   231   2e-67
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   228   4e-67
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   230   5e-67
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   229   6e-67
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   229   8e-67
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   229   1e-66
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   228   2e-66
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   228   2e-66
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   228   3e-66
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   227   3e-66
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   228   3e-66
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   229   3e-66
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   227   7e-66
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   226   9e-66
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   227   9e-66
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   231   1e-65
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   227   1e-65
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   226   2e-65
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                225   2e-65
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   225   3e-65
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   226   3e-65
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   225   3e-65
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   224   5e-65
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   224   1e-64
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    223   2e-64
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   223   3e-64
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      223   4e-64
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   222   5e-64
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   220   5e-64
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              222   7e-64
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   221   9e-64
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   221   1e-63
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   221   1e-63
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   220   2e-63
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   221   2e-63
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      219   5e-63
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   220   5e-63
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   219   7e-63
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   219   8e-63
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   218   1e-62
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   218   1e-62
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   219   1e-62
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   218   1e-62
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   218   2e-62
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   218   2e-62
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   218   2e-62
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   218   3e-62
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   217   4e-62
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   217   4e-62
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   216   8e-62
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   215   1e-61
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   214   2e-61
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              215   3e-61
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   214   3e-61
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   213   5e-61
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   214   1e-60
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   213   1e-60
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   213   2e-60
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   213   2e-60
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   212   2e-60
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   212   2e-60
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   211   3e-60
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   212   3e-60
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   211   4e-60
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   215   4e-60
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   211   4e-60
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   211   6e-60
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    209   7e-60
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   210   9e-60
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   209   1e-59
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   210   1e-59
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              209   1e-59
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   209   2e-59
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   209   3e-59
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   210   3e-59
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   208   4e-59
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   208   4e-59
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   207   4e-59
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   208   4e-59
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   208   4e-59
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   209   6e-59
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   208   7e-59
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   207   7e-59
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   208   7e-59
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              208   7e-59
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   207   8e-59
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   207   9e-59
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   207   9e-59
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   208   1e-58
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    207   1e-58
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   206   2e-58
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   206   2e-58
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   206   3e-58
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   206   4e-58
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   207   4e-58
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   209   4e-58
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   206   5e-58
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   204   5e-58
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   207   6e-58
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      204   6e-58
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   205   7e-58
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   205   7e-58
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   205   7e-58
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   206   9e-58
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   205   1e-57
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   205   1e-57
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   208   1e-57
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   204   2e-57
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   203   4e-57
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   207   5e-57
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   203   5e-57
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   203   6e-57
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   202   6e-57
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   199   1e-56
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   202   1e-56
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   200   3e-56
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   200   3e-56
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   199   7e-56
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      198   1e-55
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   199   1e-55
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   198   2e-55
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   198   2e-55
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   198   2e-55
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   198   2e-55
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   198   2e-55
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   197   4e-55
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   196   7e-55
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   197   8e-55
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   197   8e-55
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   197   8e-55
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   200   9e-55
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   196   1e-54
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              195   1e-54
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   195   1e-54
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              195   2e-54
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   195   2e-54
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   196   2e-54
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   195   2e-54
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   196   2e-54
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   196   2e-54
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   195   2e-54
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   194   3e-54
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   195   3e-54
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   196   4e-54
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   195   4e-54
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   194   4e-54
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   195   5e-54
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   194   5e-54
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   195   6e-54
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   198   6e-54
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   195   6e-54
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   194   8e-54
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   194   8e-54
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            193   9e-54
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   194   9e-54
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   194   1e-53
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   193   2e-53
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   192   3e-53
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   191   4e-53
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   192   4e-53
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   192   4e-53
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   191   5e-53
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   191   6e-53
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   191   9e-53
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   194   1e-52
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   194   1e-52
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   188   1e-52
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   188   2e-52
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   189   3e-52
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   189   4e-52
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   189   4e-52
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   188   9e-52
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   188   9e-52
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              189   1e-51
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   187   3e-51
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   188   3e-51
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   190   4e-51
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   186   4e-51
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   186   5e-51
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   185   5e-51
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   187   5e-51
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   189   8e-51
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   189   9e-51
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   188   1e-50
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   186   1e-50
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   184   3e-50
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   184   3e-50
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   184   4e-50
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   183   5e-50
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   186   5e-50
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   184   5e-50
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   184   5e-50
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                181   2e-49
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   181   2e-49
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   181   4e-49
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   180   4e-49
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   180   5e-49
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              180   1e-48
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   182   1e-48
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   177   1e-47
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   175   4e-47
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              174   6e-47
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   174   8e-47
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                174   2e-46
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   175   4e-46
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   172   6e-46
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   173   2e-45
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   172   5e-45
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   168   2e-44
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   171   2e-44
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   168   2e-44
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      166   7e-44
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   166   9e-44
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   162   2e-42
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   160   5e-42
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   157   4e-41
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              155   8e-40
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     149   1e-39
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     149   2e-39
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   151   8e-39
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   152   1e-38
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         101   9e-23
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...    96   8e-22
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      91   1e-19
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          88   3e-19
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     91   3e-19
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      65   4e-12
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          60   1e-09
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    55   2e-08
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      51   8e-07
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    48   2e-05
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              36   0.11 
TPHA0A04703 Chr1 (1067266..1067586) [321 bp, 106 aa] {ON}              32   0.75 
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    31   9.3  

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  950 bits (2456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/577 (83%), Positives = 481/577 (83%)

Query: 1   MSESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHV 60
           MSESLEKKNAGILYSNETLEEDVAFDKLER           VDGKHEGIRLKKALEARHV
Sbjct: 1   MSESLEKKNAGILYSNETLEEDVAFDKLERGASGASAAGASVDGKHEGIRLKKALEARHV 60

Query: 61  SMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFT 120
           SM                       PASILISYSFVGLLVYTVMACLGEMAAFIPLDGFT
Sbjct: 61  SMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFT 120

Query: 121 SYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLI 180
           SYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLI
Sbjct: 121 SYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLI 180

Query: 181 VLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKP 240
           VLINTVGVRFFGEFEFWLSSVK                   PNHDRTGFRYWRDPGAFKP
Sbjct: 181 VLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRYWRDPGAFKP 240

Query: 241 YSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLF 300
           YSEAISGSKGK              YTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLF
Sbjct: 241 YSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLF 300

Query: 301 YVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFS 360
           YVISILLLGMTVAYNDPLLI            PFVVAIKNAGIPVLPHIFNACVLLFVFS
Sbjct: 301 YVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIPVLPHIFNACVLLFVFS 360

Query: 361 ACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQI 420
           ACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQI
Sbjct: 361 ACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQI 420

Query: 421 FNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCL 480
           FNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCL
Sbjct: 421 FNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCL 480

Query: 481 IGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPEDVDLYTFKAAI 540
           IGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPEDVDLYTFKAAI
Sbjct: 481 IGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPEDVDLYTFKAAI 540

Query: 541 DAXXXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWIF 577
           DA                 SSPKNLTWFYDTFLGWIF
Sbjct: 541 DAEEEEGKLLELERKEQLKSSPKNLTWFYDTFLGWIF 577

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  839 bits (2168), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/574 (73%), Positives = 450/574 (78%), Gaps = 3/574 (0%)

Query: 4   SLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSMX 63
           S+EKKNAG+LYSNETLEE +   + E            VDGKHEGIRLKK LEARHVSM 
Sbjct: 6   SMEKKNAGVLYSNETLEEGIVTLESE---GQVRSVSEGVDGKHEGIRLKKELEARHVSMI 62

Query: 64  XXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFTSYA 123
                                 P SILISYSFVGLLVYTVM+CLGEMAAFIPLDGFTSYA
Sbjct: 63  AIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTSYA 122

Query: 124 SRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLI 183
           SRYVDPA+GFAVGY YLFKYFIVTPNQLTAGAMVMQ+WVSR++VNPGVWITIFL LIVLI
Sbjct: 123 SRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLI 182

Query: 184 NTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSE 243
           NTVGVRFFGEFEFWLSSVK                   PNHDRTGFR+WRDPGAFKPYSE
Sbjct: 183 NTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSE 242

Query: 244 AISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVI 303
           AISGSKGK              YTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIV+FYVI
Sbjct: 243 AISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVI 302

Query: 304 SILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACN 363
           +ILLLGMTVAYNDP L+            PFVVAI+NA IPVLPHIFN CVL+FVFSACN
Sbjct: 303 TILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACN 362

Query: 364 SDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNY 423
           SDLYVASR+LYGLAID KAP+IFA TN WGVPYYSL +SVLFCLLAYMNVSSGSAQ+FNY
Sbjct: 363 SDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNY 422

Query: 424 FVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGL 483
           FVNVVSIFGLLSWI+ILITY+RF KA+  QFGDKS  SYTA FQPWST+V+LFFCCLIGL
Sbjct: 423 FVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGL 482

Query: 484 IKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPEDVDLYTFKAAIDAX 543
           IKNYTVFLGH FDYKTFISGYIGIPVY ICYVGYK+V+R+KLIKPEDVDLYTFK AIDA 
Sbjct: 483 IKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAIDAE 542

Query: 544 XXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWIF 577
                           +SPKN  WFY+TFLGWIF
Sbjct: 543 EEEYKLLEKERLENMENSPKNFKWFYETFLGWIF 576

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/578 (62%), Positives = 412/578 (71%), Gaps = 1/578 (0%)

Query: 1   MSESLEKKNAGILYSNETLEEDVA-FDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARH 59
           + +S  K    I+ ++ T  +DV   D   +           +DGKH+GIRLKK LEARH
Sbjct: 4   IQDSYRKDLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARH 63

Query: 60  VSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGF 119
           VSM                       P SILI+YSFVG LVY VM CLGEMA +IPLDGF
Sbjct: 64  VSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGF 123

Query: 120 TSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVL 179
           TSYASRY DPALGFAVGY YLFKY I+TPNQLTA A+V+QYWVSREKVNPGVWITIFLV+
Sbjct: 124 TSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVI 183

Query: 180 IVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFK 239
           IV IN VGV+FFGEFEFWLSS K                   P+HDR GFR+++DPGAF+
Sbjct: 184 IVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFR 243

Query: 240 PYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVL 299
           PYSEAISGSKGK              Y GTELCGIVAAE KNPRR+VPRAIKLTLYRIV+
Sbjct: 244 PYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVV 303

Query: 300 FYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVF 359
           FY+++I LLGMTVAYNDPLL+            PFVVAIKNAGIPVLPHIFNACVL+FVF
Sbjct: 304 FYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFVF 363

Query: 360 SACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQ 419
           SACNSDLYVASR+LYGLAID KAPKIFAKTN WGVPY SL + +LFCLLAYMNVSSGSAQ
Sbjct: 364 SACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQ 423

Query: 420 IFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCC 479
           +FNYFVNVVSIFGL+SWI+ILITY+ F +A+ AQ  DKS  +Y AP      + +LFFCC
Sbjct: 424 VFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCC 483

Query: 480 LIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPEDVDLYTFKAA 539
           LI LIKN+TVFLGH FDYK FI+GYIGIPV+ IC+ GYK +  +K +KPE+ DLYTFK  
Sbjct: 484 LIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKEL 543

Query: 540 IDAXXXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWIF 577
           ID                  SSPKN  WFY+ FLGWIF
Sbjct: 544 IDLEEEEGKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/562 (61%), Positives = 394/562 (70%), Gaps = 4/562 (0%)

Query: 20  EEDVAFDKLERXXXXXXXXXXX----VDGKHEGIRLKKALEARHVSMXXXXXXXXXXXXX 75
           EE++  D LER               +DGK EG RLKKAL+ARHVSM             
Sbjct: 33  EEELINDDLERNISSASSQDENDSYNIDGKTEGTRLKKALKARHVSMIAIGGSLGTGLLI 92

Query: 76  XXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFTSYASRYVDPALGFAV 135
                     P S LI+Y+FVGLLV+  MACLGEMA +IPLDGFTSYASRY DPALGFAV
Sbjct: 93  GTGTSLALAGPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYASRYCDPALGFAV 152

Query: 136 GYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFE 195
           GY YLFKYFI+ PNQLTA A+V+QYWV +EKVNPGVW+TIFLV+IV IN  GVRFFGEFE
Sbjct: 153 GYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFE 212

Query: 196 FWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXX 255
           FWLSS K                   P+HDR GFRYWR PG+FK YSE I+G  G+    
Sbjct: 213 FWLSSFKVLVMLGLMLLLFILMLGGGPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAF 272

Query: 256 XXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYN 315
                     Y G EL GIVAAEA+NPR+S+P+AIKLT+YRIV+FY+ISI LLGM VAY+
Sbjct: 273 VSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYD 332

Query: 316 DPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYG 375
           DPLLI            PFVVAI N+GI  LPHI NACVL+FVFSACNSDLYV+SR+LY 
Sbjct: 333 DPLLIKAKNSSTSAAASPFVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYS 392

Query: 376 LAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLS 435
           LAID KAPKIFAKTN WG+PYY+L+VSVLFCLLAYM VSS SA+IFNYFVNVVSIFG+LS
Sbjct: 393 LAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILS 452

Query: 436 WISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTF 495
           WISILITY+ F +AV AQ  DKS F+Y APFQP+  W SLFFCCLI LIKN+TVFL H F
Sbjct: 453 WISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQF 512

Query: 496 DYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPEDVDLYTFKAAIDAXXXXXXXXXXXXX 555
           DYK FI+GYIG+PV+  CY GYK  +++K+I P  VDLYTFKAAID              
Sbjct: 513 DYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEEDGKMADAEKA 572

Query: 556 XXXXSSPKNLTWFYDTFLGWIF 577
                + KN  WFYD FLG IF
Sbjct: 573 ERIKQNGKNFEWFYDKFLGNIF 594

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/535 (62%), Positives = 400/535 (74%), Gaps = 1/535 (0%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           DGK +G+RLKK L+ARH+SM                       PASILI+YSFVG+LV+ 
Sbjct: 42  DGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVFF 101

Query: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
           VMACLGEMA +IPLDGFTSYA+RY DPALGFAVGYCYLFKYFI+TPNQLTAGA+V+QYW+
Sbjct: 102 VMACLGEMATYIPLDGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWI 161

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
            RE VNPGVWITIFLV+IV+INTVGVR+FGEFEFWLSS K                   P
Sbjct: 162 DRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGP 221

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
           NHDR GFRYW++PGAFKPYSE+I+GSKGK              Y G EL GIVAAEA+NP
Sbjct: 222 NHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENP 281

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           RR++PRAIKLT+YRI+LFY+++I LLGM VAYNDP L+            PFVVAI+N+G
Sbjct: 282 RRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSG 341

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
           +  LPHIFN CVL+FVFSACNSDLYV +R+LY LAID KAPK+FAKTN WGVPY +L   
Sbjct: 342 VRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGC 401

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
            LFCLLAYMNVSSGSAQIFNYFVNVVSIFG+LSWISILITY+ F++A IAQ  D++ F+Y
Sbjct: 402 FLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAY 461

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            APFQP+  +++LFFC LI  IKN+TVF+G  FDYK+FI+GYIG+P+Y I Y GYK++++
Sbjct: 462 RAPFQPYGAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIYK 520

Query: 523 SKLIKPEDVDLYTFKAAIDAXXXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWIF 577
           +KL+K E+ DLY+FK AID                  +S K+L WFY+ +LG+IF
Sbjct: 521 TKLVKAEEADLYSFKEAIDREEAEGKIKEAEAKERLKNSKKSLKWFYEKYLGYIF 575

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/565 (60%), Positives = 396/565 (70%), Gaps = 5/565 (0%)

Query: 18  TLEEDVAFDKLERXXXXXXXXXXX-----VDGKHEGIRLKKALEARHVSMXXXXXXXXXX 72
           T E ++  D LE                 VDGK EG RLKK LE R VSM          
Sbjct: 33  TQERELLHDDLENNISLSTSAEDQNDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTG 92

Query: 73  XXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFTSYASRYVDPALG 132
                        P S+LI+Y+FVGLLV+  MA LGEMA++IPLDGFTSYA+RY DPALG
Sbjct: 93  LLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMASLGEMASYIPLDGFTSYATRYADPALG 152

Query: 133 FAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFG 192
           FAVGYCYLFKYFI+ PNQLTA A+V+QYW+ REKVNPGVWITIFLV+IV INT+GV+FFG
Sbjct: 153 FAVGYCYLFKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFG 212

Query: 193 EFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKX 252
           EFEFWLSS K                   PNHDR GFR+W+ PGAF  YS AI+G  GK 
Sbjct: 213 EFEFWLSSFKVLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDTGKF 272

Query: 253 XXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTV 312
                        Y GTEL GIV  EA+NPR+SVP+AIKLT+YRI++FY+ISILLLGM V
Sbjct: 273 VAFVSVFVYATFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCV 332

Query: 313 AYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRT 372
            Y+DPLL+            PFVVAI N+GI VLPHIFNACVL+FVFSACNSDLYVASR+
Sbjct: 333 GYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRS 392

Query: 373 LYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFG 432
           LY LAID KAPKIFA+TN WG+PYYSL +SVLFCLLAYM+VSSGSA+IFNYFVNVVSIFG
Sbjct: 393 LYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFG 452

Query: 433 LLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLG 492
           LLSWI IL+TYL F +AV AQ  DKS FSY AP Q +  + +LFFC LI LIKN+TVFLG
Sbjct: 453 LLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLG 512

Query: 493 HTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPEDVDLYTFKAAIDAXXXXXXXXXX 552
           H FDYKTFI+GYIGIPV+ I Y GYKL++++K+I P +VDLYTFKAAID           
Sbjct: 513 HQFDYKTFITGYIGIPVFFISYFGYKLIYKTKIIDPLEVDLYTFKAAIDQEEEDGKLEDI 572

Query: 553 XXXXXXXSSPKNLTWFYDTFLGWIF 577
                  ++ +N  WFYD FL  IF
Sbjct: 573 ARKERIKANGRNFEWFYDKFLSNIF 597

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/535 (61%), Positives = 387/535 (72%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           DGK E  RL+K L+ARH+SM                       P S+LI+Y FVGLLV+ 
Sbjct: 72  DGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFF 131

Query: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
            MACLGEMA++IPLDGFTSYASRYVDPALGFA+GY YLFKYFI+ PNQLTA A+V+QYWV
Sbjct: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWV 191

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
           SR++VNPGVWITIFLV+IV IN VGVRFFGEFEFWLSS K                   P
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
           +HDR GFRYWRDPGAFK YS AI+GSKGK              YTG EL GIV +EAKNP
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNP 311

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           R+SVP+AIKLT+YRI++FY+ ++ LLGM VAYNDP L+            PFVVAI+N+G
Sbjct: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSG 371

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
           I VLPHIFN CVL+FVFSACNSDLYV+SR LY LAID KAPKIFAKT+ WGVPYY+L VS
Sbjct: 372 IKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVS 431

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
           VLFC LAYMNVS+GSA+IFNYFVNVVS+FG+LSWI+ILI Y+ F +A  AQ  DKS F+Y
Sbjct: 432 VLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAY 491

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            AP Q +  + +LFFC LI LIKN+TVFLGHTFDYKTFI+GYIG+P+Y   +VGYKL+++
Sbjct: 492 VAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYK 551

Query: 523 SKLIKPEDVDLYTFKAAIDAXXXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWIF 577
           +K++KP D DLYT K   D                   + KNL WFY+ FLG IF
Sbjct: 552 TKVVKPADADLYTLKEIYDREEEQGKLQDQEKEERLQRNGKNLEWFYEKFLGNIF 606

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/537 (61%), Positives = 383/537 (71%), Gaps = 2/537 (0%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           DGKH+GIRLKK L+ARHVSM                       P +ILI+YS +G +V+T
Sbjct: 50  DGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFT 109

Query: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
           VM+CLGEMAA+IPLDGFTSYA+RY DPALGFAVGY YLFKY ++TPNQLTA A+VMQYWV
Sbjct: 110 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
            R KVNPGVWIT+FL +I+ IN VGV+FFGEFEFWLSS K                   P
Sbjct: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGP 229

Query: 223 NHDRTGFRYWRDPGAFKPYSEAIS--GSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAK 280
           +H+R GFRYW+DPG FKPYS A+S  G KGK              Y GTELCGIVAAE K
Sbjct: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289

Query: 281 NPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKN 340
           NPRR+VPRAIKLTLYRIV+FY+ ++ LLG++VAYNDPLL+            P+VVAIKN
Sbjct: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKN 349

Query: 341 AGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLA 400
           AGIPVLPHIFNACVL FVFSACNSDLYV SR+LYGLAID+KAPKIFAKTN WGVPY SLA
Sbjct: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409

Query: 401 VSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGF 460
           +  LFC LAYMNVSS +  +F+YFVNV SIFGLLSWISILITY+ F +A   Q  DK+  
Sbjct: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469

Query: 461 SYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLV 520
           SY APFQP + W++L FC ++ L+KN+TVFLG TFDYKTFI+GYIGIPVY +C+V YK+V
Sbjct: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529

Query: 521 HRSKLIKPEDVDLYTFKAAIDAXXXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWIF 577
           H++K IK  +VDL+T+K AID                          FYD   GWIF
Sbjct: 530 HKTKWIKSANVDLFTYKTAIDLEEEEGKLEMMRLKEERKQHGWTWKQFYDYIFGWIF 586

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/535 (61%), Positives = 388/535 (72%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           DGK E  RL+K L+ARH+SM                       P ++LI+Y+FVGLLV+ 
Sbjct: 74  DGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFY 133

Query: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
            MACLGEMA++IPLDGFTSYASRYVDPALGFA+GY YLFKYFI+ PNQLTA A+V+QYW+
Sbjct: 134 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 193

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
           SR++VNPGVWITIFLV+IV IN VGV+FFGEFEFWLSS K                   P
Sbjct: 194 SRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 253

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
           NHDR GFRYWRDPGAFK YS AI+G KGK              YTG EL GIV +EA+NP
Sbjct: 254 NHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENP 313

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           R+SVP+AIKLT+YRI++FY+ ++ LLGM VAYNDP L+            PFVVAI+N+G
Sbjct: 314 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 373

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
           I VLPHIFNACVL+FVFSACNSDLYV+SR LY LAID KAPKIFAKT+ WGVPY +L +S
Sbjct: 374 IEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILS 433

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
           VLFC LAYMNVSSGSA+IFNYFVNVVS+FG+LSWI+ILI Y+ F KA  AQ  DKS F+Y
Sbjct: 434 VLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 493

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            AP Q +  + +LFFC LI LIKN+TVFLGH FDYKTFI+GYIG+PVY I + GYKL+++
Sbjct: 494 VAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYK 553

Query: 523 SKLIKPEDVDLYTFKAAIDAXXXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWIF 577
           +K+IK  DVDLYTFK   D                  S+ KN+ WFY+ FLG IF
Sbjct: 554 TKVIKSTDVDLYTFKEIYDREEEEGRMKDQEKEERLKSNGKNMEWFYEKFLGNIF 608

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/535 (60%), Positives = 386/535 (72%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           DGK E  RLKK L+ARH+SM                       P ++LI+Y+FVGLLV+ 
Sbjct: 72  DGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFF 131

Query: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
            MACLGEMA++IPLDGFTSYASRYVDPALGFA+GY YLFKYFI+ PNQLTA A+V+QYW+
Sbjct: 132 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWI 191

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
           SR++VNPGVWITIFLV+IV IN VGV+FFGEFEFWLSS K                   P
Sbjct: 192 SRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGP 251

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
           +HDR GFRYWRDPGAFK YS AI+GS GK              YTG EL GIV +EA+NP
Sbjct: 252 DHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENP 311

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           R+SVP+AIKLT+YRI++FY+ ++ LLGM VAYNDP L+            PFVVAI+N+G
Sbjct: 312 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSG 371

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
           I VLPHIFNACVL+FVFSACNSDLYV+SR LY LAID KAPKIFAKT+ WGVPY +L +S
Sbjct: 372 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILS 431

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
           VLFC LAYMNVSSGSA+IFNYFVNVVS+FG+LSWI+ILI Y+ F KA  AQ  DKS F+Y
Sbjct: 432 VLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 491

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            AP Q +  + +L FC LI LIKN+TVFLGH FDYKTFI+GYIG+PVY + + GYKL+++
Sbjct: 492 VAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYK 551

Query: 523 SKLIKPEDVDLYTFKAAIDAXXXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWIF 577
           +K+IK  DVDLYTFK   D                   + KN+ WFY+ FLG IF
Sbjct: 552 TKVIKSTDVDLYTFKEIYDREEEEGRIKDQEREERLQRNGKNMEWFYEKFLGRIF 606

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/534 (60%), Positives = 385/534 (72%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           DGKH+GIRLKKALEARHVSM                       PA+ILI+Y+FVGLLV+ 
Sbjct: 71  DGKHDGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFF 130

Query: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
           VM+CLGEMAA+IPLDGFTSY++RY DPALGFAVGY YLFKY+I+ PNQLTAGA+V+QYWV
Sbjct: 131 VMSCLGEMAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWV 190

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
            R+KVNPGVWITI LV I+ IN +GVRFFGE E+++S+VK                   P
Sbjct: 191 DRDKVNPGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGP 250

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
           NH+  GF+YW++PGAFK YS AI+G+KG+              Y GTELCGIV +E KNP
Sbjct: 251 NHEVLGFKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNP 310

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           R++VP+AIKLT+YRI++FY+ISI LLGM V +NDPLLI            PFVVAI NAG
Sbjct: 311 RKAVPKAIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAG 370

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
           IPVLPHI NAC+L+FVFSA NSDLYVASR+LYGLAID KAP+IFAKTN  GVPY+SL V 
Sbjct: 371 IPVLPHIMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVG 430

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
           VLF LLAYMNVSSGS+++F YFVN VSIFGLLSWISILITY+RF KA   Q  DKS  +Y
Sbjct: 431 VLFALLAYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAY 490

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            +P QP+  W SLFFC LIGLIKN+  FLG TFDYK+FI+GYIGIP Y I Y+GYKL ++
Sbjct: 491 QSPLQPYGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYK 550

Query: 523 SKLIKPEDVDLYTFKAAIDAXXXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWI 576
           +K+I  E+VDL +FK A+D                  +  K+L W Y+   GW+
Sbjct: 551 TKIIPSEEVDLVSFKEAVDLEEEEGKMLDEERAAHLAAHGKDLKWCYEKIFGWV 604

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/535 (60%), Positives = 383/535 (71%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           DGK E  RL+K L+ARH+SM                       P ++LI+Y+FVGLLV+ 
Sbjct: 73  DGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFF 132

Query: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
            MACLGEMA++IPLDGFTSYASRYVDPALGFA+GY YLFKYFI+ PNQLTA A+V+QYWV
Sbjct: 133 TMACLGEMASYIPLDGFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWV 192

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
           SR++VNPGVWITIF+V+IV IN +GV+FFGEFEFWLSS K                   P
Sbjct: 193 SRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGP 252

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
           +HDR GFRYWRDPGAFK YS AI G KGK              YTG EL GIV +EA+NP
Sbjct: 253 DHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNP 312

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           R+SVP+AIKLT+YRI++FY+ ++ LLGM VAYNDP LI            PFVVAI+N+G
Sbjct: 313 RKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSG 372

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
           I VLPHIFNACVL+FVFSACNSDLYV+SR LY LAID KAPKIF+KTN WGVPY +L  S
Sbjct: 373 IKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFS 432

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
           VLFC LAYMNVS+GSA+IFNYFVNVVS+FG+LSWI+ILI Y+ F KA  AQ  DKS F+Y
Sbjct: 433 VLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAY 492

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            AP Q +  + +L FC  I LIKN+TVFLGH FDYKTFI+GYIG+PVY   +VGYKL+++
Sbjct: 493 VAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLIYK 552

Query: 523 SKLIKPEDVDLYTFKAAIDAXXXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWIF 577
           +K+IK  DVDLYTFK   D                   + KN+ WFY+ FLG IF
Sbjct: 553 TKVIKSTDVDLYTFKEIYDREEEQGKIEDQEKEERLKKNGKNMEWFYEKFLGHIF 607

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/580 (55%), Positives = 401/580 (69%), Gaps = 3/580 (0%)

Query: 1   MSESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHV 60
           + +S  KK+ G +  +  + +    + L+            +DGK +G RLKK L+ARH+
Sbjct: 32  IDDSYFKKDNGTVAYDLEVNDQTRQNTLDDDASADSDGYNVMDGKDDGTRLKKDLKARHI 91

Query: 61  SMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFT 120
           SM                       PASILI+Y+FVG LV+  MA LGEMAA+IPLDGFT
Sbjct: 92  SMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTMAALGEMAAYIPLDGFT 151

Query: 121 SYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLI 180
           SYASRY DPALGFAVGY YLFKYFI+TPNQLTA A+V+QYWV R+ VNPGVWITIFLV+I
Sbjct: 152 SYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVDRDTVNPGVWITIFLVVI 211

Query: 181 VLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKP 240
           + INT+GV++FGEFEFWLSS K                   PNHDR GFRYW+ PGAFKP
Sbjct: 212 IAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGPNHDRLGFRYWKTPGAFKP 271

Query: 241 YSEA---ISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRI 297
           YS +   I GS GK              Y G EL GIVAAEA+NPRR++PRAIKLT++RI
Sbjct: 272 YSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTVWRI 331

Query: 298 VLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLF 357
           + FYV +I LLGM VAY+DPLL+            PFVVAI+N+G+ VLPHIFN CVL+F
Sbjct: 332 LFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQNSGVDVLPHIFNVCVLMF 391

Query: 358 VFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGS 417
           VFSACNSDLYV +R+LY LA+D KAPKIFAKTN WGVPY ++   VLFCLLAYMNVSSGS
Sbjct: 392 VFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAMGGCVLFCLLAYMNVSSGS 451

Query: 418 AQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFF 477
           A+IFNYFVNVVSIFG+LSW SILIT++ F +AV AQ  D+S F+Y APFQP+ ++ +LFF
Sbjct: 452 AEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRSTFAYVAPFQPYGSYFALFF 511

Query: 478 CCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPEDVDLYTFK 537
           C L+ LIKN++VFLG+ FDYKTFI+GYIG+PVYA  ++GYKL +++K +KP + DL ++K
Sbjct: 512 CVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKLYYKTKTVKPHEADLNSYK 571

Query: 538 AAIDAXXXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWIF 577
           AA+D                     K+L WFY+ ++  IF
Sbjct: 572 AAVDREEEEGKIKEAERKERLKHGKKDLEWFYEKYISSIF 611

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/536 (60%), Positives = 380/536 (70%), Gaps = 1/536 (0%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           DGK E  RL+K L+ARH+SM                       P S+ I+Y+FVG+LV+ 
Sbjct: 78  DGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFF 137

Query: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
            MA LGEMA++IPLDGFTSYASRY DPALGFAVGY YL KY I+ PNQLTA A+V+QYW+
Sbjct: 138 TMAALGEMASYIPLDGFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWL 197

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
            RE+VNPGVWITIFLV+IV +N +GV+FFGEFEFWLS+ K                   P
Sbjct: 198 DREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGP 257

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
            HDR GFR++  PGAFKPYS++I GSKGK              Y G EL GIVAAEA NP
Sbjct: 258 THDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELTGIVAAEAANP 317

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           R+S+P+AIKLT+YRI++FY+++I LLGM VAY+DPLL             P+VVAI N+G
Sbjct: 318 RKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINSG 377

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
           I  LPHIFNACVL+FVFSACNSDLYVASRTLYGLAID KAPKIFA TN WGVPYYSL +S
Sbjct: 378 IKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMS 437

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
             FCLLAYM+VSSGSA+IFNYFVNVVSIFGLLSWISILITYL F +AV AQ  D+S F+Y
Sbjct: 438 SCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAY 497

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            APFQP+ ++ +L FC LI  IKN+TVFL H FDYK FI+GYIGIPV+ I Y GYK V +
Sbjct: 498 RAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKK 557

Query: 523 SKLIKPEDVDLYTFKAAIDAXXXXXXXXXXXXXXXXXSSP-KNLTWFYDTFLGWIF 577
           +K+ KPE+VDLYTFKAAID                  +S  K   WFY+  LG IF
Sbjct: 558 TKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRERLKNSKTKGWDWFYEKVLGNIF 613

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/527 (58%), Positives = 371/527 (70%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LKK L+ARHVSM                       PAS+ I+YSFVG+LV+  MA +GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 111 AAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPG 170
           A++IP+DGFTSYASRYVDPALGFAVGYCYLFKY I+ PNQLTA ++V+QYW+ R+ VNPG
Sbjct: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218

Query: 171 VWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFR 230
           VWITIFLV+IV+IN  GV+FFGEFEFWLSS K                   P+HDR GFR
Sbjct: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGFR 278

Query: 231 YWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAI 290
           YW+ PGAFKPYS+AI GS GK              Y G EL GIVAAEA NPR+SVPRA+
Sbjct: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338

Query: 291 KLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIF 350
           KLT++RIV+FY+++I LLGM VAYNDP L+            PFVVAI+N+GI VLPHIF
Sbjct: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHIF 398

Query: 351 NACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAY 410
           NACVL+FVFSACNSDLYV SR+LY LA+D KAP IF +T  WG+P+YSL V VLF LLAY
Sbjct: 399 NACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAY 458

Query: 411 MNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWS 470
           MNVSSGSAQ+FNYFVNVVSIFGLLSWI I ITY+ F +AV  Q  D+S F+Y+APFQP+ 
Sbjct: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYG 518

Query: 471 TWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPED 530
           T+ SL +C  I  IKN+TVFLGH+FDYK FI+GYIG+PV+ I Y GYK + ++K++K  +
Sbjct: 519 TYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHE 578

Query: 531 VDLYTFKAAIDAXXXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWIF 577
           VDL+T K   D                   +  +L W Y+ FLG IF
Sbjct: 579 VDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/538 (58%), Positives = 373/538 (69%), Gaps = 3/538 (0%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           DGK EG RLKK L+ARHVSM                       P S+ I+YSFVG+LV+ 
Sbjct: 56  DGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFF 115

Query: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
            M+CLGEMAAFIPLDGFTSYASRYVDPALGFAVGY YL KY I+  NQLTAGAMV+QYWV
Sbjct: 116 TMSCLGEMAAFIPLDGFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWV 175

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
            R+ +NPGV+ITIFL+LIV IN  GV+ FGEFEFWLSS K                   P
Sbjct: 176 DRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGP 235

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGS---KGKXXXXXXXXXXXXXXYTGTELCGIVAAEA 279
           NHDR GFRYWRDPG+FKPYS +I       GK              Y G EL GIVAAEA
Sbjct: 236 NHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEA 295

Query: 280 KNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIK 339
           +NPR+++P+AIKLT+YRI++FYVI+ILLL M VAYNDPLL+            PFVVAI+
Sbjct: 296 QNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIE 355

Query: 340 NAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSL 399
           N+GI +LPHIFN CVL FV SA NSDLYVASR+LY LAID KAPK F KTN WG+PY+SL
Sbjct: 356 NSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSL 415

Query: 400 AVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSG 459
           A S  F  LAYMNVSS ++ +FNYFVN VSIFG++SWI IL+TY+ F KA  AQ  DKS 
Sbjct: 416 AFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSN 475

Query: 460 FSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKL 519
           F+Y AP+QP+  + +LFFCC++ L+KN+TVFLG  FDYK FI+GYIGIPV+ IC+VGYK+
Sbjct: 476 FTYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKI 535

Query: 520 VHRSKLIKPEDVDLYTFKAAIDAXXXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWIF 577
           V+++K  +PE+VDL T KA ID                  +  K+  WFYD FLG IF
Sbjct: 536 VYKTKTHRPEEVDLVTLKALIDQEEEDGKIEDAEREERLKNGNKDWAWFYDRFLGKIF 593

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/538 (57%), Positives = 368/538 (68%), Gaps = 3/538 (0%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           DGKHEGIRLKK L+ARHVSM                       P SILI+YS +G +V+T
Sbjct: 51  DGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFT 110

Query: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
           VM+CLGEMAA+IPLDGFTSYA+RY DPALGFAVG+ YLFKY ++TPNQLTAGA+V+Q+W+
Sbjct: 111 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWI 170

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
              +V+PGVWIT+ L +IV+INTVGVRFFGEFEFWLSS K                   P
Sbjct: 171 PAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGP 230

Query: 223 NHDRTGFRYWRDPGAFKPYSEA---ISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEA 279
            HDR GFRYW DPGAFK YS+    I G  GK              Y GTELCGIVAAE 
Sbjct: 231 THDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAEC 290

Query: 280 KNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIK 339
           K+PRR+VPRAIKLTLYRIV+FY+++I LLGM VAYNDPLL+            P+VVAI+
Sbjct: 291 KDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIE 350

Query: 340 NAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSL 399
           NA IPVLP++FNACVL FVFSACNSDLYV SR+LYGLAID KAPK+FA+TN WGVPY +L
Sbjct: 351 NAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNAL 410

Query: 400 AVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSG 459
           A   LFC LAYM+VS  +   F YFVNV SIFGL+SW+SILITY+ F +A  AQ   KS 
Sbjct: 411 ACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKST 470

Query: 460 FSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKL 519
            SY AP QP++ WV+L FC  + LIKN+  F+G   D  TFI+GYIG+P+Y  C++GYK+
Sbjct: 471 LSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIFCFIGYKI 530

Query: 520 VHRSKLIKPEDVDLYTFKAAIDAXXXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWIF 577
           VH++K I  ++VDL+TFK AID                      +    YD  LGWIF
Sbjct: 531 VHKTKWIPSKEVDLFTFKEAIDLEEEECIRERALMKEQLAKGGLSWKKIYDNVLGWIF 588

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/535 (60%), Positives = 385/535 (71%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           DGK    RLKK L+ARHVSM                       P S+LISYSFVG+LV+ 
Sbjct: 54  DGKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFF 113

Query: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
           VM+C+GEMAA+IPLDGFTSYASRY DPALGFAVGY YL KYFI+ PNQLTA A+V+QYW+
Sbjct: 114 VMSCIGEMAAYIPLDGFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWI 173

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
            REKVNPGVWITI LV+IV+INT GV+FFGEFEFWLSS K                   P
Sbjct: 174 PREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTP 233

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
            HDR GFRYW+ PGAFK YS++I G  G+              Y G EL GIVAAEA+NP
Sbjct: 234 THDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENP 293

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           R+++P+AIKLT++RI++FY+I+I LLGM V+ NDPLL+            PFVVAI N+G
Sbjct: 294 RKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSG 353

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
           I  LPHIFNACVL+FVFSACNSDLYVASR LY LAID KAPKIFAKTN +G+PY SL V+
Sbjct: 354 IEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVA 413

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
           VLFCLLAYM+VSSGSA+IFNYFVNVVSI G+L+WISILITY+ F +AV AQ  DKS F+Y
Sbjct: 414 VLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAY 473

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            AP QP+  + SLFFCCL+ LIKN+TVFL H FDY+ FI+GYIG+P++ ICY GYK V +
Sbjct: 474 VAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICYFGYKFVKK 533

Query: 523 SKLIKPEDVDLYTFKAAIDAXXXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWIF 577
           +K+ KPE+VDL++FKAAID                   + KN  WFY+T+LG IF
Sbjct: 534 TKIRKPEEVDLFSFKAAIDQEEEDGRIKDAATAERIKKNGKNWEWFYETYLGKIF 588

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  603 bits (1555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/499 (60%), Positives = 354/499 (70%), Gaps = 3/499 (0%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           DGK+EGIRLKK L++RH+SM                       P S LI+Y+FVG++V+ 
Sbjct: 57  DGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFF 116

Query: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
            MACLGEMA FIPLDGFTSYASRY DPALGFAVGY YL KYFI+ PNQLTA AMVMQYWV
Sbjct: 117 TMACLGEMATFIPLDGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWV 176

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
            R+ VNPG+W+T+   +I +IN  GVRFFGEFEFWLSS+K                    
Sbjct: 177 PRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAG 236

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
           +HDR GFRYW+ PGAF  YS+ ISGS GK              Y G EL GIVAAEA NP
Sbjct: 237 SHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNP 296

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           RRSVP+AIKLT YRI++FYV+SI LLGM V YND  L+            PF +AI NAG
Sbjct: 297 RRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTAS--PFSIAILNAG 354

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
           I VLP IFN C+L+FVFSA NSDLYVASR LY LA+D KAPKIFA TN WG+PY SL VS
Sbjct: 355 ITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVS 414

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
            LFCLLAYM VSS SAQ+F YFVNVVSI GLL+WISILITY+ F +AV AQ  DKS F+Y
Sbjct: 415 CLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAY 474

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            APFQP+  +VSLFFCCLI +IKN+TVFLGH FDYKTFI+GYIG+P++ +CY GYK+  +
Sbjct: 475 VAPFQPYGAYVSLFFCCLIAIIKNFTVFLGH-FDYKTFITGYIGLPIFVLCYFGYKITCK 533

Query: 523 SKLIKPEDVDLYTFKAAID 541
           S++     VDL + K+ +D
Sbjct: 534 SEIRSARYVDLVSQKSLVD 552

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  320 bits (821), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/522 (35%), Positives = 273/522 (52%), Gaps = 30/522 (5%)

Query: 15  SNETLEEDVAFD-KLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSMXXXXXXXXXXX 73
           SN T+ ED+  D  LE+           VDG  E  +LK+ L++RHV +           
Sbjct: 77  SNGTIREDLIMDVDLEKSPS--------VDGDSEPHKLKQGLQSRHVQLIALGGAIGTGL 128

Query: 74  XXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFTSYAS------RYV 127
                       PA + ISY  +  ++Y +M  LGEM  F+P DG  S  S      RYV
Sbjct: 129 LVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYV 188

Query: 128 DPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVG 187
           DP+LGFA G+ Y + Y I+   + TA + V++YW +   V  GVWITIFL ++V++N   
Sbjct: 189 DPSLGFATGWNYFYCYVILVAAECTAASGVVEYWTT--AVPKGVWITIFLCVVVILNFSA 246

Query: 188 VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISG 247
           V+ +GE EFW +S+K                   PNHDR GFRYW+ PGAF  +     G
Sbjct: 247 VKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHH--LTGG 304

Query: 248 SKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISIL 306
           S G               +  G EL  + +AE  + RR++ +A +  ++R++ FYV+  L
Sbjct: 305 SLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTL 364

Query: 307 LLGMTVAYNDPLLIXXXXXXX-XXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSD 365
            + + V YNDP L+             PFV+ I+NAGI VLPHI N C+L   +SA N+ 
Sbjct: 365 AISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAF 424

Query: 366 LYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFV 425
           ++ ++R+L  +A   +APK   + N WGVPY ++ VS L   LAY+NVSS +A +FN+F 
Sbjct: 425 MFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFS 484

Query: 426 NVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF----QPWSTWVSLFFCCLI 481
           N+ +I G L W+   I YLRF KA+       +G     PF    QP++ W SL    +I
Sbjct: 485 NISTISGFLGWMCGCIAYLRFRKAIF-----YNGLYDRLPFKTWGQPYTVWFSLIVIGII 539

Query: 482 GLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
            +   Y +F+   +    FI+ YI +P++ + + G+KL  R+
Sbjct: 540 TITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLYTRT 581

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  317 bits (813), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/534 (34%), Positives = 278/534 (52%), Gaps = 32/534 (5%)

Query: 3   ESLEKKNAGILYSNETLEEDVAFD-KLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVS 61
           E + K ++    SN T+ ED+  D  +E+           V+G +E  +LK+ L++RHV 
Sbjct: 71  EKISKNHSA--SSNGTIREDLIMDVDVEKSPS--------VEGDNEPHKLKQGLQSRHVQ 120

Query: 62  MXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFTS 121
           +                       PA + ISY  +  ++Y +M  LGEM  F+P DG  S
Sbjct: 121 LIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDS 180

Query: 122 YAS------RYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITI 175
             S      RYVD +LGFA G+ Y + Y I+   + TA + V++YW +   V  GVWITI
Sbjct: 181 AGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTT--AVPKGVWITI 238

Query: 176 FLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDP 235
           FL ++VL+N   V+ +GE EFW +S+K                   PNHDR GFRYW+ P
Sbjct: 239 FLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHP 298

Query: 236 GAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTL 294
           GAF  +     GS G               +  G EL  + +AE  + RR++ +A +  +
Sbjct: 299 GAFAHH--LTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNISKASRRFV 356

Query: 295 YRIVLFYVISILLLGMTVAYNDPLLIXXXXXXX-XXXXXPFVVAIKNAGIPVLPHIFNAC 353
           +R++ FYV+  L + + V YNDP L+             PFV+ I+NAGI VLPHI N C
Sbjct: 357 WRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGC 416

Query: 354 VLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNV 413
           +L   +SA N+ ++ ++R+L  +A   +APK   + N WGVPY ++ VS L   LAY+NV
Sbjct: 417 ILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLAYLNV 476

Query: 414 SSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF----QPW 469
           SS +A +FN+F N+ +I G L W+   I YLRF KA+       +G     PF    QP+
Sbjct: 477 SSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIF-----YNGLFDRLPFKTWGQPY 531

Query: 470 STWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
           + W SL    +I L   Y +F+   +    FI+ YI +P++ + + G+KL  R+
Sbjct: 532 TVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYTRT 585

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  311 bits (797), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 175/498 (35%), Positives = 271/498 (54%), Gaps = 14/498 (2%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           D +H    LKK L  RH+ +                       PA + +S+  +  +VY 
Sbjct: 46  DYEHN---LKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYC 102

Query: 103 VMACLGEMAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           +M  L EM  ++P  G      +RYVDP+LGFA G+ Y + Y ++   +LTA A +++YW
Sbjct: 103 IMCTLAEMVCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYW 162

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
              ++V  GVWITIFL+++V++N   VRF+GE EFW +S+K                   
Sbjct: 163 T--DQVPQGVWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGA 220

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAK 280
           PNHDR GFRYWR+PGAF  +     G+ G+              +    EL G+   EAK
Sbjct: 221 PNHDRVGFRYWRNPGAFGYH--ITGGNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAK 278

Query: 281 NPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYND-PLLIXXXXXXXXXXXXPFVVAIK 339
           + RR++ +A +  +YRI+ FY+ S L++G+ VA ND  LL+            PFV  I 
Sbjct: 279 DTRRNIEKASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIA 338

Query: 340 NAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSL 399
           N+GIPVL H+ N  +L   +SA NS  Y +SR++  L+    APKIF+K N +GVPY ++
Sbjct: 339 NSGIPVLNHVINVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAV 398

Query: 400 AVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVI-AQFGDKS 458
            +  L   LAY+NVSS S+++F +  N+ +I G + W  I + Y+RF KA++  +  D+ 
Sbjct: 399 FLCSLVACLAYLNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRLLDR- 457

Query: 459 GFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYK 518
              Y +P QP+S +       +I L   Y VF+   +DYK F++ YI +P++   Y+G+K
Sbjct: 458 -IPYRSPLQPFSAYFFTIVVAIITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHK 516

Query: 519 LVHRSKLIKPED-VDLYT 535
            +++++   P D +D+ T
Sbjct: 517 TIYKTRFCIPVDQIDVIT 534

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  311 bits (796), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 179/501 (35%), Positives = 273/501 (54%), Gaps = 9/501 (1%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +G+     +K+ L+ RH+ M                       P   LI+Y F+G LVY+
Sbjct: 51  NGQIREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYS 110

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   LGEMA FIP+   FT ++ R++ P+ G A GY Y F + I    +L+    ++Q+W
Sbjct: 111 VTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFW 170

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
            S   +    WI+IF VL+V +N   VRF+GEFEFW++S+K                   
Sbjct: 171 TSAVPIV--AWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAG 228

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
                 GFRYWR+PG   P   A + ++ K              Y GTEL GI A EA N
Sbjct: 229 VTGP-VGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAAN 287

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PR+SVPRAIK  ++RI+ FY+ S+  +G+ V YNDP L             PF+++I+N+
Sbjct: 288 PRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKL---TSDDSYVAASPFIISIQNS 344

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G P+LPHIFNA +L  + SA NS++YV SR ++GL+  + AP+I ++TN  GVP+ S+  
Sbjct: 345 GTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIF 404

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           + LF  LAYM  S+G    FN+ +N+  + G  SW+ I I+++RF +A+  +   +    
Sbjct: 405 TGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLP 464

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           + A F P   + ++FF  LI +I+ +T F   +FD   F++ YI   ++   ++ ++L  
Sbjct: 465 FKAKFMPGLAYYAIFFMTLIIIIQGFTSFC-PSFDGIDFLAAYISCFLFIAIWIVFQLWF 523

Query: 522 RSKLI-KPEDVDLYTFKAAID 541
           R +LI K EDVD+ T +  I+
Sbjct: 524 RCRLIWKIEDVDIDTDRRDIE 544

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  307 bits (787), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 181/532 (34%), Positives = 271/532 (50%), Gaps = 25/532 (4%)

Query: 5   LEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSMXX 64
           LEKK   +L    + E++   ++++                 +   L + L+ R VS+  
Sbjct: 2   LEKKGTVVLERPASGEDECESEEID----------------EKNGNLSRELKPRVVSLLT 45

Query: 65  XXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLD-GFTSYA 123
                                P S+ I+Y F G L+  V+  L EMA+F P+D GF+ Y 
Sbjct: 46  LGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYL 105

Query: 124 SRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLI 183
           +RYVDPA GFA G+ Y  KY IV    LTA  +V+ YW  R  VN GVW+T+  V +  +
Sbjct: 106 NRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RPDVNVGVWVTVLYVTVFCV 163

Query: 184 NTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSE 243
           N + V++FGE E  L+  K                   PNH  TGFRYWR+ GA  PY  
Sbjct: 164 NFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGAL-PY-- 220

Query: 244 AISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVI 303
            + G  GK              + G+E+ GIV  E  NP++++P++     +RI   YV 
Sbjct: 221 LVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVF 280

Query: 304 SILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACN 363
            + +LG+ ++  +  L+            PFV+AI ++GI VLP+  NA +L+F+ S+ N
Sbjct: 281 GVFILGLAISPVNSKLVHAHSTDANAS--PFVIAISSSGIKVLPNFVNAALLVFIISSAN 338

Query: 364 SDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNY 423
           +D+Y+ SR LYGLA D  APKIF   N + VP        L   LAYMN    +A +F+Y
Sbjct: 339 TDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSY 398

Query: 424 FVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGL 483
             + VS+FG+L+W  ILI Y+ + +A+ A+        +   FQP++ +V+LFF  +I  
Sbjct: 399 ITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAYVTLFFVTIITF 458

Query: 484 IKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPEDVDLYT 535
              Y  F+   F YKTFI+ YIG+    +  +GYKL  ++K +KP ++   T
Sbjct: 459 FNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSEISFRT 509

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  307 bits (787), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 178/502 (35%), Positives = 266/502 (52%), Gaps = 16/502 (3%)

Query: 46  HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMA 105
            E  +LK+ L++RHV +                       PA +  SY  +   +Y +M 
Sbjct: 65  EENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIMN 124

Query: 106 CLGEMAAFIPLDGFTSYAS------RYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQ 159
             GEM  ++P +G  S  S      +YVD +LGFA  + Y + + I+   + TA A V++
Sbjct: 125 AFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVVE 184

Query: 160 YWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXX 219
           YW    KV  G WITIFL  +V +N + V F+GE EFW +S+K                 
Sbjct: 185 YWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILFWG 244

Query: 220 XXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAE 278
             P+HDR GFRYW+ PGAF  +     G+ G               +  G EL  + ++E
Sbjct: 245 GGPSHDRLGFRYWQRPGAFADH--ITDGTGGNFLDVYTGVIKGGFAFVLGPELVSLTSSE 302

Query: 279 AKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXX-XXXXXPFVVA 337
             + RR++ +A +  ++R+++FYV+  L + + VAYNDP L              PFV+ 
Sbjct: 303 CHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIG 362

Query: 338 IKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYY 397
           I+NAGI VLPHI N C++   +SA N+ ++ +SR+L  +A    APK F+K N +GVPY 
Sbjct: 363 IQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPYV 422

Query: 398 SLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGD- 456
           ++  S LFC LAY+NVSS +A +FN+F N+ +I G + WI   + Y+RF KA+I  F D 
Sbjct: 423 AVGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAII--FNDL 480

Query: 457 KSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVG 516
                Y    Q +  W SLF   LI L   Y +F+   +DYK FI+ YI +PV+ + ++G
Sbjct: 481 YDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIG 540

Query: 517 YKLVHRSKL---IKPEDVDLYT 535
           +KLV RS     I  + +D++T
Sbjct: 541 HKLVTRSWRQWYIPVDKIDVFT 562

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  306 bits (785), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 182/508 (35%), Positives = 272/508 (53%), Gaps = 16/508 (3%)

Query: 45  KHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVM 104
           K E   LK+ L++RH+ +                       PA +L SY  + L++Y VM
Sbjct: 43  KREPHTLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVM 102

Query: 105 ACLGEMAAFIPLDGFTS------YASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVM 158
             LGEM  ++P  G  S        SRY DP+LGFA G+ Y + Y I+   + TA + V+
Sbjct: 103 NALGEMVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVV 162

Query: 159 QYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXX 218
            YW +   V    WITIFL ++ ++N   V+F+GE EFW + +K                
Sbjct: 163 TYWTT--VVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFW 220

Query: 219 XXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAA 277
              P+HDR GFRYW+ PGAF  +    +G+ G+              +  G EL  + ++
Sbjct: 221 GGGPSHDRLGFRYWQKPGAFAYH--ITTGNTGRFLDVWTGVIKGGFAFILGPELVAVTSS 278

Query: 278 EAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXX-XXXXPFVV 336
           EA + RR++ +A +   YR++ FYV S L +G+ VA NDP+L              PFV+
Sbjct: 279 EAMDQRRNIEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVI 338

Query: 337 AIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPY 396
           AI+NA I +LPHI NAC+L   +S+ NS ++ ASR+L  +A D  APK+F K N  GVPY
Sbjct: 339 AIQNAHIKILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPY 398

Query: 397 YSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGD 456
            ++AVS  F  LAY+NVSSGSA+ F +F N+ +I G + WI I + YLRF KA+  + G 
Sbjct: 399 NAVAVSAAFSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFR-GL 457

Query: 457 KSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVG 516
                + +PFQP+ T+  +    +I L   Y  F+   +    F++ YI +PV+ + +VG
Sbjct: 458 YDRVPFKSPFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVG 517

Query: 517 YKLVHRSK---LIKPEDVDLYTFKAAID 541
           +K+  R+    +I   +VD+ T  A I+
Sbjct: 518 HKIYTRTLSTWVIPVAEVDVTTGLAEIE 545

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  305 bits (782), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 171/500 (34%), Positives = 266/500 (53%), Gaps = 9/500 (1%)

Query: 44  GKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTV 103
           G  +  ++K+AL+ RH+SM                       P   LI+Y F+G L Y+V
Sbjct: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94

Query: 104 MACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
              LGEMA FIP+   FT +  R++ PALG A GY Y   + I    +L+    ++Q+W 
Sbjct: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
             + V    WI IF V++ + N   V+++GE EFW++ +K                    
Sbjct: 155 --DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
                GFRYWR+PG + P   +   ++G+              Y GTEL GI A EA NP
Sbjct: 213 TGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           R++VPRAI    +RI+ FY++S+L +G+ V +NDP L             PFV+AI+N+G
Sbjct: 272 RKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENSG 328

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
             VLPHIFNA +L  + SA NS++YV SR  Y +A++  APK    T   G+PY ++  +
Sbjct: 329 TKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTT 388

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
            +   LAY+  SSG++ +FN+ +N+ ++ G  +WI I I+++RF +A+  Q   +    +
Sbjct: 389 SVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPF 448

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            A F PW  + + FF  +I +I+ +T F    F    F + YI + ++ + ++G+++  R
Sbjct: 449 KAKFMPWGAYYAAFFIGVIIIIQGFTAF-APKFKVSDFFTAYISVMLFFVFWIGFQIWFR 507

Query: 523 SKL-IKPEDVDLYTFKAAID 541
             L IK ED+DL T +  ID
Sbjct: 508 GPLFIKTEDIDLDTDRREID 527

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  306 bits (784), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 181/531 (34%), Positives = 275/531 (51%), Gaps = 13/531 (2%)

Query: 1   MSESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHV 60
           MS   + K+AG     +     V    +E             D       LKK L++RH+
Sbjct: 1   MSGLQDLKDAGETTVTDKQTGQVYEIDIESYSQISGPKVSSSDAPQGDHTLKKGLKSRHI 60

Query: 61  SMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFT 120
            +                       PA +  SY  + +++Y VM  LGEM  ++P DG +
Sbjct: 61  QLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNALGEMVCYLPGDGSS 120

Query: 121 ------SYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWIT 174
                    +RYVDP+LGFA G+ Y + Y I+   + TA + V+QYW +   V  G WIT
Sbjct: 121 SGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYWTT--AVPKGAWIT 178

Query: 175 IFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRD 234
           IFL ++VL+N   V+F+GE EFW +S+K                   P+HDR GFRYW+ 
Sbjct: 179 IFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPHHDRLGFRYWQK 238

Query: 235 PGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLT 293
           PGAF  +    SG+ G+              +  G EL  + +AEA++ RR++ +A +  
Sbjct: 239 PGAFAYH--ITSGNTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDARRNIQKASRRF 296

Query: 294 LYRIVLFYVISILLLGMTVAYNDPLL-IXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNA 352
           +YR++ FYV S L +G  VAYND  L              PFV+ I+NAGI VLPHI N 
Sbjct: 297 VYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNAGIKVLPHIINV 356

Query: 353 CVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMN 412
           C+L   +S+ NS ++ ASR+L  ++ +  APKI  + N +GVPY ++A++ L   +AY+N
Sbjct: 357 CILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALTSLLSCIAYLN 416

Query: 413 VSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTW 472
           VSS +A +F +F N+ +I G + WI I I YLRF KA+  Q        +  PFQP+ TW
Sbjct: 417 VSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQ-NLYERVPFKTPFQPYGTW 475

Query: 473 VSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
             +    +I L   Y +F+   ++   FI+ Y+ +P++ + ++G+KL  R+
Sbjct: 476 FFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWTRT 526

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  307 bits (786), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 174/508 (34%), Positives = 274/508 (53%), Gaps = 20/508 (3%)

Query: 48  GIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACL 107
           G  LK+ L++RHV +                       PA + ISY  +  ++Y +M  +
Sbjct: 72  GHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGI 131

Query: 108 GEMAAFIP-----LDGFTSY-ASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           GEM  ++P      +GF +Y   +YVD +LGFA  + Y + Y I+   + TA + V++YW
Sbjct: 132 GEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYW 191

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
            +   V    WITIFL  +V++N   V+F+GE EFW +S+K                   
Sbjct: 192 TT--SVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGG 249

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAK 280
           PNHDR GFRYW++PG F  +     GS G               +  G E+  + ++E +
Sbjct: 250 PNHDRLGFRYWQNPGGFAHHIRG--GSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVE 307

Query: 281 NPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXX-XXXXXPFVVAIK 339
           + RR++ +A +  ++R++ FY++  L + + VAYNDP L              PFV+ I+
Sbjct: 308 DQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQ 367

Query: 340 NAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSL 399
           NAGI VLPHI NAC+L   +SA N+ ++ +SR+L  +A + +AP+IFAK N WGVPYY++
Sbjct: 368 NAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAV 427

Query: 400 AVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSG 459
            +S     LAY+N SS +A +FN+F N+  I G + WI + I Y+RFHKA++   G +S 
Sbjct: 428 GLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFH-GMQSR 486

Query: 460 FSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKL 519
             YTA   P+  +  L    +I L   Y VF+   +D K F++ YI +PV+ + ++G++ 
Sbjct: 487 LPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHR- 545

Query: 520 VHRSKLI------KPEDVDLYTFKAAID 541
           V+R K+         E++D+ T    I+
Sbjct: 546 VYRRKIFTLKWWKSIEEIDVVTGVEEIE 573

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  305 bits (782), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 178/535 (33%), Positives = 282/535 (52%), Gaps = 11/535 (2%)

Query: 1   MSESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEG----IRLKKALE 56
           +S+S +   +G+  SN  +++ + F K                   EG      +K+AL+
Sbjct: 20  LSQS-QSARSGMHVSNSKIDDPLRFSKDNNLTLEAIDDDSSRMFDPEGSIGQAEVKRALK 78

Query: 57  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPL 116
            RHVSM                       P   LI++  +G L Y+V   LGEMA FIP+
Sbjct: 79  PRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPV 138

Query: 117 -DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITI 175
              FT ++ R++ PA+G A GY Y F + I    +L+    ++QYW   + V    WI I
Sbjct: 139 TSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWT--DAVPLEAWIAI 196

Query: 176 FLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDP 235
           F VL+V  N   V+++GEFEFW++S+K                   P     GFRYWR P
Sbjct: 197 FWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKP 255

Query: 236 GAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLY 295
           G +     A + +K +              Y GTEL GI A E KNPR++VPRAI    +
Sbjct: 256 GPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFF 315

Query: 296 RIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVL 355
           RI++FY+ S+  +G+ V YNDP L             PF++AI N   PVLPHIFNA +L
Sbjct: 316 RILIFYIGSLFFIGLLVPYNDPKL-EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVIL 374

Query: 356 LFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSS 415
             + SA NS++YV SR L+GL+ +  APK F+KT   GVP+ ++ ++ +F  LAY+NVS+
Sbjct: 375 TTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSN 434

Query: 416 GSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSL 475
            + ++F++ +N+ +I G ++W+ I I+++RF + +  +   +    Y A F P++ + + 
Sbjct: 435 DAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPYAAYYAA 494

Query: 476 FFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPED 530
           FF  +I +I+ +T F  H F+   F + YI + ++ I +  ++ ++R+KL +  D
Sbjct: 495 FFITVIIIIQGFTAFAPH-FNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFRTLD 548

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  305 bits (780), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 172/502 (34%), Positives = 273/502 (54%), Gaps = 9/502 (1%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
            G+     +K+ L+ RH+ M                       P   LISY F+G L Y+
Sbjct: 76  QGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYS 135

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   LGEMA FIP+   FT ++ R++ PA G A GY Y F + I    +L+    V+++W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFW 195

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
            +  KV    WI+IF V+I ++N   V+++GEFEFW++S+K                   
Sbjct: 196 TN--KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAG 253

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
                 GFRYWR+PGA+ P   +   ++G+              + GTEL GI A EA N
Sbjct: 254 VTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PR++VPRAIK  ++RI+ FY+ S+L +G+ V YNDP L             PF++AI+N+
Sbjct: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TTATSYVSVSPFIIAIENS 369

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G  VLPHIFNA +L  + SA NS++YV SR L+GL+ ++ APK  ++T   GVPY ++ +
Sbjct: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFI 429

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           + +F  LAYM  S+G  ++F + +N+  + G  +W+ I I+++RF +A+  +   +    
Sbjct: 430 TAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELP 489

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           + A   P   + +  F  +I LI+ +T F    FD   F++ YI I ++   ++ ++++ 
Sbjct: 490 FKAKLMPGLAYFAATFMIIIILIQGFTAF-APKFDGIDFLAAYISIFLFLAIWILFEIIF 548

Query: 522 RSKLI-KPEDVDLYTFKAAIDA 542
           R + I K EDVD+ + +  I+A
Sbjct: 549 RCRFIWKIEDVDIDSDRRDIEA 570

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  303 bits (776), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 173/494 (35%), Positives = 267/494 (54%), Gaps = 9/494 (1%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           +K++L+ RH+ M                       P   L++Y F+G +V++V   LGEM
Sbjct: 66  VKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEM 125

Query: 111 AAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A FIP+   F+ +A R++ PALG A GY Y   +      +L+    ++Q+W    KV  
Sbjct: 126 ATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTF--KVPL 183

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
             WI+IF VL+   N   V+F+GEFEFW++S+K                         GF
Sbjct: 184 AAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGF 242

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           RYWR+PGA  P   + +  + +              Y GTEL GI A EA NPR++VPRA
Sbjct: 243 RYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRA 302

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
           I+  L RI+LFY+ S+  +G+TV YNDP L             PF++ I+NAG  VLPHI
Sbjct: 303 IRKVLIRILLFYIGSLFFIGLTVPYNDPKL---TSTDSYVSSSPFIITIQNAGTRVLPHI 359

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
           FNA +L  + SA NS++YV SR L+ +A +  APK  AKT   GVPY S+     F  L+
Sbjct: 360 FNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLS 419

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           YM +S+G A+ FN+ +N+  + G  +W+ I  +++RF +A+  +   +    Y A + PW
Sbjct: 420 YMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPW 479

Query: 470 STWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI-KP 528
             + ++FF  +I LI+ +T F  H F  + F++ YI + ++ + +  +++  R ++I K 
Sbjct: 480 LAYYAIFFMVVIILIQGFTSFAPH-FSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKL 538

Query: 529 EDVDLYTFKAAIDA 542
           EDVD+ T +  I++
Sbjct: 539 EDVDIDTDRREIES 552

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  303 bits (776), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 171/502 (34%), Positives = 273/502 (54%), Gaps = 9/502 (1%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +G+ +   +K+ L+ RH+ M                       P   LISY F+G L Y+
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYS 135

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   LGEMA FIP+   FT ++ R++ PA G A GY Y F + +    +L+    V+Q+W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFW 195

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
                V    WI+IF V+I  +N   V+++GEFEFW++S+K                   
Sbjct: 196 TY--AVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
                 GFRYWR+PGA+ P   + + ++ +              + GTEL GI A EA N
Sbjct: 254 VTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAAN 312

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PR++VPRAIK  ++RI+ FY+ S+L +G+ V YNDP L             PF++AI+N+
Sbjct: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TSATSYVSTSPFIIAIENS 369

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G  VLPHIFNA +L  + SA NS++YV SR L+GL+  + APK F+KT   GVPY ++  
Sbjct: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFA 429

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           + +F  LAYM  S+G  ++F + +N+  + G  +W+ I ++++RF +A+  +   +    
Sbjct: 430 TSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELP 489

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           + A   P   + + FF  +I LI+ +T F   TF+   F++ YI + ++   ++ ++L+ 
Sbjct: 490 FKAKLMPGLAYYATFFMVVIILIQGFTSFT-PTFNGVNFLAAYISVFLFLAIWILFELIF 548

Query: 522 RSKLI-KPEDVDLYTFKAAIDA 542
           R + + K EDVD+ + +  I+A
Sbjct: 549 RCRFVWKIEDVDIDSDRRDIEA 570

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  302 bits (774), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 173/502 (34%), Positives = 276/502 (54%), Gaps = 9/502 (1%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +G+ +   +K+ L+ RH+ M                       P   LI+Y F+G L ++
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFS 135

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   LGEMA FIP+   FT ++ R++ PA G A GY Y F + I    +L+    V+Q+W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
               KV    WI+IF VLI ++N   V+++GEFEFW++S+K                   
Sbjct: 196 T--HKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAG 253

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
                 GFRYWR+PGA+ P   + + ++G+              + GTEL GI A EA N
Sbjct: 254 VTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PR++VPRAIK  ++RI+ FY+ S+L +G+ V YNDP L             PF+VAI+N+
Sbjct: 313 PRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TEATSYVSTSPFIVAIQNS 369

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G  VLPHIFNA +L  + SA NS++YV SR L+GL+ ++ APK  ++T+  GVPY ++  
Sbjct: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFA 429

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           + +F  LAYM  S+G  ++F + +N+  + G  +W+ I I+++RF +A+  +   +    
Sbjct: 430 TAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELP 489

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           + A   P   + S FF  +I +I+ +T F    F+  +F++ YI I ++   ++ ++ + 
Sbjct: 490 FKAKLMPGLAYYSSFFMIIIIIIQGFTAF-APKFNGSSFLAAYISIFLFIAVWILFECIF 548

Query: 522 RSKLI-KPEDVDLYTFKAAIDA 542
           R + I K EDVD+ + +  I+A
Sbjct: 549 RCRFIWKIEDVDIDSDRRDIEA 570

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  302 bits (774), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 175/502 (34%), Positives = 271/502 (53%), Gaps = 9/502 (1%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +G+     +K+AL+ RH+ M                       P   LI+Y F+  LVY+
Sbjct: 69  EGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYS 128

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V+  LGEMA FIP+   FT ++SR++ PA G A GY Y F + I    +L+    ++++W
Sbjct: 129 VVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFW 188

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
            +   V    WITIF VL+ + N   V+++GEFEFW++ +K                   
Sbjct: 189 TT--AVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAG 246

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
                 GFRYWR+PGA+ P   +   ++G+              Y GTEL GI A EA N
Sbjct: 247 ITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PR+SVPRAIK  ++RI++FY    + +G+ V YNDP L             PF++AI+N+
Sbjct: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIENS 362

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G  VLPHIFNA VL  + SA NS++YV SR +YGLA  + AP  F +TN  GVPY+++  
Sbjct: 363 GTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFF 422

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           +  F  LAYM +S+G A  FN+ +N+  + G  +W+ I   ++RF +A+  +   +    
Sbjct: 423 TSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLP 482

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           + A F PW  + +LFF  +I LI+ +T F   TF    F + Y+ + ++   ++G ++  
Sbjct: 483 FKAKFMPWLAYYALFFMVVIILIQGFTAF-APTFSGVDFAAAYVSVFLFIAIWLGAQIWF 541

Query: 522 RSKLI-KPEDVDLYTFKAAIDA 542
           R ++  + ++VD+ T +  I+A
Sbjct: 542 RCRIFHRLDEVDIDTDRRDIEA 563

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  302 bits (773), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 167/485 (34%), Positives = 260/485 (53%), Gaps = 8/485 (1%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +G  +   +K+AL+ RH+SM                       P   LI+Y F+G + Y 
Sbjct: 74  EGNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYF 133

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   LGEMA FIP+   FT +  R++ PA G A GY Y F + I    +L+    ++Q+W
Sbjct: 134 VTQSLGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFW 193

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
                V  G WI IF V++   N   V+++GE EFW++ +K                   
Sbjct: 194 TF--AVPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG 251

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
                 GFRYWR+PG + P   +   ++G+              Y GTEL GI A E+KN
Sbjct: 252 KTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKN 310

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PRR+VPRAI    +RI+ FY++S+L +G+ V +NDP L             PFV+AI+N+
Sbjct: 311 PRRTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENS 367

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G  VLPHIFNA +L  + SA NS++YV SR LYGLA ++ APK+FA+    GVPY S+  
Sbjct: 368 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLG 427

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           +  F  LAY+N+S+ + ++F++ +N+ +I G  +W+ I + ++RF + +  +   ++   
Sbjct: 428 TAAFGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLP 487

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           + A F PW  + S FF  LI +I+ +T F    F+   F + YI + ++   +V +++  
Sbjct: 488 FKAKFMPWGAYYSAFFISLIIIIQGFTAF-APKFNVSNFFAAYISVFLFLAIWVVFQIRF 546

Query: 522 RSKLI 526
           R++ I
Sbjct: 547 RTRFI 551

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  304 bits (779), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 181/533 (33%), Positives = 273/533 (51%), Gaps = 34/533 (6%)

Query: 3   ESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSM 62
           E + K  +    SN T+ E++  +K               DG     RLK+ L++RHV +
Sbjct: 127 EKISKNQSA--SSNGTVREELDLEK-----------SPSADGDAGPHRLKQGLQSRHVQL 173

Query: 63  XXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFTSY 122
                                  PA + ISY  +  ++Y +M  LGEM  F+P DG  S 
Sbjct: 174 IALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSA 233

Query: 123 AS------RYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIF 176
            S      RYVD +LGFA G+ Y + Y I+   + TA + V++YW +   V  GVWITIF
Sbjct: 234 GSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWTT--AVPKGVWITIF 291

Query: 177 LVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPG 236
           L ++VL+N   V+ +GE EFW +S+K                   P HDR GFRYW+ PG
Sbjct: 292 LCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPG 351

Query: 237 AFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTLY 295
           +F  +     GS G               +  G EL  + +AE  + RR++ +A +  ++
Sbjct: 352 SFAHHLAG--GSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVW 409

Query: 296 RIVLFYVISILLLGMTVAYNDPLLIXXXXXXX-XXXXXPFVVAIKNAGIPVLPHIFNACV 354
           R++ FYV+  L + + V YNDP L+             P+V+ I+NAGI VLPHI N C+
Sbjct: 410 RLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKVLPHIINGCI 469

Query: 355 LLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVS 414
           L   +SA N+ ++ ++R+L  +A   +APK   K N +GVPY ++ VS L   LAY+NVS
Sbjct: 470 LTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLCSCLAYLNVS 529

Query: 415 SGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF----QPWS 470
           S +A +FN+F N+ +I G L WI   I YLRF KA+       +G     PF    QP++
Sbjct: 530 SSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFF-----NGLYDRLPFKTWGQPYT 584

Query: 471 TWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
            W SL    +I +   Y +F+   ++   FI+ YI +P++ + ++G+KL  R+
Sbjct: 585 VWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTRT 637

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  303 bits (775), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 181/522 (34%), Positives = 273/522 (52%), Gaps = 30/522 (5%)

Query: 15  SNETLEEDVAFD-KLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSMXXXXXXXXXXX 73
           SN T+ E++  D  LE+            DG +E  +LK+ L++RHV +           
Sbjct: 76  SNGTIHEELVMDVDLEKSPS--------ADGDNEPRKLKQGLQSRHVQLIALGGAIGTGL 127

Query: 74  XXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFTSYAS------RYV 127
                       P  + ISY  +  ++Y +M  LGEM  F+P DG  S  S      RYV
Sbjct: 128 LVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYV 187

Query: 128 DPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVG 187
           D +LGFA G+ Y + Y I+   + TA + V++YW +   V  GVWIT+FL+++VL+N   
Sbjct: 188 DASLGFATGWNYFYCYVILVAAECTAASGVVEYWTT--AVPKGVWITVFLLVVVLLNFSA 245

Query: 188 VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISG 247
           V+ +GE EFW +S+K                   P HDR GFRYW+ PGAF  +     G
Sbjct: 246 VKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHPGAFAHH--LTGG 303

Query: 248 SKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISIL 306
           S G               +  G EL  + +AE  + RR++ +A +  ++R++ FYV+  L
Sbjct: 304 SLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTL 363

Query: 307 LLGMTVAYNDPLLIXXXXXXX-XXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSD 365
            + + V YNDP+L+             PFV+ I+NAGI VLPHI N C+L   +SA N+ 
Sbjct: 364 SISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAF 423

Query: 366 LYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFV 425
           ++ ++R+L  +A   +APK   K N WGVPY ++A S L   LAY+NVSS +A +FN+F 
Sbjct: 424 MFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFS 483

Query: 426 NVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF----QPWSTWVSLFFCCLI 481
           N+ +I G L WI   I YLRF KA+       +G     PF    QP++ W SL    +I
Sbjct: 484 NISTISGFLGWICGCIAYLRFRKAIF-----YNGLYDRLPFKTWGQPYTVWFSLIVVSII 538

Query: 482 GLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
            +   Y +F+   +    FI+ Y+ +P++ + ++G+KL  R+
Sbjct: 539 TITNGYAIFIPKYWKVADFIAAYVTLPIFLVLWLGHKLYTRT 580

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  301 bits (771), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 180/535 (33%), Positives = 273/535 (51%), Gaps = 18/535 (3%)

Query: 3   ESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSM 62
           E  EKK   +  + + L  ++  + L R           V+ +  G +LK+ L +RHV  
Sbjct: 13  EEEEKKT--VFDNRQILINELDLESLTREKITRSDSSSEVEAEGNG-KLKQGLSSRHVQF 69

Query: 63  XXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFTSY 122
                                  P  ++ISY  +  ++Y +M  LGEM  ++P +G  S 
Sbjct: 70  IALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNALGEMVCYLPGNGEDSA 129

Query: 123 AS------RYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIF 176
            S      RYVD +L FA G+ Y + + I+   + TA + V+ YW +   V   VWITIF
Sbjct: 130 GSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYWTT--SVPTAVWITIF 187

Query: 177 LVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPG 236
           L ++ L+N   V++FGE EFW +S+K                   P+H R GF YW+DPG
Sbjct: 188 LGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGPSHVRLGFHYWKDPG 247

Query: 237 AFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTLY 295
            F  +     GS G               +  G EL  + ++E  + RR++ +A K  ++
Sbjct: 248 TFAHH--ITGGSWGSFLDIYTGIIKGAFAFILGPELVALTSSECNDQRRNIAKASKRFIW 305

Query: 296 RIVLFYVISILLLGMTVAYNDPLLIXXXXXXXX-XXXXPFVVAIKNAGIPVLPHIFNACV 354
           R++ FY++  L + + VAYNDP+L+             PFV+ I+NAGI VLPHI NAC+
Sbjct: 306 RLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNAGIKVLPHIINACI 365

Query: 355 LLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVS 414
           L   +SA NS ++ +SR+L  +A +  APKIF K N +GVPYYS+ +S +   LA++NVS
Sbjct: 366 LSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGLSAMLSCLAFLNVS 425

Query: 415 SGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVI-AQFGDKSGFSYTAPFQPWSTWV 473
           S +AQ+F++F N+ +I G L WI  +I YLRF KA+      D+  F      QP+  W 
Sbjct: 426 SSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNMYDRLPFKTFG--QPYLIWY 483

Query: 474 SLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKP 528
           SL    +I L   Y  F+   +    F++ YI +P++ I +VG+K   R K   P
Sbjct: 484 SLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGHKFWARYKHAVP 538

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  302 bits (773), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 180/548 (32%), Positives = 285/548 (52%), Gaps = 19/548 (3%)

Query: 6   EKKNAGILYSNETLEEDVA----FDKLERXXXXXXXXXXXVD------GKHEGIRLKKAL 55
           +KK+  + Y NE LE+  +    F  + R            D       + +  ++K+AL
Sbjct: 47  DKKDMTVTYDNEILEKKDSKSDIFTSVNRYASHPSEARISSDEYDHQEAEFKDTKVKRAL 106

Query: 56  EARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIP 115
           + RH+ M                       P   LI+Y F+G +VY V   LGEMA FIP
Sbjct: 107 KPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQALGEMATFIP 166

Query: 116 L-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWIT 174
           +    T ++SR++ PA G + GY Y F + I    +++    V+++W +  KV    WI+
Sbjct: 167 VTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTT--KVPLAAWIS 224

Query: 175 IFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRD 234
           IF VL+  +N   V  +GE EFW++SVK                         GFRYWR 
Sbjct: 225 IFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGS-KQGPIGFRYWRH 283

Query: 235 PGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTL 294
             A      +   ++ +              Y GTEL GI A EA NPR+SVPRAI   +
Sbjct: 284 GYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVV 343

Query: 295 YRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACV 354
           +RIV+FY++S+  +G+ V YNDP L             PFV++I+NAG   LPHIFNA +
Sbjct: 344 FRIVIFYILSLFFIGLLVPYNDPKL---NSATSYIASSPFVISIENAGTRALPHIFNAII 400

Query: 355 LLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVS 414
           ++ + SA NS++YV+SR LY LA+   APKIFA+    GVP+  + V+ L  LLA++ V+
Sbjct: 401 MITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLAFLVVN 460

Query: 415 SGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVS 474
           + + + FN+ +N+ ++ GL +W+ I +++LRF +A+  +   +    + A F P+ ++ +
Sbjct: 461 NNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPYGSYYA 520

Query: 475 LFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI-KPEDVDL 533
            FF  +I  I+ +T F    FD  +F + YI + + A+ ++G +L +R +   K ED+D+
Sbjct: 521 CFFITVIIFIQGFTAF-SPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFFWKVEDIDI 579

Query: 534 YTFKAAID 541
            T +  ID
Sbjct: 580 DTDRREID 587

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  301 bits (770), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 170/539 (31%), Positives = 283/539 (52%), Gaps = 26/539 (4%)

Query: 6   EKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSMXXX 65
           E KN GI  + E + E      +E                ++   +K+ L+ RH+SM   
Sbjct: 35  ETKNEGIFINQENMSE------VESLY------------GNDDPDVKRDLKPRHMSMISL 76

Query: 66  XXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPL-DGFTSYAS 124
                               P   L++Y F+G + + V   LGEMA FIP+   FT Y  
Sbjct: 77  GGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQ 136

Query: 125 RYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLIN 184
           R++ PALG A GY Y F + +    +L+    ++QYW     V   VWI +F +L+   N
Sbjct: 137 RFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTF--AVPLSVWIVVFWILLTASN 194

Query: 185 TVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEA 244
            + VRF+GE EFW++++K                    +    GFRYW++PG +     +
Sbjct: 195 MIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGALGFRYWKNPGPWGMGMIS 253

Query: 245 ISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVIS 304
            +  + +              Y GTEL GI A E+KNPR++VP+AI    +RI+ FY++S
Sbjct: 254 SNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILS 313

Query: 305 ILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNS 364
           +  +G+ V Y DP L             PFV+AI+N+G  VLP +FN  +L+ + SA NS
Sbjct: 314 LFFVGLLVPYTDPRL--STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNS 371

Query: 365 DLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYF 424
           ++Y+ SR LYGL+    AP +F KTN  GVP+Y++  S +F  LAY+N+S  + ++F++ 
Sbjct: 372 NIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWL 431

Query: 425 VNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLI 484
           + + ++ G  +W+ I ++++RF + +  +   ++   + A F PW  + + FF  +I LI
Sbjct: 432 LTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILI 491

Query: 485 KNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI-KPEDVDLYTFKAAIDA 542
           + +  F    F +  FI+ YI + ++ +C++G++++ +++LI + EDVD+ T +  IDA
Sbjct: 492 QGFDSF-APEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREIDA 549

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  302 bits (773), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 180/555 (32%), Positives = 284/555 (51%), Gaps = 29/555 (5%)

Query: 2   SESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGI---RLKKALEAR 58
           S    KKN  I+Y+ ++  +D                     GK        LK+ L++R
Sbjct: 44  SNDNNKKNPQIIYNEKSYSQDELQTTSPTIIDSIDDEAEKEQGKERSSSNGELKQGLKSR 103

Query: 59  HVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDG 118
           H+ +                       PA + ISY  +   VY +M  LGEM  F+P +G
Sbjct: 104 HIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIMNALGEMVCFLPGNG 163

Query: 119 FTSYAS------RYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVW 172
             S  S      +YVDP+LGFA  + Y + + I+   +++A + V++YW   E V  G W
Sbjct: 164 SDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVIEYWAWAEHVPKGAW 223

Query: 173 ITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT-GFRY 231
           ITIFL LIV++N + V  +GE EFW +S+K                   P  D   GFRY
Sbjct: 224 ITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFWGGGPKSDGILGFRY 283

Query: 232 WRDPGAFKPYSEAISGSKGKXXXXXXXXXXXX--XXYTGTELCGIVAAEAKNPRRSVPRA 289
           W++PG+F  +   I+G  G                   G EL  + ++E  + RR++ +A
Sbjct: 284 WKNPGSFAHH---ITGGGGGNFLDIYTGIIKGGFSVILGPELVCLTSSECADQRRNIAKA 340

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXX-XXPFVVAIKNAGIPVLPH 348
            K  ++R++ FY++  L +G+ VAYNDP+L              PFV+ I+NAGI  +PH
Sbjct: 341 SKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFVIGIQNAGIRAVPH 400

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           I N C+L   +SA N+ ++ +SR+L  +A +  APKIF + N  GVPY ++  S+L   L
Sbjct: 401 IVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVPYTAVGASLLLSCL 460

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF-- 466
           AY+NVSS +A +FN+F N+ +I G + WI   + Y+RF KA+       +  ++  PF  
Sbjct: 461 AYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAIT-----YNKLTHRIPFRA 515

Query: 467 --QPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK 524
             Q ++ W SLF+  LI L   Y +F+   ++ K FI+ YI +P++ + ++G+K+  R+ 
Sbjct: 516 KGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWIGHKVFTRTL 575

Query: 525 L---IKPED-VDLYT 535
           L   ++P D +D+YT
Sbjct: 576 LKAWLRPIDKIDVYT 590

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  300 bits (768), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 168/502 (33%), Positives = 267/502 (53%), Gaps = 8/502 (1%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +G +    +K+AL+ARH+SM                       P   LI+Y F+G +VY+
Sbjct: 52  EGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYS 111

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           +   LGEMA FIP+    T ++ R++ PA G A GY Y F + I    +L+    ++ YW
Sbjct: 112 ITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYW 171

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
            S   V  G WITIF +++ L+N   VRF+GE EFW++SVK                   
Sbjct: 172 TS--VVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGS 229

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
            +    GFR WR+PG +     + + ++ +              Y GTEL GI A E+KN
Sbjct: 230 -SQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKN 288

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PR++VP+AI    +RI+ FY++S+  +G+ V YNDP +             PFV++I+NA
Sbjct: 289 PRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRM--DNTSDTDVNASPFVISIRNA 346

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G  +LP IFNA VL+ V SA NS++Y+ SR +Y LA    APK F   N  GVP   + V
Sbjct: 347 GTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMV 406

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           + L  L+A++ V++ +   FN+ VN+ ++ GL +W+ I + ++RF + +  +   +    
Sbjct: 407 TALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALP 466

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           + A F PW+ + +  F  +I  I+ YT F    FD   F + YI + +  + ++G ++ +
Sbjct: 467 FKAKFMPWAAYYAASFVFVIIFIQGYTAF-SPKFDVTQFFTAYISLMLMLVVFIGCQIYY 525

Query: 522 RSKLI-KPEDVDLYTFKAAIDA 542
           + + + K ED+D+ T +  IDA
Sbjct: 526 KCRFLWKLEDIDIDTNRREIDA 547

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  298 bits (763), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 162/447 (36%), Positives = 249/447 (55%), Gaps = 9/447 (2%)

Query: 86  PASILISYSFVGLLVYTVMACLGEMAAFIPLD-GFTSYASRYVDPALGFAVGYCYLFKYF 144
           P SI ++Y F G ++  V+  L EMAAF P+D GF+ Y ++YVDPA GFA G+ Y  KY 
Sbjct: 68  PISIFLAYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYA 127

Query: 145 IVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXX 204
           IV    LTA  +V+ YW  R  +N  VW+T+      ++N + VR+FG+ E +++  K  
Sbjct: 128 IVLSANLTAFGLVIGYW--RPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLT 185

Query: 205 XXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX 264
                            P+H   GFRYWR+ G F PY   + G+ GK             
Sbjct: 186 ILLLIFIVCLVITCGGGPDHTTIGFRYWRESG-FLPY--LVKGNTGKFLGWWACVIQSIF 242

Query: 265 XYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXX 324
            + G+E+ GI+  E  NPR+++P+A +  + RI +FY+  + +LG+ V+ ++  L+    
Sbjct: 243 GFMGSEMIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHAHS 302

Query: 325 XXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPK 384
                   PFV+AI  +GI VLP   NA +L+F+ S+  +D+Y+ SR LYGLA D  APK
Sbjct: 303 TDANAS--PFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPK 360

Query: 385 IFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYL 444
           IF + N   +P     V  L   LAYMN    +A +F Y  + VS+FG+L+W  IL+ Y+
Sbjct: 361 IFLRLNKHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYI 420

Query: 445 RFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGY 504
            + + V +         +  PFQP++ +++LFF  +I     Y+ F+   F+YK FI+ Y
Sbjct: 421 HYDRVVKSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFI-LKFNYKLFITSY 479

Query: 505 IGIPVYAICYVGYKLVHRSKLIKPEDV 531
           IGI    +  +GYKL +++K +KPE++
Sbjct: 480 IGIFANVLLVLGYKLYYKTKWVKPEEI 506

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  300 bits (767), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 172/502 (34%), Positives = 271/502 (53%), Gaps = 9/502 (1%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +G+ +   +K+ L+ RH+ M                       P   LISY F+G L Y+
Sbjct: 76  EGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYS 135

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   LGEMA FIP+   FT ++ R++ PA G A GY Y F + I    +L+    V+Q+W
Sbjct: 136 VTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFW 195

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
               KV    WI+IF V+I ++N   V+++GEFEFW++S+K                   
Sbjct: 196 TY--KVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAG 253

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
                 GFRYWR+PGA+ P   +   ++G+              + GTEL GI A EA N
Sbjct: 254 VTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAAN 312

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PR+SVPRAIK  ++RI+ FY+ S+L +G+ V YNDP L             PF++AI+N+
Sbjct: 313 PRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TQSTSYVSTSPFIIAIENS 369

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G  VLPHIFNA +L  + SA NS++YV SR L+GL+ ++ APK  ++T   GVPY ++ V
Sbjct: 370 GTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFV 429

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           +  F  LAYM  S+G  ++F + +N+  + G  +W+ I I+++RF +A+  +   +    
Sbjct: 430 TAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELP 489

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           + A   P   + +  F  +I +I+ +T F    F+  +F + YI I ++   ++ ++ + 
Sbjct: 490 FKAKLMPGLAYYAATFMTIIIIIQGFTAF-APKFNGVSFAAAYISIFLFLAVWILFQCIF 548

Query: 522 RSKLI-KPEDVDLYTFKAAIDA 542
           R + I K  DVD+ + +  I+A
Sbjct: 549 RCRFIWKIGDVDIDSDRRDIEA 570

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  300 bits (768), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 177/495 (35%), Positives = 259/495 (52%), Gaps = 9/495 (1%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           R+K+AL+ RH+ M                       P   LI+Y F+G ++Y V   LGE
Sbjct: 90  RVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLGE 149

Query: 110 MAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           MA FIP+    T ++ R++ PA G A GY Y F + I    +++    V+QYW    KV 
Sbjct: 150 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTF--KVP 207

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
              WI IF VLI L+N   V+ +GEFEFW++S+K                    +    G
Sbjct: 208 LAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGS-HQGPIG 266

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
           FRYWR+PGA      +    + +              Y GTEL GI A EA NPR+SVPR
Sbjct: 267 FRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 326

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           AI   ++RIVLFY++S+  +G+ V YNDP L             PFV++I+NAG  VLP 
Sbjct: 327 AINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASS---PFVISIQNAGTKVLPD 383

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           IFNA VL+ V SA NS++YV SR LY LA    APK FA     GVPY  +  + L  LL
Sbjct: 384 IFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLL 443

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           A++ V+  +   FN+ +N+ ++ GL +W+ I + ++RF +A+  +   +    + A F P
Sbjct: 444 AFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMP 503

Query: 469 WSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI-K 527
           W  + + FF  +I  I+ +  F    FD   F + YI + +  + + G +L +R + + K
Sbjct: 504 WGAYYASFFVTVIIFIQGFQAF-APKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWK 562

Query: 528 PEDVDLYTFKAAIDA 542
            ED+D+ + +  IDA
Sbjct: 563 LEDIDIDSDRREIDA 577

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  300 bits (768), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 177/536 (33%), Positives = 275/536 (51%), Gaps = 24/536 (4%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           + +++  R+K+AL+ RH+ M                       P   LI+Y F+G +VY 
Sbjct: 96  EAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYF 155

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   LGEMA FIP+    T ++ R++ PA G A GY Y F + I    +++    V+QYW
Sbjct: 156 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYW 215

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
              + V    WI IF V++ L+N   V+ +GEFEFW++S+K                   
Sbjct: 216 T--KAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGS 273

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
            +    GFRYWR+PG + P   +    + +              Y GTEL GI A EA N
Sbjct: 274 -HQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAAN 332

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PR+SVPRAI   ++RI LFY++S+  +G+ V +ND  L             PFV++I+NA
Sbjct: 333 PRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRL---ANDSAVIASSPFVISIQNA 389

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G   LP IFNA VLL + SA NS++YV SR LY LA+   APKIF+    +GVPY  +  
Sbjct: 390 GTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVIC 449

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           +    LLA++ V++ +   FN+ +N+ ++ GL +W+ I ++++RF +A+  +   +    
Sbjct: 450 TAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLP 509

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           + A   PW  + + FF  +I  I+ +  F    FD  TF + YI + + A+ + G +L +
Sbjct: 510 FKAKLMPWGAYYASFFVTVIIFIQGFQAFT-PKFDVSTFFTSYISLILLAVLFSGCQLYY 568

Query: 522 RSKLI-KPEDVDLYTFKAAIDAXXXXXXXXXXXXXXXXXSSPKNLTWFYDTFLGWI 576
           R + I K ED+D+ + +  I+A                   PKNL   ++ F  W+
Sbjct: 569 RCRFIWKVEDIDIDSDRREIEA------------IIWEEDEPKNL---WEKFWAWV 609

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  298 bits (764), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 173/510 (33%), Positives = 269/510 (52%), Gaps = 17/510 (3%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           D K EG +L++ L ARH+ +                       PA + ISY  +  ++Y 
Sbjct: 49  DAKLEG-KLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYP 107

Query: 103 VMACLGEMAAFIPLDGFTSYAS------RYVDPALGFAVGYCYLFKYFIVTPNQLTAGAM 156
           +M   GEM  ++P +G  S  S      RYVDP+L FA G+ Y + Y I+   + TA + 
Sbjct: 108 IMNAFGEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASG 167

Query: 157 VMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXX 216
           V++YW   + V    WITIFL ++VL+N   V+++GE EFW +S+K              
Sbjct: 168 VVKYWT--DAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFIL 225

Query: 217 XXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIV 275
                PNHDR GFRYW++PG F  +     G+ G               +  G EL  + 
Sbjct: 226 FWGGGPNHDRLGFRYWKNPGGFAHH--ITGGNLGNFLDVYSGIIKGAFAFILGPELIALA 283

Query: 276 AAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXX-XXXXXPF 334
           ++E K+ RR++ +A K  ++R++ FY++  L + + VA NDP L              PF
Sbjct: 284 SSECKDQRRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPF 343

Query: 335 VVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGV 394
           V+ I+NAGI +LPHI NAC+L   +SA N+ ++ +SR+L  +A + +APKIF K N +GV
Sbjct: 344 VIGIQNAGIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGV 403

Query: 395 PYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQF 454
           P+ ++  S L   LAY+NVSS +A +F +F N+ +I G + W   L+ YLRF KA I   
Sbjct: 404 PWVAVTFSALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKA-IKYN 462

Query: 455 GDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICY 514
           G ++   Y   FQ +  W S+    L+     Y VF+   ++   FI+ YI +P++ + +
Sbjct: 463 GLENRLPYAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLW 522

Query: 515 VGYKLVHRS--KLIKP-EDVDLYTFKAAID 541
           +G+K+  R   K   P E++D+ T    I+
Sbjct: 523 IGHKIYTRDFKKWWYPVEEIDVVTGLTEIE 552

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  299 bits (765), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 176/499 (35%), Positives = 264/499 (52%), Gaps = 11/499 (2%)

Query: 46  HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMA 105
           HE  ++K+AL+ RH+ M                       P   LI+Y F+G ++Y V  
Sbjct: 88  HE-TKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYFVTQ 146

Query: 106 CLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSR 164
            LGEMA FIP+    T ++ R++ PA G A GY Y F + I    +++    V+QYW   
Sbjct: 147 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWT-- 204

Query: 165 EKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNH 224
           + V    WI IF VL+ L+N   V+ +GE EFW++ VK                    + 
Sbjct: 205 KAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVGYLIYALVIVCGGS-HQ 263

Query: 225 DRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRR 284
              GFRYWR PGAF P   + + + GK              Y GTEL GI A EA NPR+
Sbjct: 264 GPIGFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAANPRK 323

Query: 285 SVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIP 344
           +VPRAI   ++RIVLFY++S+  +GM + YND  L             PFV++IKNA   
Sbjct: 324 TVPRAINKVVFRIVLFYIMSLFFIGMLLPYNDKRL---SAQDAVIASSPFVISIKNAHTK 380

Query: 345 VLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVL 404
           VLP IFNA V++ V SA NS++YV SR LY LA+   APK F+    +GVPY  +  +  
Sbjct: 381 VLPDIFNAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTAS 440

Query: 405 FCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTA 464
             LLA++ V++ +   FN+ +N+ ++ GL +W+ I + ++RF +A+  +   +    + A
Sbjct: 441 LGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKA 500

Query: 465 PFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK 524
              PW  + + FF  +I  I+ Y  F    +D  TF + YI + + A+  VG +L +R +
Sbjct: 501 KLMPWGAYYAAFFVTVIIFIQGYQAFC--PWDVSTFFTSYISLILLAVLVVGCQLYYRGR 558

Query: 525 -LIKPEDVDLYTFKAAIDA 542
            L+K ED+D+ T +  I++
Sbjct: 559 FLLKLEDIDIDTDRREIES 577

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  297 bits (761), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 167/500 (33%), Positives = 261/500 (52%), Gaps = 9/500 (1%)

Query: 44  GKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTV 103
           G  +  ++K+AL+ RH+SM                       P   LI+Y F+G L Y V
Sbjct: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94

Query: 104 MACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
              LGEMA FIP+   F  +  R++ PALG A GY Y   + I    +L+    V+Q+W 
Sbjct: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
             + V    WI I  V++V  N   V+F+GE EFW++ +K                    
Sbjct: 155 --DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGK 212

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
                GFRYWR+PG + P   +   ++G+              Y GTEL GI A EA NP
Sbjct: 213 TGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANP 271

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           R++VPRAI    +RI+ FY++S+L +G+ V +NDP L             PFV+AI+N+G
Sbjct: 272 RKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSPFVIAIENSG 328

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
             VLPHIFNA +L  + SA NSD+Y++SR LY + ++  APK    T   G+PY ++  +
Sbjct: 329 TKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTT 388

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
            L   LAY+  S G++ +F++ +N+ ++ G  +W+ I + ++RF +A+  Q   +    +
Sbjct: 389 SLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPF 448

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            A F PW  + + FF  +I +I+ +T F    F+   F + Y+ + ++   ++G+++  R
Sbjct: 449 KAKFMPWGAYYAAFFIGVIIIIQGFTAF-APKFNVSDFFTAYVSVILFFAVWIGFQIWFR 507

Query: 523 SKLIKP-EDVDLYTFKAAID 541
             L K  ED+DL T +  ID
Sbjct: 508 GPLFKKTEDIDLDTDRREID 527

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  296 bits (758), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 175/491 (35%), Positives = 272/491 (55%), Gaps = 9/491 (1%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           L++  + RHV M                       P S+LI++ F G L+  V+  L EM
Sbjct: 46  LQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEM 105

Query: 111 AAFIPLD-GFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A+F P+D  F+ YA+RYVDPALGFA G+ Y  KY I   ++L+A  +++QYW  RE ++ 
Sbjct: 106 ASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQYW--REDLSI 163

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
            ++I +FLV+++ +N + ++F+GE EFW + +K                   P+ +  GF
Sbjct: 164 AIFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGF 223

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           RYWR+  AF PY   + G+ G+              Y G+E  G+V  EA NP++++P A
Sbjct: 224 RYWREY-AFVPY--LVKGTTGRFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAA 280

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            +  ++RI  FY++ +L+LG+ ++ +D  L             PFV+A  NAGI  LP  
Sbjct: 281 TRNVIFRITGFYIVGVLILGLIISPHDKTL--ANAKTSDASGSPFVIAFTNAGIKGLPSF 338

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            NA +++F+ SA N+ LYV SRT YGLA D  APKIF   N +GVP+    ++ L  LL+
Sbjct: 339 INAMLIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLS 398

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           +MN+S+ S+ IF Y  + V++FG L+W+S+LI+Y+ + +A +     +    +   FQP+
Sbjct: 399 FMNISNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPRDRIPFRMWFQPY 458

Query: 470 STWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPE 529
           S +V LFF  LI     Y+ F+   F YK+FI  YIGI V+    + +K   +S   +PE
Sbjct: 459 SAYVCLFFVSLIIFFNGYSAFIAG-FKYKSFIVSYIGIAVFIGNTLFWKFWKKSAATRPE 517

Query: 530 DVDLYTFKAAI 540
           D+     + AI
Sbjct: 518 DLRSIMVEEAI 528

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  296 bits (759), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 175/499 (35%), Positives = 263/499 (52%), Gaps = 10/499 (2%)

Query: 46  HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMA 105
           +E   +K+AL+ RH+ M                       P   LISY F+G +VY +  
Sbjct: 102 YEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQ 161

Query: 106 CLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSR 164
            LGEMA FIP+    T ++ R++ PA G A GY Y F + I    +++    V+QYW   
Sbjct: 162 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWT-- 219

Query: 165 EKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNH 224
           +KV   VWI IF VLI L+N   V+ +GEFEFW++SVK                    + 
Sbjct: 220 DKVPLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-HQ 278

Query: 225 DRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRR 284
              GFRYWR+PGA+ P   +   ++G+              Y GTEL GI A EA NPR+
Sbjct: 279 GPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 338

Query: 285 SVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIP 344
           +VPRAI   ++RIVLFY++S+  +G+ V YN+P L             PFV++I+NAG  
Sbjct: 339 TVPRAINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASS---PFVISIQNAGTY 395

Query: 345 VLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVL 404
            LP IFNA VL+ V SA NS++YV SR LY LA    APK F      GVPY  +  +  
Sbjct: 396 ALPDIFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAA 455

Query: 405 FCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTA 464
             LLA++ V++ +   FN+ +N+ ++ GL +W+ I + ++RF +A+  +   +    + A
Sbjct: 456 LGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKA 515

Query: 465 PFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK 524
              P+  + + FF  +I  I+ +  F    F    F + YI + + A+ + G +L ++ +
Sbjct: 516 KLMPYGAYYAAFFVTVIIFIQGFQAFC--PFKVSDFFTSYISLILLAVVFTGCQLYYKCR 573

Query: 525 LI-KPEDVDLYTFKAAIDA 542
            I K ED+D+ T +  I+A
Sbjct: 574 FIWKLEDIDIDTDRREIEA 592

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  295 bits (755), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 170/494 (34%), Positives = 260/494 (52%), Gaps = 10/494 (2%)

Query: 44  GKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTV 103
           G H+  R+K+AL+ RH+ M                       P   LI+Y F+G +VY +
Sbjct: 61  GYHD-TRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFI 119

Query: 104 MACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
              LGEMA FIP+    T ++ R++ PA G A GY Y F + I    +++    V+Q+W 
Sbjct: 120 TQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFWT 179

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
           S   V    WI IF V + L+N   V+ +GE EFW++S+K                    
Sbjct: 180 S--AVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGS- 236

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
           +    GFRYWR+PG + P   +   ++G+              Y GTEL GI A EA NP
Sbjct: 237 SQGPIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 296

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           R+SVPRAI   ++RIV+FY++S+  +GM V +NDP L             PFV++I+NAG
Sbjct: 297 RKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRL---ASNVAVIASSPFVISIQNAG 353

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
             VLPHIFNA V+L + SA NS++YV SR LY L+    APK F      GVPY  +  +
Sbjct: 354 TRVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIAT 413

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
            L  LLA++ V++ +   FN+ +N+ ++ GL +W+ I ++++RF +A+  +   +    +
Sbjct: 414 SLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPF 473

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            A   PW  + + FF  +I  I+ +  F    FD   F + YI + +  +  +G +L +R
Sbjct: 474 KAKLMPWGAYYAAFFVTVIIFIQGFEAF-SPKFDVSGFFTAYISLIILVVLLIGCQLYYR 532

Query: 523 SKLI-KPEDVDLYT 535
            + + K ED+D+ T
Sbjct: 533 CRFLWKLEDIDIDT 546

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  295 bits (755), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 166/494 (33%), Positives = 266/494 (53%), Gaps = 8/494 (1%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            +++ L+ RH+ M                       P   LISY F+G ++Y+V   LGE
Sbjct: 65  EVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124

Query: 110 MAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           MA FIP+   F+ +A R++ PALG   GY Y   +      +L+    ++QYW     V 
Sbjct: 125 MATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWT--HAVP 182

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
              WI IF  L+ L+N   V+++GEFEF ++S+K                         G
Sbjct: 183 LAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIG 242

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
           FRYWR+PGA+ P   + + ++G+              Y GTEL GI A EA NPR++VPR
Sbjct: 243 FRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPR 302

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           AIK  + RI++FY++S+  +G+ V YNDP L             PF+++I+N+G  VLP 
Sbjct: 303 AIKKVVIRILVFYILSLFFIGLLVPYNDPKL---DSDGTFVSASPFMISIENSGTKVLPD 359

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           IFNA VL+ +FSA NS++Y+ SR LY L+ +  APK  +     GVPY ++ ++ LF  L
Sbjct: 360 IFNAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFL 419

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           A++  S+GS + FN+ +N+  + G  +W+ I  +++RF +A+  +   +    Y A   P
Sbjct: 420 AFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMP 479

Query: 469 WSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI-K 527
           +  + + FF  LI LI+ +T F   TF    F++ YI + ++AI ++ ++L  + +LI K
Sbjct: 480 FLAYYASFFIALIVLIQGFTAF-APTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICK 538

Query: 528 PEDVDLYTFKAAID 541
            +D+D+ + +  I+
Sbjct: 539 LQDIDIDSDRREIE 552

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  295 bits (754), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 180/552 (32%), Positives = 276/552 (50%), Gaps = 39/552 (7%)

Query: 1   MSESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHV 60
           + +   KK++G L    T+  D + + LE                     LK+ L++RHV
Sbjct: 41  LDDRFNKKDSG-LNKVLTVSSDTSTNSLEEDYTNT---------------LKQGLKSRHV 84

Query: 61  SMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFT 120
            +                       PA + I+Y  +  ++Y +M  +GEM  ++P DG  
Sbjct: 85  QLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEMVCYLPGDGHD 144

Query: 121 SYAS------RYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWIT 174
           S  S      RYVD +L FA G+ Y + Y I+   + TA A V++YW     V    WIT
Sbjct: 145 SAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWT--LAVPKAAWIT 202

Query: 175 IFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRD 234
           IFL +I L+N   V++FGE EFW +S+K                   P+HDR GFRYW++
Sbjct: 203 IFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGGGPSHDRLGFRYWKN 262

Query: 235 PGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLT 293
           PGAF  +     GS G               +  G EL  + ++E  + RR++ +A K  
Sbjct: 263 PGAFAHH--VTDGSLGNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRNIAKASKRF 320

Query: 294 LYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXX-XXXXXPFVVAIKNAGIPVLPHIFNA 352
           +YR++ FY++  L +G+ VA+NDP+L              PFV+ I+NAGI VLPHI NA
Sbjct: 321 IYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIEVLPHIINA 380

Query: 353 CVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMN 412
           C+L   +S+ N+ ++ +SR+L+ +A +  APKIF + N +GVPY ++ +S L   LAY+N
Sbjct: 381 CILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTLISCLAYLN 440

Query: 413 VSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVI-AQFGDKSGFSYTAPFQPWST 471
            SS +A++F +  N+ +I G L WI   I YLRF KA+      D+  F      QP+  
Sbjct: 441 ASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNLYDRMPFKTWG--QPYLI 498

Query: 472 WVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKP--- 528
             SL    +I +   Y  F+   ++   FI+ YI +P++   YVG+K+ +  K   P   
Sbjct: 499 LWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKVYNHFKNDYPLMK 558

Query: 529 -----EDVDLYT 535
                ED+D+ T
Sbjct: 559 LAYSVEDIDVIT 570

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  294 bits (753), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 171/507 (33%), Positives = 266/507 (52%), Gaps = 14/507 (2%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +  +E  ++K+ L+ RH+ M                       P   LI+Y F+G +VY 
Sbjct: 76  EADYEDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYF 135

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   LGEMA FIP+    T ++ R++ PA G A GY Y F + I    +++    V+QYW
Sbjct: 136 VTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYW 195

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
              + V    WI IF VL+ L+N   V+ +GE EFW++ +K                   
Sbjct: 196 T--DAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGS 253

Query: 222 PNHDRTGFRYWRDPGAF----KPYSEAISGSK--GKXXXXXXXXXXXXXXYTGTELCGIV 275
                 GFRYWR+PGA+        E I  SK  G+              Y GTEL GI 
Sbjct: 254 KKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGTELVGIT 313

Query: 276 AAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFV 335
           A EA NPR++VPRAI   ++RIVLFY++S+  +G+ V + D  L             PFV
Sbjct: 314 AGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRL---SDDTTVIASSPFV 370

Query: 336 VAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVP 395
           ++I+NAG  +LP IFNA V++ V SA NS++YV SR LY LA  + APKIFA+    GVP
Sbjct: 371 ISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVP 430

Query: 396 YYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFG 455
           +  +  + L  LLA++ V + +   FN+ V++ ++ GL +W+ I + ++RF + +  +  
Sbjct: 431 FMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGI 490

Query: 456 DKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYV 515
            +    + A F PW ++ + F+  +I  ++ +  F  H FD  TF + YI + + A+ ++
Sbjct: 491 SRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPH-FDVTTFFTDYISLILLAVVFI 549

Query: 516 GYKLVHRSKLI-KPEDVDLYTFKAAID 541
           G +L +R + + K EDVD+ + +  I+
Sbjct: 550 GAQLYYRCRFLWKLEDVDIDSDRREIE 576

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  293 bits (751), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 175/488 (35%), Positives = 253/488 (51%), Gaps = 9/488 (1%)

Query: 44  GKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTV 103
           G  E  ++K+ L+ RH+ M                       P   LI+Y F+G LV++V
Sbjct: 95  GVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSV 154

Query: 104 MACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
              LGEMA FIP+   FT +ASR+V    G A GY Y F + I    +L+    V+++W 
Sbjct: 155 TQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWT 214

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
              KV    WI+IF VLIV++N   V+ +GEFEFW++S+K                    
Sbjct: 215 F--KVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGI 272

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
                GFRYWR PG + P   +   ++ +              Y GTEL GI A EA NP
Sbjct: 273 TGP-VGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANP 331

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           R+SVPRAIK    RI+LFY++S+  +G+ V YNDP L             PF++AI+N+G
Sbjct: 332 RKSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKL---SSTDSYVSASPFIIAIQNSG 388

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
             VLPHIFNA +L  + SA NS++YV SR LYGL+  + APK F KT   GVP+ ++  +
Sbjct: 389 TKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKTRN-GVPFIAVLFT 447

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
             F  LAYM  S+G    FN+ +N+  + G  +W+SI I+++RF + +  +   +    Y
Sbjct: 448 AAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPY 507

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            A   P   +   FF  LI LI+ +T F    FD   F++ YI   ++   Y+  +   R
Sbjct: 508 KAALMPGLAYYGAFFVTLIILIQGFTAF-APKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566

Query: 523 SKLIKPED 530
           ++L +  D
Sbjct: 567 TRLWRTLD 574

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  293 bits (750), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 173/499 (34%), Positives = 264/499 (52%), Gaps = 10/499 (2%)

Query: 46  HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMA 105
           +E   +++AL+ RH+ M                       P   LI+Y F+G +VY V  
Sbjct: 101 YEDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQ 160

Query: 106 CLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSR 164
            LGEMA FIP+    T ++ R++ PA G + GY Y F + I    +++    V++YW + 
Sbjct: 161 SLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTT- 219

Query: 165 EKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNH 224
            KV  GVWI IF VLI L+N   V+ +GEFEFW++SVK                      
Sbjct: 220 -KVPLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-KQ 277

Query: 225 DRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRR 284
              GFRYWR+PGA+ P   +   ++G+              Y GTEL GI A EA NPR+
Sbjct: 278 GPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 337

Query: 285 SVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIP 344
           +VPRAI   ++RIVLFY++S+  +G+ V Y DP L             PFV++I+NAG  
Sbjct: 338 TVPRAINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASS---PFVISIQNAGTY 394

Query: 345 VLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVL 404
            LP IFNA VL+ V SA NS++YV SR LY LA    APK F      GVPY  +  +  
Sbjct: 395 ALPDIFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAA 454

Query: 405 FCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTA 464
             LLA++ V++ +   FN+ +N+ ++ GL +W+ I ++++RF +A+  +   +    + A
Sbjct: 455 LGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKA 514

Query: 465 PFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK 524
            F P+  + + FF  +I  I+ +  F    F    F + YI + + A+ + G +L ++ +
Sbjct: 515 KFMPYGAYYASFFVTVIIFIQGFQSFC--PFRVADFFTSYISLILLAVVFTGCQLYYKCR 572

Query: 525 LI-KPEDVDLYTFKAAIDA 542
            I K ED+D+ + +  I+A
Sbjct: 573 FIWKLEDIDIDSDRREIEA 591

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  293 bits (750), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 175/501 (34%), Positives = 259/501 (51%), Gaps = 10/501 (1%)

Query: 44  GKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTV 103
           GK    ++K+AL+ RH+ M                       P   LI+Y F+G +VY V
Sbjct: 95  GKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFV 154

Query: 104 MACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
              LGEMA FIP+    T +  R++ PALG + GY Y F + I    +L+    ++QYW 
Sbjct: 155 TQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWT 214

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
              KV    WI IF V++ ++N   V+ +GE EFW+SSVK                    
Sbjct: 215 --YKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGS- 271

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
                GFRYWR   AF     + +  + +              Y GTEL GI A EA NP
Sbjct: 272 RQGPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANP 331

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           R++VPRAI   ++RI LFY++S+  +G+ V YND  L             PFV+++ NAG
Sbjct: 332 RKTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRL---SDGSAIIASSPFVISMLNAG 388

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
              LP IFNA +L+ V SA NSD+Y+ASR LY LA    APK F   N +GVPY  + V+
Sbjct: 389 TSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVT 448

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
            L   LA++ VS+ +   FN+ +N+ ++ GL +W  I   ++RF +A+  +   +    +
Sbjct: 449 CLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPF 508

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            A F PW  + + FF  LI  I+ Y  F    +D K+F + YI + ++ + Y+G  + +R
Sbjct: 509 KARFMPWGAYYAAFFVGLIIFIQGYDAFT--PWDTKSFFTSYISLILFGVLYLGCLIYYR 566

Query: 523 SK-LIKPEDVDLYTFKAAIDA 542
            + LIK ED+D+ T +  ++A
Sbjct: 567 GRLLIKIEDIDIDTDRKEVEA 587

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  291 bits (746), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 174/506 (34%), Positives = 266/506 (52%), Gaps = 12/506 (2%)

Query: 42  VDGKHEGIR---LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGL 98
           VDG+   +R   +K+AL+ RH+ M                       P  +LI+Y F+  
Sbjct: 62  VDGEKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMAT 121

Query: 99  LVYTVMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMV 157
           + ++VM  LGEMA +IP+   F+ ++ R++ PA G A GY Y F + I    +L+    +
Sbjct: 122 IAFSVMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQI 181

Query: 158 MQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXX 217
           +QYW    KV    WI+IF VLI  +N   V+F+GEFEFW++ +K               
Sbjct: 182 VQYWTF--KVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMV 239

Query: 218 XXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAA 277
                     GFRYWR   AF     + + ++ +              Y GTEL GI A 
Sbjct: 240 CGAGKTGP-VGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAG 298

Query: 278 EAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVA 337
           EA NPR++VP++IK TL+RI++FY+ S+L +G+ V +ND  L             PF++A
Sbjct: 299 EAANPRKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGL---QDSRSYAASSPFILA 355

Query: 338 IKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYY 397
           IKN+G   LP IFNA +L  V SA NSD+YV SR +Y +A +R AP I AK +  GVPY 
Sbjct: 356 IKNSGTKALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYA 415

Query: 398 SLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDK 457
           ++  +     LAY+  SS  A +FN+ +N+  + G  SW  I  ++LRF KA+  +   +
Sbjct: 416 AVLFTSAIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISR 475

Query: 458 SGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGY 517
           +   + A F PW    S FF  LI L++ +T F  H F    F++ YI + ++ + +  +
Sbjct: 476 NDLPFKASFMPWIAIYSFFFMTLIILVQGFTCFTPH-FQASDFVASYISVGLFFVIWAVF 534

Query: 518 KLVHRSKLIKP-EDVDLYTFKAAIDA 542
           ++  R  L+ P  ++D+ T +  +DA
Sbjct: 535 QIWFRCPLLVPIAEIDIDTDRRDVDA 560

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  292 bits (748), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 174/502 (34%), Positives = 276/502 (54%), Gaps = 9/502 (1%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +G  +   +K+ L+ RH+ M                       P   LI+Y F+  +V++
Sbjct: 89  EGVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFS 148

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   LGEMA FIP+   FT ++SR++ PA+G A GY Y F + +    +L+    ++Q+W
Sbjct: 149 VTQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFW 208

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
                V    WI I+ V++ ++N   V+F+GEFEFW++S+K                   
Sbjct: 209 T--HAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAG 266

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
                 GFRYWR+PG + P   +   ++G+              Y GTEL GI A EA N
Sbjct: 267 VTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 325

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PR++VPRAIK   +RI++FY++S+  +G+ V Y+D  L             PF++AI+N+
Sbjct: 326 PRKTVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKL---TSTDSYISASPFIIAIENS 382

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G  +LPHIFNA +L  + SA NS++YV SR L+GLA  + APK F  T+  GVPYYS+  
Sbjct: 383 GTKILPHIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFF 442

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           +  F  LA++ VSSG A+ FN+ +N++S+ G  +W+ I I ++RF +A+  +   +    
Sbjct: 443 TSSFGALAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLP 502

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           + A F P   + S+FF  +I +I+ +T F   TF+   F++ YI I ++   ++ ++L  
Sbjct: 503 FKARFMPHLAYYSIFFMTIIIIIQGFTAF-APTFNGSDFVAAYISIFLFFFLWLCFQLYF 561

Query: 522 RSKLI-KPEDVDLYTFKAAIDA 542
           RSKL+   E+VD+ T +  +DA
Sbjct: 562 RSKLLWTVEEVDIDTDRRDVDA 583

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  291 bits (744), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 189/546 (34%), Positives = 282/546 (51%), Gaps = 20/546 (3%)

Query: 3   ESLEKKNAGILYSNE-TLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVS 61
           +S EK+    L+ NE  + E+     L                +  GI  ++AL+ RHVS
Sbjct: 4   QSFEKQPQ--LHKNEIKVMEEGESSSLADGVLEQQSQIDTASSQERGI--QRALKPRHVS 59

Query: 62  MXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPL-DGFT 120
           M                       P   LISY F+G L + V   LGEMA FIP+   FT
Sbjct: 60  MIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMATFIPVASSFT 119

Query: 121 SYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLI 180
            +  R++ PALG A GY Y F + I    +L+    ++QYW     V    WI IF V I
Sbjct: 120 VFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTL--GVPNAAWIIIFWVPI 177

Query: 181 VLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKP 240
            L N V V+F+GEF+FW++ +K                         GFRYWR+PG   P
Sbjct: 178 SLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGP-VGFRYWRNPG---P 233

Query: 241 YSEAI---SGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRI 297
           + + I   S S+G+              Y GTEL G+ A E+ NPR++VP+AI+    RI
Sbjct: 234 WGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRI 293

Query: 298 VLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLF 357
           +LFYV S+  +G+ V +NDP L             PF++AI+N+G   LP IFNA +L  
Sbjct: 294 LLFYVGSLFFIGLLVPFNDPKL---DSTANYSASSPFIIAIQNSGTRALPDIFNAVILTT 350

Query: 358 VFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGS 417
           + SA NS++YV SR LYGLA +  APKI  + N  GVPY  + +  LF  L Y++VSSGS
Sbjct: 351 IISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGS 410

Query: 418 AQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFF 477
           A+ F++ +N+ +I G  +W+ I + ++RF +A+  Q   +    + A   PW  + + FF
Sbjct: 411 AKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFF 470

Query: 478 CCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI-KPEDVDLYTF 536
             LI +I+ +T F    F+   F + Y+ + ++   +V ++++ +S+LI K EDVD+ + 
Sbjct: 471 ILLIIIIQGFTAF-APKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDVDIDSD 529

Query: 537 KAAIDA 542
           +  I+A
Sbjct: 530 RREIEA 535

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  293 bits (749), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 177/502 (35%), Positives = 266/502 (52%), Gaps = 18/502 (3%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LKK L++RH+ +                       PA +L SY  + L++Y VM  LGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 111 AAFIPLDGFTSYAS------RYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSR 164
             F+P     S  S      RY DP+LGFA G+ Y + Y I+   + TA + V+ YW + 
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTT- 223

Query: 165 EKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNH 224
             V  G WI IFL ++ ++N   V+ +GE EFW + +K                   P H
Sbjct: 224 -AVPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTH 282

Query: 225 DRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPR 283
           DR GFRYW+ PGAF  +    +G+ G+              +  G EL  I ++EA + R
Sbjct: 283 DRLGFRYWQHPGAFAYH--ITTGNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDAR 340

Query: 284 RSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXX-XXPFVVAIKNAG 342
           R++ +A +   YR+V FYV S L +G+ V+  DP+L              PFV+AI+NA 
Sbjct: 341 RNIEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAH 400

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
           I VLPHI NAC+L   +S+ NS ++ ASR+L  +A D  AP+I  + N  GVPYY++A+S
Sbjct: 401 IKVLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALS 460

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
             F  LA++NVSSGSA+ F +F N+ +I G + WI I + YL+F KAV  + G      +
Sbjct: 461 AAFSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFR-GLYERVPF 519

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            +P QP+ T+  +    LI L   Y  F+   ++   F++ YI +P++ + +VG+K+  R
Sbjct: 520 KSPLQPYGTYFFIVVVSLICLTNGYASFV--NWNASDFVAAYITLPIFVVLWVGHKIYTR 577

Query: 523 ---SKLIKPEDVDLYTFKAAID 541
              + L+   +VD+ T  A I+
Sbjct: 578 TWSTWLLPVAEVDVTTGLAEIE 599

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  291 bits (744), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 174/541 (32%), Positives = 275/541 (50%), Gaps = 25/541 (4%)

Query: 2   SESLEK-KNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHV 60
           S S+EK  N G ++  +T     + ++LE                 E   L K L++RH+
Sbjct: 7   SASIEKADNGGYMHKVKTPHSRTSLEELETQ-----------SAGSEYNTLHKGLQSRHI 55

Query: 61  SMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDG-F 119
            +                        A +L+S+  +  +VY +M  L EM  ++P  G  
Sbjct: 56  QLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEMICYLPQQGSV 115

Query: 120 TSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVL 179
               SRYVDP+LGFA G+ Y + Y I+   +L+A A V+ YW     V    WITIFLV+
Sbjct: 116 PELVSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYW--DNPVPMAAWITIFLVV 173

Query: 180 IVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFK 239
           +V +N   V+++GE EFW +S+K                   PNHDRTGFRYW++PG   
Sbjct: 174 VVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPG--- 230

Query: 240 PYSEAIS-GSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTLYRI 297
           P++ +++ GS G+              +    EL GI   EA++ RR+  +A +  +YRI
Sbjct: 231 PFAMSLAPGSTGRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRI 290

Query: 298 VLFYVISILLLGMTVAYNDPLLIXXXXXXX-XXXXXPFVVAIKNAGIPVLPHIFNACVLL 356
           + FYV   L++G+ ++  DP LI             PFV  I NAGIPVL H+ N  +L 
Sbjct: 291 IFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHVINVAILS 350

Query: 357 FVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSG 416
             +SA NS +Y ++R +  LA +  APK   K N +GVPY ++ V  L   LAY+NV + 
Sbjct: 351 SAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTT 410

Query: 417 SAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGD-KSGFSYTAPFQPWSTWVSL 475
           SA +F +  N+ +I G + W ++ I ++RF + ++  F + +S   Y  P QP+  +   
Sbjct: 411 SANVFQWLSNICTISGFIGWFAMGIAFIRFRRGIV--FNNLQSRIPYQGPLQPYIAYYFT 468

Query: 476 FFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKP-EDVDLY 534
           F   ++ L   + VFL   ++   F++ Y+ +P+Y + Y+G+KL  R++   P E +D+ 
Sbjct: 469 FMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRWYIPVEQIDVI 528

Query: 535 T 535
           T
Sbjct: 529 T 529

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  291 bits (746), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 167/499 (33%), Positives = 269/499 (53%), Gaps = 11/499 (2%)

Query: 45  KHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVM 104
           KH  +  K+AL+ RH++M                       P   LI+Y FVG ++++V 
Sbjct: 89  KHRSV--KRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVT 146

Query: 105 ACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVS 163
             LGEM  FIP+   FT ++ R++ PA G A GY Y F + +    +L+    V+Q+W +
Sbjct: 147 QSLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTT 206

Query: 164 REKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPN 223
              V    WI IF  L+ L N   V+++GE EFW++ +K                   P 
Sbjct: 207 --AVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGP- 263

Query: 224 HDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPR 283
           H   GFRYWRDPGA+ P   A   S+ +              Y GTEL GI A EA NPR
Sbjct: 264 HGPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 323

Query: 284 RSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGI 343
           ++VP+AIK  + RI+ FYV S+  +GM V +NDP L             PF++AI+N+G+
Sbjct: 324 KAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKL---TSATSFVSSSPFIIAIQNSGV 380

Query: 344 PVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSV 403
            +LP IFN  +L+ + SA NS++YV SR L+GLA    AP+ F +T   GVP+ ++  + 
Sbjct: 381 SLLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTS 440

Query: 404 LFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYT 463
           LF  LA++ +++   ++FN+ +++V+I G  +W+ I ++++RF KA+  +   ++   + 
Sbjct: 441 LFGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFK 500

Query: 464 APFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
           A F PW  + +  F  LI LI+ +T F    F+   F++ YI + ++ I +  ++ + + 
Sbjct: 501 AIFMPWLAYYATAFIILIILIQGFTAF-APRFNVSDFVASYISLLLFVIIWGVFQAMKKC 559

Query: 524 KLI-KPEDVDLYTFKAAID 541
           ++  K ED+DL + +  I+
Sbjct: 560 RIFWKVEDIDLDSDRKDIE 578

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  291 bits (746), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 178/546 (32%), Positives = 273/546 (50%), Gaps = 12/546 (2%)

Query: 1   MSESLEKKNA--GILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEAR 58
           M  S  KK A  G L+S++        D                 G  +  R+K+AL+ R
Sbjct: 42  MEPSQRKKAAMAGKLFSDQLSYNVSVADNSSAANGDLDLSDTEEAGHVQDTRVKRALKQR 101

Query: 59  HVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPL-D 117
           H+ M                       P   LI+Y F+G ++Y +   LGEMA FIP+  
Sbjct: 102 HIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFITQSLGEMATFIPVTS 161

Query: 118 GFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFL 177
             T ++ R++ PA G   GY Y F + I    +++    V+QYW   + V    WI IF 
Sbjct: 162 SITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYWT--DAVPLAAWIAIFW 219

Query: 178 VLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGA 237
           V + L+N   V+ +GE EFW++S+K                    +    GFRYWR+PG 
Sbjct: 220 VFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGS-SQGPIGFRYWRNPGP 278

Query: 238 FKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRI 297
           + P   +   ++G+              Y GTEL GI A EA NPR+SVPRAI   ++RI
Sbjct: 279 WGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRI 338

Query: 298 VLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLF 357
            LFY++S+  +G+ V YND  L             PFV++I+NAG   LP IFNA V+L 
Sbjct: 339 ALFYIMSLFFIGLLVPYNDHTL---SSGDSYIASSPFVISIQNAGTYALPDIFNAVVMLT 395

Query: 358 VFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGS 417
           + SA NS++YV SR LY LA    APK FA     GVP+  + V+    LLA++ V++ +
Sbjct: 396 IISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLLAFLVVNNNA 455

Query: 418 AQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFF 477
              FN+ +N+ ++ GL +W  I ++++RF +A+  +   +    + A   PW  + S FF
Sbjct: 456 NTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYSAFF 515

Query: 478 CCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK-LIKPEDVDLYTF 536
             +I  I+ +  F    +D  TF + YI + +  + ++G +L +R + L+K ED+D+ T 
Sbjct: 516 VFVIIFIQGFEAFT--PWDTTTFFTSYISLILLVVVFIGCQLYYRCRFLLKVEDIDIDTD 573

Query: 537 KAAIDA 542
           +  I+A
Sbjct: 574 RREIEA 579

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  291 bits (746), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 174/548 (31%), Positives = 278/548 (50%), Gaps = 16/548 (2%)

Query: 2   SESLEKKNAGILYSNE------TLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKAL 55
           +E LEK    I ++N+      ++ + +A  +L                 H+   +K+AL
Sbjct: 47  NEILEKDKKKIAHTNQFSSDIHSITDSLARSRLPHLGDDDDEEDAEEAQYHD-TEVKRAL 105

Query: 56  EARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIP 115
           + RH+ M                       P   LI+Y F+G ++Y++   LGEMA FIP
Sbjct: 106 KQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQSLGEMATFIP 165

Query: 116 L-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWIT 174
           +    T ++ R++ PA G A GY Y F + I    +++    V++YW   +KV    WI 
Sbjct: 166 VTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWT--KKVPLAAWIA 223

Query: 175 IFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRD 234
           IF V + L+N   V+ +GE EFW++ +K                    +    GFRYWR+
Sbjct: 224 IFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGS-SQGPIGFRYWRN 282

Query: 235 PGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTL 294
           PG +     +   +  +              Y GTEL GI A EA NPR+SVPRAI   +
Sbjct: 283 PGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVV 342

Query: 295 YRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACV 354
           +RI LFY++S+  +G+ V Y+DP L             PFV++I+NAG  +LP IFNA V
Sbjct: 343 FRIALFYIMSLFFIGLLVPYDDPRL---SSDSAVVASSPFVISIQNAGTKILPDIFNAIV 399

Query: 355 LLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVS 414
           ++ V SA NS++YV SR LY LA    APK FA     GVPY  +  +    LLA++ V+
Sbjct: 400 MITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLAFLVVN 459

Query: 415 SGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVS 474
           + +   FN+ +N+ ++ GL +W+ I I+++RF +A+  +   +    + A F PW+ + +
Sbjct: 460 NNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPWAAYYA 519

Query: 475 LFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI-KPEDVDL 533
            FF  +I  I+ +  F  H FD   F + YI + + A+ ++G ++ +R +   K ED+D+
Sbjct: 520 TFFVTVIIFIQGFQAFSPH-FDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLEDIDI 578

Query: 534 YTFKAAID 541
            T +  I+
Sbjct: 579 DTDRREIE 586

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  290 bits (741), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 167/504 (33%), Positives = 268/504 (53%), Gaps = 15/504 (2%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           D + +   +K+ L+ RH+SM                       P   LI+Y F+G +V++
Sbjct: 27  DDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFS 86

Query: 103 VMACLGEMAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   LGEM  FIP+   FT +A R++ PA G A GY Y F + +    +L+    ++Q+W
Sbjct: 87  VTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFW 146

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
                V    WI+I  VL+ + N   VR +GE EFW++SVK                   
Sbjct: 147 TM--AVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIICGAG 204

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGS---KGKXXXXXXXXXXXXXXYTGTELCGIVAAE 278
                 GFRYW++PG   P+   I  S   + +              + GTEL GI A E
Sbjct: 205 VTGP-VGFRYWKNPG---PWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGE 260

Query: 279 AKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAI 338
            + PR++VP+AIK  ++RI++FY+ S+L++G+ V YNDP L             PF++ I
Sbjct: 261 VQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKL---QSNDSYVSSSPFIITI 317

Query: 339 KNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYS 398
           +NAG  +LPHIFNA +L+ + SA NS++Y+ SR LYGLA ++ APK F  T+  GVPY +
Sbjct: 318 QNAGTKILPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVT 377

Query: 399 LAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKS 458
           +  + +F  LAYM  ++G  + F + +N+V + G  +W+ I  +++RF KA+  +   ++
Sbjct: 378 VLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRN 437

Query: 459 GFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYK 518
              Y A   PW  + ++FF  +I +I+ +T F    F    F + YI + ++ I +V ++
Sbjct: 438 DLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSF-APKFKVANFFAAYISVFLFIIFWVAFQ 496

Query: 519 LVHRSKLI-KPEDVDLYTFKAAID 541
           +  + +L+ K +DVDL T +  I+
Sbjct: 497 IWFKCRLVWKLQDVDLDTDRRDIE 520

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  291 bits (744), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 166/499 (33%), Positives = 264/499 (52%), Gaps = 9/499 (1%)

Query: 46  HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMA 105
           +   ++K+AL+ RH+ M                       P   LI+Y F+G ++Y +  
Sbjct: 88  YHDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQ 147

Query: 106 CLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSR 164
            LGEMA FIP+    T ++ R++ PA G A GY Y F + I    +++    V++YW   
Sbjct: 148 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWT-- 205

Query: 165 EKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNH 224
           +KV    WI IF VLI L+N   V+ +GE EFW++ +K                    + 
Sbjct: 206 DKVPLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGG-SSQ 264

Query: 225 DRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRR 284
              GFRYWR+PG + P   +   + G+              Y GTEL GI A EA NPR+
Sbjct: 265 GPIGFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 324

Query: 285 SVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIP 344
           +VPRAI   ++RI LFY++S+  +GM V YND  L             PFV++I+NAG  
Sbjct: 325 TVPRAINKVVFRIALFYIMSLFFIGMLVPYNDERL---ASTSAVIASSPFVISIQNAGTK 381

Query: 345 VLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVL 404
           VLP IFNA V++ + SA NS++YV SR LY LA+   APK FA    +GVPY  + V+  
Sbjct: 382 VLPDIFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSA 441

Query: 405 FCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTA 464
             LLA++ V++ +   FN+ +N+ ++ GL +W+ I I+++RF +A+  +   +    + A
Sbjct: 442 LGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKA 501

Query: 465 PFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK 524
              P+  + + FF  +I  I+ +  F  H +D   F + YI + + A+ ++G ++ +R +
Sbjct: 502 KLMPFGAYYATFFVTVIIFIQGFQAFSPH-WDTTAFFTSYISLIILAVLFIGCQIFYRCR 560

Query: 525 LI-KPEDVDLYTFKAAIDA 542
              + ED+D+ + +  I+A
Sbjct: 561 FFWRVEDIDIDSDRREIEA 579

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  290 bits (741), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 165/485 (34%), Positives = 253/485 (52%), Gaps = 8/485 (1%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +G      +K+AL+ RH+SM                       P   LI+Y F+G +VY 
Sbjct: 48  EGDCRETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYF 107

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   LGEMA FIP+    T ++ R++ PA G A GY Y F + I    ++     V+QYW
Sbjct: 108 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYW 167

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
              + V    WI IF VL+ L N   V+F+GE EFW++SVK                   
Sbjct: 168 T--DAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGS 225

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
            +    GFRYWR+PG + P   +   ++G+              Y GTEL GI A EA N
Sbjct: 226 -HQGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 284

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PR++VPRAI    +RI+ FY++S+  +G+ V Y+D   +            PFV++I+NA
Sbjct: 285 PRKTVPRAINKVFFRILFFYILSLFFIGLLVPYDD---LRLSNTTAVIASSPFVISIQNA 341

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G  VLPHIFNA V++ + SA NS++YV SR LY LA+   APK F      GVPY  + V
Sbjct: 342 GTKVLPHIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIV 401

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           + L  LLA++ V++ + + FN+ VN+ ++ GL +W+ I ++++RF + +  +   +    
Sbjct: 402 TALLGLLAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLP 461

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           + A   PW  + + FF  +I +I+ +  F    F    F + YI + + A+ ++G +L +
Sbjct: 462 FKAKLMPWGAYYAAFFIGVIIIIQGFKAFT-PKFRVSDFFTSYISLILLAVLFLGCQLFY 520

Query: 522 RSKLI 526
           R + I
Sbjct: 521 RCRFI 525

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  289 bits (739), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 173/527 (32%), Positives = 271/527 (51%), Gaps = 14/527 (2%)

Query: 18  TLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIR-----LKKALEARHVSMXXXXXXXXXX 72
            LE+D +F  ++            ++ + EG +     L+K L +RH+ +          
Sbjct: 8   NLEKDTSFYDVKSQGETYSGTLNQLESQLEGTKCDENNLEKGLSSRHIQLIALGGCIGTG 67

Query: 73  XXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDG-FTSYASRYVDPAL 131
                        P  + +S+  +  +VY VM  L EM  ++P  G      SRYVDP+L
Sbjct: 68  LFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAEMICYLPQQGTVPELTSRYVDPSL 127

Query: 132 GFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFF 191
           GFA G+ Y + Y I+   +L+A A V+QYW   +KV+  VWITIFLV++V +N   V+F+
Sbjct: 128 GFAAGWNYAYSYSILVATELSAAAGVVQYWT--DKVHVAVWITIFLVIVVGLNFAPVKFY 185

Query: 192 GEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGK 251
           GE EFW +S+K                   P+HDR GFRYW +PG F  +     G+ G+
Sbjct: 186 GESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPGPFAYH--ITGGNTGR 243

Query: 252 XXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGM 310
                         +    EL G+   EAK+ RR++ +A +  ++RI+ FY+ S L +G 
Sbjct: 244 FLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITSTLCIGF 303

Query: 311 TVAYNDPLLIXXXXXXX-XXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVA 369
            ++ +DP LI             PFV  I NAGIPVL HI NA +L   +S+ NS +Y +
Sbjct: 304 ILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSANSFMYAS 363

Query: 370 SRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVS 429
           SR++  LA    APK+F + N  GVPY ++A+S     L Y+N SS SAQ+F +  N+ +
Sbjct: 364 SRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWLSNICT 423

Query: 430 IFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTV 489
           I G + W  I ITYLRF KA+           + +  QP+ T+  + F  L+ L   Y  
Sbjct: 424 ISGFIGWALIGITYLRFRKAIFYN-NLYERVPFKSALQPYFTYFFVVFVVLLCLTNGYAT 482

Query: 490 FLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKP-EDVDLYT 535
           F+   ++   F++ YI +P++ + Y+G+K+  +++   P  ++D+ T
Sbjct: 483 FIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKTRWYIPFREIDVIT 529

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  288 bits (737), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 167/497 (33%), Positives = 264/497 (53%), Gaps = 10/497 (2%)

Query: 47  EGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMAC 106
           E   +++ L+ RH+ M                       P   LI+Y F+  L Y+V   
Sbjct: 23  EAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQS 82

Query: 107 LGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSRE 165
           LGEMA FIP+   FT ++ R+V PA G A GY Y F + I    +L+    V+Q+W    
Sbjct: 83  LGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTF-- 140

Query: 166 KVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHD 225
            V    WI+IF VL+  +N   V+++GEFEFW++ VK                       
Sbjct: 141 AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGP 200

Query: 226 RTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRS 285
             GFRYWR PGAF P   A   ++ +              + GTEL GI A EA NPR++
Sbjct: 201 -VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKT 259

Query: 286 VPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPV 345
           VPRAIK  ++RI+ FY++S+  +G+ V Y+D  L             PF++AI+N+G  V
Sbjct: 260 VPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKL---TSTDSYVSASPFIIAIENSGTHV 316

Query: 346 LPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLF 405
           LPHIFNA ++  + SA NS++YV SR +YGL+  R AP I ++T   GVP+ ++ V+ LF
Sbjct: 317 LPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLF 376

Query: 406 CLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAP 465
             LAYM  S+G  + FN+ +N+  + G  +W+ I ++++RF +A+  +   +    + A 
Sbjct: 377 GALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAK 436

Query: 466 FQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKL 525
           + P   +  +FF  LI +I+ +T F    ++   F++ YI + ++   ++ ++   R +L
Sbjct: 437 WMPGLAYYGVFFMTLIIIIQGFTSFC--PWNGIDFLTAYISVFMFIAIWIAFQAWFRCRL 494

Query: 526 I-KPEDVDLYTFKAAID 541
           I + EDVD+ T + A++
Sbjct: 495 IWRVEDVDIDTDRRAVE 511

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  290 bits (743), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 170/502 (33%), Positives = 263/502 (52%), Gaps = 10/502 (1%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +  +E   +K+AL+ RH+ M                       P   LI+Y F+G +VY 
Sbjct: 98  EAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYF 157

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   LGEMA FIP+    T ++ R++ PA G + GY Y F + I    +++    V++YW
Sbjct: 158 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYW 217

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
              +KV    WI IF V+I L+N   V+ +GEFEFW++SVK                   
Sbjct: 218 T--DKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGS 275

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
            +    GFRYWR+PGA+ P   +   S+G+              Y GTEL GI A EA N
Sbjct: 276 -HQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 334

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PR++VPRAI   ++RIVLFY++S+  +G+ V YND  L             PFV++I+NA
Sbjct: 335 PRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAVIASS---PFVISIQNA 391

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G   LP IFNA VL+ V SA NS++YV SR LY LA    APK F      GVPY  +  
Sbjct: 392 GTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVC 451

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           +    LLA++ V++ +   FN+ +N+ ++ GL +W+ I + ++RF +A+  +   +    
Sbjct: 452 TAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLP 511

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           + A   P+  + + FF  +I  I+ +  F    F    F + YI + + A+ ++G ++ +
Sbjct: 512 FKAKLMPYGAYYAAFFVTVIIFIQGFQAFC--PFKVSEFFTSYISLILLAVVFIGCQIYY 569

Query: 522 RSKLI-KPEDVDLYTFKAAIDA 542
           + + I K ED+D+ + +  I+A
Sbjct: 570 KCRFIWKLEDIDIDSDRREIEA 591

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  289 bits (739), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 163/498 (32%), Positives = 264/498 (53%), Gaps = 8/498 (1%)

Query: 46  HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMA 105
            E   +K+ L+ RH+ M                       P   LISY F+G ++Y+V  
Sbjct: 61  QERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQ 120

Query: 106 CLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSR 164
            LGEM  FIP+   F+ +A R++ PALG   GY Y   +      +L+    V+QYW   
Sbjct: 121 SLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWT-- 178

Query: 165 EKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNH 224
           E V    WI IF  L+  +N   V+++GEFEF ++S+K                    + 
Sbjct: 179 EAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSD 238

Query: 225 DRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRR 284
              GFRYWR+PGA+ P   +   ++G+              Y GTEL GI A EA NPR+
Sbjct: 239 GPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 298

Query: 285 SVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIP 344
           ++PRAIK  + RI++FY++S+  +G+ V YNDP L             PF+++I+N+G  
Sbjct: 299 ALPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL---DSDGIFVSSSPFMISIENSGTK 355

Query: 345 VLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVL 404
           VLP IFNA VL+ + SA NS++Y+ SR LY L+ +  AP+  +     GVPY+S+  + +
Sbjct: 356 VLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSV 415

Query: 405 FCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTA 464
           F  LA++ VS+GS + FN+ +N+  + G  +W+ I  +++RF +A+  +   +    Y A
Sbjct: 416 FGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKA 475

Query: 465 PFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK 524
              P+  + + FF  LI LI+ +T F   TF    F++ YI I ++   ++ +++  + +
Sbjct: 476 QMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFVAAYISIFLFLAIWLSFQVWFKCR 534

Query: 525 LI-KPEDVDLYTFKAAID 541
           L+ K +D+D+ + +  I+
Sbjct: 535 LLWKLQDIDIDSDRRQIE 552

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  289 bits (739), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 163/498 (32%), Positives = 267/498 (53%), Gaps = 8/498 (1%)

Query: 46  HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMA 105
            +G  +K+ L+ RH+ M                       P   LISY F+G ++Y+V  
Sbjct: 61  RKGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQ 120

Query: 106 CLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSR 164
            LGEMA FIP+   F+ +A R++ PALG   GY Y   +      +L+    ++QYW   
Sbjct: 121 SLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWT-- 178

Query: 165 EKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNH 224
           + V    WI IF  L+ L+N   V+++GEFEF ++S+K                    + 
Sbjct: 179 DAVPLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSG 238

Query: 225 DRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRR 284
              GFRYWR+PGA+ P   + + ++G+              Y GTEL GI A EA NPRR
Sbjct: 239 GPIGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRR 298

Query: 285 SVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIP 344
           +VPRAIK  + RI++FY++S+  +G+ V YNDP L             PF+++I+N+G  
Sbjct: 299 AVPRAIKKVVVRILVFYILSLFFIGLLVPYNDPKL---DSEGTFVSSSPFMISIENSGTK 355

Query: 345 VLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVL 404
           VLP IFNA VL+ + SA NS++Y+ SR LY L+ +  AP+  +     GVPY+++  +  
Sbjct: 356 VLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSA 415

Query: 405 FCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTA 464
           F  LA++  S+GS ++FN+ +N+  + G  +W+ I ++++RF +A+  +   +    Y A
Sbjct: 416 FGFLAFLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRA 475

Query: 465 PFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK 524
              P+  + + FF  LI LI+ +T F   TF    FI+ YI + ++   ++ +++  + +
Sbjct: 476 RMMPFLAYYASFFIALIVLIQGFTAF-APTFQPIDFIAAYISVFLFIAIWLLFQVWFKCR 534

Query: 525 LI-KPEDVDLYTFKAAID 541
            + K +DVD+ + +  I+
Sbjct: 535 FVWKLQDVDIDSDRRDIE 552

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  287 bits (735), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 182/552 (32%), Positives = 282/552 (51%), Gaps = 23/552 (4%)

Query: 1   MSESLEKKNAGILYSNETLEED-----VAFDKLERXXXXXXXXXXXVDGKHEGIRLKKAL 55
           M ++ EK+  G+    ET  ED      A + L++             G H    +++ L
Sbjct: 1   MLKTSEKE--GMSQKTETRLEDYEMGSFAEEALDQEAQSSQDSQLGSSG-HGRNAVQRQL 57

Query: 56  EARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIP 115
           + RHVSM                       P   LISY F+G + Y V   LGEMA FIP
Sbjct: 58  KPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEMATFIP 117

Query: 116 L-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWIT 174
           +   FT +  R++   LG A GY Y F + +    +L+    +++YW S   V    WI 
Sbjct: 118 VTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTS--AVPNAAWIA 175

Query: 175 IFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRD 234
           IF V I L N V V+F+GEF+FW++ +K                         GFRYWR+
Sbjct: 176 IFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGP-VGFRYWRN 234

Query: 235 PGAFKPYSEAISGS---KGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIK 291
           PG   P+ + I      +G+              Y GTEL GI A E+ NPR++VP+AI 
Sbjct: 235 PG---PWGDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAIN 291

Query: 292 LTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFN 351
              +RI+LFYV S+  +G+ V +ND  L             PF++AI+N+G  +LP IFN
Sbjct: 292 KVFFRILLFYVGSLFFIGLLVPFNDEKL---TSSDSYSAGSPFIIAIQNSGTKILPDIFN 348

Query: 352 ACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYM 411
           A +L  + SA NS++YV SR LYGLA +R AP+ FA+TN  GVP  ++     F  L Y+
Sbjct: 349 AVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYL 408

Query: 412 NVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWST 471
           +VS+G+++ F++ +N+ +I G  SW+ I + ++RF +A+  Q   +    + A   PW  
Sbjct: 409 SVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGA 468

Query: 472 WVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI-KPED 530
           + S FF  LI +I+ +T  L  TF+   F + YI + ++ + +  ++  +R+++I + E 
Sbjct: 469 YYSAFFITLIIIIQGFTS-LAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEH 527

Query: 531 VDLYTFKAAIDA 542
           VD+ + +  +DA
Sbjct: 528 VDIDSDRREVDA 539

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  288 bits (738), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 171/535 (31%), Positives = 274/535 (51%), Gaps = 29/535 (5%)

Query: 9   NAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGI--------RLKKALEARHV 60
           +AG L + +   + + F  +E              G  +G          L++ L++RH+
Sbjct: 27  SAGALPAKDKYNKTIEFVDVESQQSTSSATISEKLGDGDGDADPFANEGSLQQGLKSRHI 86

Query: 61  SMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFT 120
            M                       PA + ISY  +  +VY +M   GEM  ++P +G  
Sbjct: 87  QMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCGFGEMVCYLPGNGND 146

Query: 121 SYAS------RYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWIT 174
           +  S      RYVD +LGFA  + Y + Y I+   + TA + V++YW     V  GVWI 
Sbjct: 147 ASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEYWTV--AVPKGVWIL 204

Query: 175 IFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRD 234
           IFL ++V++N   V+++GE EFW +S+K                   PNHDR GFRYW+ 
Sbjct: 205 IFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQR 264

Query: 235 PGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLT 293
           PGAF  +   + G  G+              +  G EL  + +AE ++ RR++ +A +  
Sbjct: 265 PGAFTEH--IMKGGFGRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQRRNIAKAARRF 322

Query: 294 LYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXX-XXXXXPFVVAIKNAGIPVLPHIFNA 352
           ++R++ FYV+  L + + VAYNDP L+             PFV+ I+NAGI VLPHI NA
Sbjct: 323 IWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAGIRVLPHIINA 382

Query: 353 CVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMN 412
           C+L   +SA N+ ++ ++R+L  +A +  AP++F K N +GVPY ++++S     LA++N
Sbjct: 383 CILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLSGGLSCLAFLN 442

Query: 413 VSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF----QP 468
           VSS +A +FN+F N+ +I G + WI   + Y+RF KA+       +G     PF    QP
Sbjct: 443 VSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFF-----NGMYDRLPFKTWGQP 497

Query: 469 WSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
           ++ + SLF   LI L   Y  F+   +    F++ YI +P++ + +VG+KL  R+
Sbjct: 498 YAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLWTRT 552

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  288 bits (736), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 167/495 (33%), Positives = 261/495 (52%), Gaps = 10/495 (2%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            +K+AL+ RH+ M                       P   LI+Y F+G ++Y +   LGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 110 MAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           MA FIP+    T ++ R++ PA G + GY Y F + I    +++    V+QYW   +KV 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWT--DKVP 222

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
              WI IF VLI L+N   V+ +GEFEFW++SVK                    +    G
Sbjct: 223 LAAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGS-HQGPIG 281

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
           FRYWR+PGA+ P   + + S+G+              Y GTEL GI A EA NPR++VPR
Sbjct: 282 FRYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           AI   ++RIV+FY++S+  +G+ V YN+P L             PFV++I+NAG   LP 
Sbjct: 342 AINKVVFRIVIFYIMSLFFIGLLVPYNEPRL---SPSSAVIASSPFVISIQNAGTYALPD 398

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           IFNA VL+ V SA NS++YV SR LY LA    APK F      GVPY  +  +    LL
Sbjct: 399 IFNAVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLL 458

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           A++ V++ +   FN+ +++ ++ GL +W+ I + ++RF +A+  +   +    + A   P
Sbjct: 459 AFLVVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMP 518

Query: 469 WSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI-K 527
           +  + + FF  +I  I+ +  F    F    F + YI + + A+ ++  +L ++ + I K
Sbjct: 519 YGAYYASFFVTIIIFIQGFQAFC--PFSVSEFFTSYISLILLAVVFISCQLYYKCRFIWK 576

Query: 528 PEDVDLYTFKAAIDA 542
            ED+D+ + +  I+A
Sbjct: 577 LEDIDIDSDRREIEA 591

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  283 bits (725), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 167/495 (33%), Positives = 260/495 (52%), Gaps = 9/495 (1%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            +K+ L+ RH+ M                       P   LISY F+G LVY+V   LGE
Sbjct: 72  EVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSLGE 131

Query: 110 MAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           MA FIP+   FT +A R++ P++G A GY Y F + +    +L+    V+QYW     V 
Sbjct: 132 MATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWT--YAVP 189

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
              WI+IF V+I   N   V+++GE EFW++ +K                         G
Sbjct: 190 LAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTGP-VG 248

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
           FRYWR+PG + P   +   ++ +              Y GTEL GI A EA NPR++VPR
Sbjct: 249 FRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVPR 308

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           AIK  ++RI+ FY+ S+  +G+ V YND  L             PF++AIKN+G PVLPH
Sbjct: 309 AIKKVVFRILFFYIGSLFFIGLLVPYNDDAL---NNTDSYVASSPFIIAIKNSGTPVLPH 365

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           IFNA +   + SA NS++YV SR L+GL+ ++ APKI ++T   GVP+ ++ V+ +   L
Sbjct: 366 IFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGAL 425

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           AYM  S+G    FN+ +N+ ++ G  +W+ I ++++RF +A+  +   +    + A   P
Sbjct: 426 AYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMP 485

Query: 469 WSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI-K 527
              + + F   +I +I+ +T F    F    F + YI I ++   +  ++++ R + I K
Sbjct: 486 GLAYYASFLMFVIIIIQGFTAF-APKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHK 544

Query: 528 PEDVDLYTFKAAIDA 542
            EDVD+ T +  I+A
Sbjct: 545 VEDVDIDTDRRDIEA 559

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  282 bits (722), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 175/506 (34%), Positives = 262/506 (51%), Gaps = 23/506 (4%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
            G H    LKK L++ H+ +                       PA + ISY  +  ++Y 
Sbjct: 47  SGDHN---LKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYP 103

Query: 103 VMACLGEMAAFIPL--------DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAG 154
           VM  L EM  F+P            ++  +RYVD +LGFAVG+ Y++ Y I+   + TA 
Sbjct: 104 VMNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAA 163

Query: 155 AMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXX 214
           + V+ YW +   V    WITIFL +IV++N   V F+G  E    S+K            
Sbjct: 164 SGVVTYWTT--AVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSI 221

Query: 215 XXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGI 274
                  PNHDR GFR+W+DPGA+  Y  A  G+                   G EL  +
Sbjct: 222 VLFFGGGPNHDRLGFRFWKDPGAWA-YHLADGGAGRLSDIITGVIRAGFAFILGPELVVL 280

Query: 275 VAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXX-XXXXXP 333
            + EA++ RR++ +A +  ++R++ FY +S L  G+ V+ NDP+L+             P
Sbjct: 281 TSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSP 340

Query: 334 FVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWG 393
           FV+ I+NAGI VLPHI N C+L   +S+ NS +Y  +R+L  L+ +  APKIF + N WG
Sbjct: 341 FVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWG 400

Query: 394 VPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAV-IA 452
           VPY  +A +  F  LAY+NVSS +A +FN+F N+ +I G L WI   + YLRF KAV   
Sbjct: 401 VPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFN 460

Query: 453 QFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAI 512
              D+    +  PFQP+ TW  +    +I LI  Y  F+   ++YK FI+ YI +P++ I
Sbjct: 461 NLYDR--LPFKTPFQPYFTWFYIILIAIICLINGYESFV--HWNYKDFIAAYITLPLFLI 516

Query: 513 CYVGYKLVHRS---KLIKPEDVDLYT 535
            ++G+K   R+    +I   ++D+ T
Sbjct: 517 LWLGHKAYTRTWSQWMISVSEIDVTT 542

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  279 bits (714), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 156/458 (34%), Positives = 253/458 (55%), Gaps = 8/458 (1%)

Query: 86  PASILISYSFVGLLVYTVMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYF 144
           P   LISY F+G ++Y+V   LGEMA FIP+   F+ +A R++ PALG   GY Y   + 
Sbjct: 25  PVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWC 84

Query: 145 IVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXX 204
                +L+    ++QYW   + V    WI IF  L+ L+N   V+++GEFEF ++S+K  
Sbjct: 85  FTFALELSVLGQIIQYWT--DAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVI 142

Query: 205 XXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX 264
                                  GFRYWR+PGA+ P   +   ++G+             
Sbjct: 143 ALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAF 202

Query: 265 XYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXX 324
            Y GTEL GI A EA NPR++VPRAIK  + RI++FY++S+  +G+ V YNDP L     
Sbjct: 203 TYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKL---DS 259

Query: 325 XXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPK 384
                   PF+++I+N+G  VLP IFNA VL+ + SA NS++Y+ SR LY L+ +  AP+
Sbjct: 260 DGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAPR 319

Query: 385 IFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYL 444
             +     GVPY+++  + +F  LA++  S+GS + FN+ +N+  + G  +W+ I  +++
Sbjct: 320 FLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHI 379

Query: 445 RFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGY 504
           RF +A+  +   ++   Y A   P+  + + FF  LI LI+ +T F   +F    F++ Y
Sbjct: 380 RFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAF-APSFQPVDFVAAY 438

Query: 505 IGIPVYAICYVGYKLVHRSKLI-KPEDVDLYTFKAAID 541
           I + ++   +  ++L  +  +I K +DVD+ + +  I+
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIE 476

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  281 bits (720), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 164/502 (32%), Positives = 258/502 (51%), Gaps = 9/502 (1%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +G  +  ++K+AL+ RHVSM                       P   LI+Y F+G +VY 
Sbjct: 107 EGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYF 166

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   +GEMA FIP+    T ++SR++ PA G A GY Y F + I    +L+    V++YW
Sbjct: 167 VTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEYW 226

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
              E V    WI IF VL+ L N   V+F+GE EFW++S+K                   
Sbjct: 227 T--EAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGS 284

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
                 GFRYWR+PG +     +    +G+              Y GTEL GI A EA N
Sbjct: 285 -KQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAAN 343

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PRR+VPRAI    +RI+ FY++S+  +G+ V YN   L             PFV++I+NA
Sbjct: 344 PRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSL---DKTTTVIASSPFVISIQNA 400

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G   LP IFNA VL+ + SA NS++YV SR L+ LA    APK+F+     GVP+  + V
Sbjct: 401 GTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIV 460

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           + L  LLA++ V+  + + FN+ +N+ ++ GL +W+ I I+++RF + +  +   +    
Sbjct: 461 TSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLP 520

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           + +   P+  + + F+  +I  ++ +  F  H F    F + YI + +  + + G +L +
Sbjct: 521 FKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPH-FKVTEFFTSYISLMLLVVVFCGAQLFY 579

Query: 522 RSKLI-KPEDVDLYTFKAAIDA 542
           R +   + ED+D+ + +   DA
Sbjct: 580 RCRFFNRLEDIDIDSDRREADA 601

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  278 bits (711), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 161/484 (33%), Positives = 260/484 (53%), Gaps = 8/484 (1%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
            G  +   +K+ L+ RH+ M                       P   LI+Y F+  +V++
Sbjct: 81  QGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFS 140

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   LGEMA FIP+   FT ++SR++ P++G A GY Y F + I    +L+    ++Q+W
Sbjct: 141 VTQSLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFW 200

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
              + V    WI I+  ++ ++N   V+F+GEFEFW++S+K                   
Sbjct: 201 T--DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAG 258

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
                 GFRYWR+PG + P   +   ++G+              Y GTEL GI A EA N
Sbjct: 259 VT-GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 317

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PR++VPRAIK   +RI++FY++S+  +G+ V ++DP L             PF++AI+N+
Sbjct: 318 PRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDDSYVSSS---PFIIAIQNS 374

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G  VLPHIFNA +L  + SA NS++YV SR ++GLA  + AP+ F  T   GVPY ++  
Sbjct: 375 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLF 434

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           +  F  LA++ VSSG A+ FN+ +N+V + G  +W+ I I ++RF + +  +   +    
Sbjct: 435 TSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLP 494

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           + A   PW  + ++FF  +I +I+ +T F   TF+   F++ YI + ++   +V ++L  
Sbjct: 495 FKAALMPWLAYYAIFFMIIIIIIQGFTAF-APTFNGSDFVAAYISVFLFFFLWVSFQLYF 553

Query: 522 RSKL 525
           R KL
Sbjct: 554 RCKL 557

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  276 bits (705), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 163/529 (30%), Positives = 264/529 (49%), Gaps = 8/529 (1%)

Query: 16  NETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSMXXXXXXXXXXXXX 75
            +TLE D+    +              +G ++   +K+AL+ARH+SM             
Sbjct: 21  GKTLENDIELQSVTPATGEFPEDHTE-EGDYQETEVKRALKARHISMIALGGTIGTGLFI 79

Query: 76  XXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPL-DGFTSYASRYVDPALGFA 134
                     P   L++Y F+G +VY++   LGEMA FIP+    T ++ R++ PA G A
Sbjct: 80  VIASPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVA 139

Query: 135 VGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEF 194
            GY Y F + I    +L+    ++QYW  R  +    WI IF VL+ L+N   VRF+GE 
Sbjct: 140 NGYMYWFNWAITFAVELSVVGQIIQYWTDRVPI--AAWIVIFWVLVTLVNFFPVRFYGEI 197

Query: 195 EFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXX 254
           EFW++SVK                                P      S   +  +     
Sbjct: 198 EFWIASVKVLTIVGYLIYAFIIVCGGSKQGPIGLPATGGIPARGARASSRTTRKRHGFLG 257

Query: 255 XXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAY 314
                      Y GTEL GI A E+ NPR++VP+AI    +RI+ FY+ S+L +G+ V Y
Sbjct: 258 WVSSLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPY 317

Query: 315 NDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLY 374
           +DP L             PFV++IKNAG  +LP IFNA VL+ V SA NS++Y+ SR  Y
Sbjct: 318 DDPRL--NSESSTDVNASPFVISIKNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAY 375

Query: 375 GLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLL 434
            LA+   APK  A     GVPY+ + ++ L  L++++ ++  ++  F++ VN+ ++ GL 
Sbjct: 376 SLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLC 435

Query: 435 SWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHT 494
           +W+ I + ++RF + +  +   +    + A F PW+ + + FF  +I  I+ YT F    
Sbjct: 436 AWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFTPK- 494

Query: 495 FDYKTFISGYIGIPVYAICYVGYKLVHRSKLI-KPEDVDLYTFKAAIDA 542
           FD  TF + YI + +  + ++G ++ ++ + +   ED+D+ + +  IDA
Sbjct: 495 FDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLWAVEDIDIDSDRREIDA 543

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  274 bits (701), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 167/505 (33%), Positives = 261/505 (51%), Gaps = 15/505 (2%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +G  +  ++K+AL+ RHVSM                       P   LI+Y F+G +VY 
Sbjct: 46  EGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYF 105

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   +GEMA FIP+    T +++R++ PA G A GY Y F + I    +++    V+QYW
Sbjct: 106 VTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYW 165

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
              + V    WI IF V I L N   VRF+GE EFW++S+K                   
Sbjct: 166 T--KAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGS 223

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAI-SGSK--GKXXXXXXXXXXXXXXYTGTELCGIVAAE 278
                 GFRYWR+PG   P+ + I SG K  G+              Y GTEL GI A E
Sbjct: 224 -KQGPIGFRYWRNPG---PWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGE 279

Query: 279 AKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAI 338
           A NPR++VP+AI    +RI+ FY++S+  +G+ V YN P L             PFV++I
Sbjct: 280 AANPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGL---DKHTSVIASSPFVISI 336

Query: 339 KNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYS 398
           ++AG  +LP IFNA VL+ + SA NS++YV SR L+ LA    APK F+     GVPY  
Sbjct: 337 QSAGTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLG 396

Query: 399 LAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKS 458
           +  + L  LLA++ V   + + FN+ +N+ ++ GL +W+ I I+++RF + +  +   + 
Sbjct: 397 VICTALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRD 456

Query: 459 GFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYK 518
              + +   P+  + + F+  +I  ++ +  F    F    F +GYI + + A+ +   +
Sbjct: 457 DLPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFC-PKFKVAEFFTGYISLILLAVVFCLAQ 515

Query: 519 LVHRSKLI-KPEDVDLYTFKAAIDA 542
           L +R +   + ED+D+ + +  IDA
Sbjct: 516 LYYRCRFFNRLEDIDIDSDRREIDA 540

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  272 bits (696), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 170/556 (30%), Positives = 280/556 (50%), Gaps = 26/556 (4%)

Query: 2   SESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVD-----GKHEGIRLKKALE 56
           S+S+ ++    + +  T+ +D    K+              +     G      +K+ L+
Sbjct: 8   SQSVPRQRKSGVQTFSTMSQDDDMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELK 67

Query: 57  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPL 116
            RH+ M                       P   LI+Y FVG L Y V   LGEMA FIP+
Sbjct: 68  QRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPV 127

Query: 117 -DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITI 175
              FT +ASR++ P++G AVGY Y F + +    +L+    ++ YW     V    WI+I
Sbjct: 128 TSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTF--AVPIAAWISI 185

Query: 176 FLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDP 235
           F V++  +N   V+F+GE EFW+++VK                         GFRYWR+P
Sbjct: 186 FWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNP 244

Query: 236 GAFKPYSEAISGS---------KGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSV 286
           G   P+ + ++ +          G+              Y GTEL GI A EA NPR++V
Sbjct: 245 G---PWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTV 301

Query: 287 PRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVL 346
           PRAIK  ++RI+LFY+ S+  +G+ V ++DP L             PF++AI+N+G  +L
Sbjct: 302 PRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVSSS---PFIIAIENSGTKIL 358

Query: 347 PHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC 406
           P IFNA +L+ + SA NS++YV SR L+ LA    APKI ++T   GVP+ S+  + +F 
Sbjct: 359 PDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFG 418

Query: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF 466
           +LAYM  + G   +F++ VN+ +I G  +W+ ILI+++RF + +  +   +    + A  
Sbjct: 419 VLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANL 478

Query: 467 QPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI 526
            P   + ++F   +I + + +T F   TFD   F + YI + ++ + +  ++L  + + I
Sbjct: 479 MPGLAYYAVFCMVIIIIFQGFTAFT-PTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWI 537

Query: 527 -KPEDVDLYTFKAAID 541
            K EDVD+ + +  ++
Sbjct: 538 WKLEDVDIDSNRRDVE 553

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  271 bits (693), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 166/547 (30%), Positives = 277/547 (50%), Gaps = 17/547 (3%)

Query: 2   SESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXV--DGKHEGIRLKKALEARH 59
            E+LE K+  ++ S E+LE+       ++           V  + K E   +K+ L  RH
Sbjct: 9   EETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEVKRDLSKRH 68

Query: 60  VSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDG- 118
           ++M                       P   LI+Y F+G +VY+V   LGEMA FIP+   
Sbjct: 69  IAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMATFIPVTAS 128

Query: 119 FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLV 178
           FT ++ R++ PALG A GY Y F + +    +L+    ++Q+W     V    WI+IF V
Sbjct: 129 FTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTF--AVPLPAWISIFWV 186

Query: 179 LIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAF 238
           ++ + N   VR +GE EFW++ +K                         GFRYWR+PG  
Sbjct: 187 ILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFRYWRNPG-- 243

Query: 239 KPYSEAISGS---KGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLY 295
            P+   I  S   + +              + GTEL GI A EA NPR++VP+AI+  ++
Sbjct: 244 -PWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIRKVVF 302

Query: 296 RIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVL 355
           RI++FY++S+  +G+ V Y+D   +            PF++AI+N+G  +LPHIFN  +L
Sbjct: 303 RILVFYILSLFFIGLLVPYDD---VKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVIL 359

Query: 356 LFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSS 415
           + + SA NS++Y+ SR L+GLA +   PK+FAKT   GVP +++  + LF  LA+M  S+
Sbjct: 360 VTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETST 419

Query: 416 GSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSL 475
           G  + F + +NVV + G  SW+ I   ++RF + + ++   ++   + A F P+  + + 
Sbjct: 420 GGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYAT 479

Query: 476 FFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI-KPEDVDLY 534
               +I   + +T F    FD   F + YI + ++ I +  ++L  + + + K  D+D+ 
Sbjct: 480 IVMIIIIFFQGFTAF-APKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVDIDID 538

Query: 535 TFKAAID 541
             +  I+
Sbjct: 539 KDRREIE 545

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  271 bits (692), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 167/517 (32%), Positives = 257/517 (49%), Gaps = 16/517 (3%)

Query: 14  YSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSMXXXXXXXXXXX 73
           Y  + ++E   F                ++ +  GI   + L++RHV +           
Sbjct: 16  YVTDRMKEKTQFSIHSTGDEVSQGSVLDIESQKPGI--VRGLKSRHVQLIALGSAIGTGL 73

Query: 74  XXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFTSYASR---YVDPA 130
                       PA +LI+Y+ + L V++VM  + EM   IPL G ++  S    YV+  
Sbjct: 74  FIGSGGALSICGPAPLLIAYAVMSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKP 133

Query: 131 LGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRF 190
           L F  G+   +   ++ P ++TA A+++QYW      NP ++I+IFLVL V I  + V+ 
Sbjct: 134 LSFMCGWNLFYAQAMIAPAEVTACALLVQYWTD---ANPAIFISIFLVLSVAITMLPVKV 190

Query: 191 FGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT-GFRYWRDPGAFKPYSEAISGSK 249
           FGE EFW+SS+K                   P  +   GF YW+ PGAFKPY   + G  
Sbjct: 191 FGESEFWVSSIKILTIVGLIIVGVVIFFGGGPAQEHVLGFHYWKKPGAFKPY--LVEGGT 248

Query: 250 GKXXXXXXXXXXXXXXYTGT-ELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLL 308
           GK              +    E+    AAEA  PRR++PRA K  +YR+ LFYV  IL++
Sbjct: 249 GKFLAFWTAIIKSGFSFVLVPEIVSSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVV 308

Query: 309 GMTVAY-NDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLY 367
           G+ V Y ND LL             PFV+ IK AGI VLPHI NA +L   +S     LY
Sbjct: 309 GVIVGYDNDRLLNAIASGQSSAAASPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLY 368

Query: 368 VASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNV 427
            ASRTL+ +A    AP+I    N +GVPYY   ++ LFCLLAY+N S+ S+ +FN+  N+
Sbjct: 369 GASRTLHSMACKGDAPRILTTVNKYGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNI 428

Query: 428 VSIFGLLSWISILITYLRFHKAV-IAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKN 486
            +I G +SW+ + I Y+RF   + + +  D+    +  P+Q    ++++ F  ++ L   
Sbjct: 429 ATISGFVSWVLVSIAYIRFRNVIDVLKLNDR--IPFRVPYQKPLAYLAMGFFSILTLTNG 486

Query: 487 YTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
           + VF+   +D   F + YI +    + +VG  + ++ 
Sbjct: 487 FAVFIKGNWDTSNFFAAYITLGFVLVLFVGSTIYYKE 523

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  271 bits (694), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 165/517 (31%), Positives = 266/517 (51%), Gaps = 26/517 (5%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           DG+    +LK+ L ARH+ +                       PA ++ SY  +  +VY 
Sbjct: 96  DGRKN--KLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYP 153

Query: 103 VMACLGEMAAFIPLDGFTSYAS------RYVDPALGFAVGYCYLFKYFIVTPNQLTAGAM 156
           +M  LGEM  ++P DG  S  S      RY+D +L FA G+ Y + + ++   + TA + 
Sbjct: 154 IMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASG 213

Query: 157 VMQYWVSREKVNPG-VWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXX 215
           V++YW    KV P   WI +F ++I  +N   VR +GE EFW +  K             
Sbjct: 214 VVEYWT---KVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFI 270

Query: 216 XXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGI 274
                 PNHDR GFRYW  PG+F   +   +GS G               +  G EL  +
Sbjct: 271 LFWGGGPNHDRLGFRYWITPGSFA--NTITNGSFGNFLDVYKGIILGAFSFILGPELVVL 328

Query: 275 VAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLL-IXXXXXXXXXXXXP 333
            ++E  +PRR++ +A K  ++R++ FY++  L + + V+YNDP+L              P
Sbjct: 329 PSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSSP 388

Query: 334 FVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWG 393
           FV+ I+NAGI VLPHI N C+L+  +S+ N+ L+ +SR+L  +AI+ +APK   K N +G
Sbjct: 389 FVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRFG 448

Query: 394 VPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQ 453
           VPY ++ VS++   +AY+N S  ++ +F +F N+ +I G L WI + +TYLRF KA I  
Sbjct: 449 VPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKA-IEY 507

Query: 454 FGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAIC 513
            G K    YT   QP+    SL    +I +   + + +   ++   FI+ Y+ +P++ + 
Sbjct: 508 HGMKDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLMI 567

Query: 514 YVGYKLV-HRSKLI--------KPEDVDLYTFKAAID 541
           ++G+K   +R K+         + ED+D+ T    I+
Sbjct: 568 WIGHKFYKYRFKIFTRQCRWWYQVEDIDVITGLEEIE 604

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  267 bits (683), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 157/484 (32%), Positives = 249/484 (51%), Gaps = 13/484 (2%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           +K+ L+ RHV+M                       P   L++Y FV  + Y V   LGEM
Sbjct: 49  VKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEM 108

Query: 111 AAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A FIP+   FT +ASR+V PALG A GY Y   + I    +++    ++ YW   + V  
Sbjct: 109 ATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYW--SDAVPI 166

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
             W+ IF VL+  IN + V+F+GEFEFW++S+K                       R GF
Sbjct: 167 TAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRIGF 225

Query: 230 RYWRDPGAFKPYSEAISGSK---GKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSV 286
           RYW+DPG   P+   I   +    +              + GTEL G+ A E KNPRR+V
Sbjct: 226 RYWKDPG---PWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTV 282

Query: 287 PRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVL 346
           P+AI    +RI+LFY+ S+L++G+ V Y+DP LI            PFVVAI  AG  VL
Sbjct: 283 PKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANAS-PFVVAINAAGTKVL 341

Query: 347 PHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC 406
           P I N  +++ + SA NS++YV SR LYGL     AP   ++T   GVPY ++  + +F 
Sbjct: 342 PDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFG 401

Query: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF 466
            L Y+NVSS S  +F++ +++ ++ G  +W+ I ++++RF + +  +   +    + A F
Sbjct: 402 ALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKF 461

Query: 467 QPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI 526
            P+  + + FF  +I L++ +T F    F    F++ YI   ++ + ++ ++ + + +  
Sbjct: 462 MPYGAYYAAFFVIVIILVQGFTAF--TPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRWF 519

Query: 527 KPED 530
              D
Sbjct: 520 HTVD 523

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  268 bits (684), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 168/502 (33%), Positives = 256/502 (50%), Gaps = 9/502 (1%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +G      +K+AL+ RHVSM                       P   LI+Y F+G +VY 
Sbjct: 65  EGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYF 124

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           V   LGEMA FIP+    T ++ R++ PA G A GY Y F + I    +L+    ++ YW
Sbjct: 125 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYW 184

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
              + V    WI IF VL+   N   V+++GEFEF ++S+K                   
Sbjct: 185 T--DAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGS 242

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
            +    GFRYWR+PG +   + A + +K +              Y GTEL GI A EA N
Sbjct: 243 -SQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEASN 301

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PR++VP+AI    +RI++FY+ S+  +G+ V YN P L             PFV++I+NA
Sbjct: 302 PRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQL---ESNSAVIASSPFVISIQNA 358

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G  VLP IFNA VL+ + SA NS++YV SR LY LA+   APK F+     GVPY  +  
Sbjct: 359 GTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVIC 418

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           + L  LLA++  +  +   FN+ +N+ ++ GL +W  I + ++RF + +  +   +    
Sbjct: 419 TALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLP 478

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           + A   PW  + + FF  LI  I+ +T F    FD   F + YI + +  + ++  +L +
Sbjct: 479 FKAKLMPWGAYYAAFFVGLIVFIQGFTAF-APRFDVSEFFTAYISLILLVVLFILCQLYY 537

Query: 522 RSK-LIKPEDVDLYTFKAAIDA 542
           R + L K ED+D+ + +  IDA
Sbjct: 538 RCRFLTKIEDIDIDSDRREIDA 559

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  265 bits (677), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 166/539 (30%), Positives = 266/539 (49%), Gaps = 20/539 (3%)

Query: 1   MSESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHV 60
           +  S  + N G  +S ++   + +  ++++           ++G+    ++ + L++RH+
Sbjct: 21  IDNSHSRPNYG--HSADSWNNEKSAYQVDQIIDVEDASMELIEGQEH--QVARKLKSRHI 76

Query: 61  SMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFT 120
            +                       PA +LISY  +   V+ +M  L EM   +P+ G T
Sbjct: 77  QLIALGGAIGTGLFIGSGGALSVCGPAPLLISYMIMSFFVWCIMNFLTEMVCMMPISGET 136

Query: 121 SY---ASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFL 177
           S       Y++  L F  G    +   ++ P+++TA A+++QYW      N  ++I+IF+
Sbjct: 137 SMFAMTGTYLNKPLSFMCGINLFYAMSMIAPSEITATAILIQYWT---DANSAIFISIFI 193

Query: 178 VLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT-GFRYWRDPG 236
           V+ V +  + V FFGE EFW+S +K                   PN D+  GF YW+ PG
Sbjct: 194 VVTVSLTMLPVHFFGESEFWVSIIKLFCITGLVILGIVIFFGGAPNQDKVLGFHYWKHPG 253

Query: 237 AFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGT-ELCGIVAAEAKNPRRSVPRAIKLTLY 295
           AF P+   + G+ GK              Y    E+    AAEAK+PRR++PR  +  +Y
Sbjct: 254 AFNPH--LVPGNTGKFLACWTAIIKSGFSYVLVPEVVVSCAAEAKDPRRNMPRVAQRFVY 311

Query: 296 RIVLFYVISILLLGMTVAY-NDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACV 354
           R+ LFYV   L +G+ V Y N  LL             PFV+ I+  GI VLPHI NAC+
Sbjct: 312 RLALFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAAASPFVIGIQEVGIRVLPHIINACI 371

Query: 355 LLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVS 414
           L   +S   S LY ASR L+ +A++   PKIFA TN +G PYYS A + +FCLLAY+N S
Sbjct: 372 LTSAYSCGTSVLYGASRVLHSMAVNGAVPKIFATTNRFGTPYYSTAAASVFCLLAYLNCS 431

Query: 415 SGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVI-AQFGDKSGFSYTAPFQPWSTWV 473
             S+ +F +  N+ +I G + W+ + + YLRF K +  A   DK  F     F     ++
Sbjct: 432 DSSSVVFTWLSNIATISGFVDWMLVCVVYLRFRKVIEHANLTDKMPFRKR--FMKPLAYL 489

Query: 474 SLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPEDVD 532
           S  F  ++ L   Y VF+   ++   F + Y  + + A+ Y+G  + +++  IK  D+D
Sbjct: 490 SCGFFAILSLTNGYAVFVADNWNVSDFFACYTTLGLAAVLYIGAAIYYKT--IKLRDLD 546

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  259 bits (663), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 158/503 (31%), Positives = 248/503 (49%), Gaps = 18/503 (3%)

Query: 19  LEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXX 78
           + E +  D LER           +D K    ++++ L++RH+ +                
Sbjct: 33  VTESIQEDDLERGSIDVL-----IDEKPSH-QMQRGLKSRHMQLIALGCAIGTGLFIGTG 86

Query: 79  XXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFTSY---ASRYVDPALGFAV 135
                  PA +LISY  +   V+T+M  L EM    P+ G  S    A  Y++  L F  
Sbjct: 87  GALSTCGPAPLLISYIIMSFFVWTIMHQLTEMVVLTPIPGEASMYALARAYLNRPLSFMC 146

Query: 136 GYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFE 195
           G+   +   ++ P+++TA  +++QYW      N  ++++IF+V+ + +  + V+ FGE E
Sbjct: 147 GWNLFYAQAMIAPSEITASTLLIQYWT---DANSAIFVSIFIVITIAVTALPVKVFGESE 203

Query: 196 FWLSSVKXXXXXXXXXXXXXXXXXXXPN-HDRTGFRYWRDPGAFKPYSEAISGSKGKXXX 254
           FW+S +K                   PN H   GF YW+ PGAFKP+    +G+ GK   
Sbjct: 204 FWVSMIKLITITGLIILGVVIFFGGGPNQHHVLGFHYWKHPGAFKPHIS--TGNTGKFLA 261

Query: 255 XXXXXXXXXXXYT-GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVA 313
                      +    E     +AEA  PRR++PRA    ++R++LFY+   L++G+TV 
Sbjct: 262 VWTAIIKSGFAFILSPETLTSCSAEADRPRRNMPRAANRFVWRLMLFYIGGALVVGVTVG 321

Query: 314 Y-NDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRT 372
           Y N  LL             PFV+ IK  GI VLPHI NA +L   +SA  +++Y ASR 
Sbjct: 322 YDNQNLLSAIASGQSNAAASPFVIGIKEVGIKVLPHIINAAILTGAYSAGTAEMYGASRM 381

Query: 373 LYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFG 432
           L+ +A+   APKIFA+ N +GVPYYS+ V   FC LAY+N S+ ++Q+F +  N+ +I G
Sbjct: 382 LHSMALKGNAPKIFARVNRYGVPYYSIIVPSCFCFLAYLNCSNSASQVFTWLTNISTISG 441

Query: 433 LLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLG 492
            +SW+ + ITY+RF + VI          +  PFQ    + S  F  ++ L   Y VF  
Sbjct: 442 FISWVFVSITYVRFRR-VIDYLDLNDRIKFRKPFQRIFAYFSGCFFVILSLTNGYAVFTK 500

Query: 493 HTFDYKTFISGYIGIPVYAICYV 515
             +    F + YI I    + ++
Sbjct: 501 GNWSVSDFFANYITIGFVVVLFI 523

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  254 bits (650), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 163/535 (30%), Positives = 258/535 (48%), Gaps = 22/535 (4%)

Query: 2   SESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVS 61
           S SL K+   I  +   LEE V  D+  +               ++  +LK+ L+ARH+ 
Sbjct: 7   SSSLTKEKVAIDEAEVQLEEGVTLDETIKQGVL----------HNDRTKLKQGLKARHIK 56

Query: 62  MXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDGFT- 120
           M                       P  +LI+Y  VG++V      + E+A+F+P  G T 
Sbjct: 57  MLTLVGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIAIAEVASFMPATGATI 116

Query: 121 SYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLI 180
            ++ +++D A+GF  G+  +  Y  + P +L+A A+VM YW     ++P ++ITIF VL 
Sbjct: 117 RHSEQFIDEAVGFTFGW--ISTYSSLMPGELSATAVVMTYWTD---LSPAIFITIFGVLF 171

Query: 181 VLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKP 240
           +L N   +RF+GE E++   +K                      +R GF YWR+PG F  
Sbjct: 172 ILTNIYTIRFYGEIEYFFGWLKLALIAILIITGLVIDLGGT-KQERLGFHYWRNPGPFAE 230

Query: 241 YSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLF 300
           Y   + G  GK              Y+G +   I+A E KN R ++    K    RI+L 
Sbjct: 231 Y--LVGGDTGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFVRIILL 288

Query: 301 YVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFS 360
           Y+I++ +L + V YND L+             PFV+A++ AGI VLPHI NA +L   +S
Sbjct: 289 YLITVFVLTLIVPYNDKLI---ATGSGNARSSPFVIAMERAGIKVLPHIVNALILTSAWS 345

Query: 361 ACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQI 420
           A N  +   SR L+ LA   +APKIF KT+  G+P+  +     F  LAYM+ S  SA +
Sbjct: 346 AGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVLFISSFLPLAYMSCSESSATV 405

Query: 421 FNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCL 480
           F++F  +VS   LL WI I   ++   +A+ AQ   +    Y+    P++ W S     +
Sbjct: 406 FSWFQELVSSNTLLRWILISANHIHMDRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFI 465

Query: 481 IGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPEDVDLYT 535
             L   +  F+   FD ++F S Y  IP+    +  +KL  +++ ++P +VDL +
Sbjct: 466 FLLTGGFYNFIHGNFDIESFFSRYFIIPLAIALFTFWKLFKKTRYLRPHEVDLQS 520

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  254 bits (649), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 156/489 (31%), Positives = 245/489 (50%), Gaps = 11/489 (2%)

Query: 46  HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMA 105
           ++  +LK+ L+ RH+ M                       P  +LI+Y FVG++V     
Sbjct: 39  NDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQI 98

Query: 106 CLGEMAAFIPLDGFT-SYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSR 164
            + E+A+F+P  G T  +A +++D ++GF  G+  +  Y  + P +L+A A++M+YW   
Sbjct: 99  AIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD- 155

Query: 165 EKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNH 224
             ++P V+ITIF VL V+ N   +RF+GE E+    +K                      
Sbjct: 156 --ISPAVFITIFGVLFVVTNIYTIRFYGEVEYVFGWLKLILIFILIISGLVIDLGGVKGQ 213

Query: 225 DRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRR 284
           +R GF YWRDPG F  Y   + GS GK              Y+G +   I+A E KN R 
Sbjct: 214 ERLGFHYWRDPGPFAEY--IVGGSIGKFVGFWSALSSVVYSYSGIQNIAILAGETKNSRH 271

Query: 285 SVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIP 344
           ++    K    RI++ Y++++ +L + V YND L+             PFV+A+  AGI 
Sbjct: 272 AIYHGAKNVFLRIIVLYLVTVFVLTLIVPYNDALI---ASGTGTAKSSPFVIAMNRAGIK 328

Query: 345 VLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVL 404
           VLPHI NA VL   +SA N  +   SR L+ LA   +APKIF KT+  G+PY  +     
Sbjct: 329 VLPHIVNALVLTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFISC 388

Query: 405 FCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTA 464
           F  LAYM+ S  S+ +F +F  +VS   LL WI I   ++   +A+ AQ   +S   Y+ 
Sbjct: 389 FLPLAYMSCSESSSTVFGWFQELVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYST 448

Query: 465 PFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK 524
           P  P++ W S     +  L   +  F+   FD ++F + Y  IP+    +  +KL  +++
Sbjct: 449 PIAPYAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTR 508

Query: 525 LIKPEDVDL 533
            ++PE+VDL
Sbjct: 509 YLRPEEVDL 517

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  254 bits (649), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 153/508 (30%), Positives = 261/508 (51%), Gaps = 31/508 (6%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            LK  L++RH+ +                       PA+++ISY  +  +VY +M   GE
Sbjct: 55  NLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGE 114

Query: 110 MAAFIPLD-------GFTSY-ASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           M  ++P +       G+ +Y  S+YVD +LGFA  + Y + + ++   + TA + +++YW
Sbjct: 115 MVCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYW 174

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
            S  K+   V I +FL +I L+N + V+F+GE EFW + +K                   
Sbjct: 175 TS--KIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGA 232

Query: 222 PNHDRT---GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT-GTELCGIVAA 277
           PN++     GF YW++P +F+ Y    +GS G               +  G EL  + ++
Sbjct: 233 PNNEDNSFVGFHYWKNPSSFRDY--VTNGSLGNFLDVYNALIKGAFAFILGPELVSLTSS 290

Query: 278 EAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXX-XXXXXPFVV 336
           E  + RR++ +A +  +YR++ FY+   L + + V YNDP L+             PFV+
Sbjct: 291 ECVDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVI 350

Query: 337 AIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPY 396
            I+NAGI +LPHI N C+L    SA N+ L+ ++R L  +  +  AP+IF++ N  GVPY
Sbjct: 351 GIQNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPY 410

Query: 397 YSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGD 456
            +L++S++   LA++N S+ SA++F +F N+ +I G + W +  I YLRF + +     D
Sbjct: 411 VALSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTI-----D 465

Query: 457 KSGFSYTAPF----QPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAI 512
            +G     PF    Q + TW S  F  ++ L   Y   +   ++Y+ FI+ YI +PV+ +
Sbjct: 466 YNGLYDRLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLV 525

Query: 513 CYVGYKLV----HRSKLIKP-EDVDLYT 535
            Y G+ +      + K  KP +++D+ T
Sbjct: 526 LYFGHIIYSGRWRQRKWWKPVDEIDVVT 553

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  253 bits (645), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 160/480 (33%), Positives = 243/480 (50%), Gaps = 12/480 (2%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            + + L++RH+ +                       PA ILISY  +   V+T++  L E
Sbjct: 50  EMVRGLKSRHIQLIALGDAIGTGLFIGSGGALSTCGPAPILISYIVMSFFVWTIVNQLTE 109

Query: 110 MAAFIPLDG---FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREK 166
           M A IPL G     S A  YV   L F  G+   +   ++ P+++TA AM++QYW     
Sbjct: 110 MVALIPLPGEASMYSLARMYVGRPLAFMCGWNLFYAMAMIAPSEITACAMLIQYWT---D 166

Query: 167 VNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR 226
            N  ++I+IF+V  V I  + VR FGE EF +SS+K                   P+ D 
Sbjct: 167 ANSAIFISIFIVFSVAITMLPVRVFGESEFCVSSIKLLTIVGLIIVGIVIFFGGGPSQDH 226

Query: 227 T-GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGT-ELCGIVAAEAKNPRR 284
             GF YW+ PGAFK +   + GS GK              +    E     +AE+ +PRR
Sbjct: 227 ILGFHYWKKPGAFKEH--LVPGSTGKFLAVWTAIIKSGFSFVLVPETVASCSAESASPRR 284

Query: 285 SVPRAIKLTLYRIVLFYVISILLLGMTVAYNDP-LLIXXXXXXXXXXXXPFVVAIKNAGI 343
           ++PRA +  +YR+ LFYV  +L++ + V  +D  LL             P+V+ IK AGI
Sbjct: 285 NMPRACQRFVYRLALFYVAGVLVVTVVVGSDDANLLNAIHSGASNAAASPYVIGIKEAGI 344

Query: 344 PVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSV 403
            VLPHI NAC+L   +S   ++LY  SR L+ +A+   AP+IFAK N +GVPYYS AV+ 
Sbjct: 345 KVLPHIINACILTSAYSCGTAELYGCSRILHSMAMKGDAPQIFAKVNRFGVPYYSTAVAC 404

Query: 404 LFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYT 463
           LF LLAY+N S  S+ +FN+  N+ +I G +SW+ + +TY RF + VI +        + 
Sbjct: 405 LFTLLAYLNCSKSSSLVFNWLSNIATISGFISWVFVSVTYTRF-RTVIDKLDLNDRIPFR 463

Query: 464 APFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
             FQ    +  + F  L+ L   Y VF+   ++   F + Y+ I   A+ ++G  + ++ 
Sbjct: 464 RRFQKGFAYACIAFFVLLSLTNGYAVFIKGNWNTSDFFASYVTIGFVAVLFIGSTIYYKE 523

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  252 bits (643), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 152/485 (31%), Positives = 241/485 (49%), Gaps = 11/485 (2%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           +LK+ L+ RH+ M                       P  +LI+Y FVG++V      + E
Sbjct: 48  KLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAE 107

Query: 110 MAAFIPLDGFT-SYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           +A+F+P  G T  +A +++D ++GF  G+  +  Y  + P +L+A A++M+YW     V+
Sbjct: 108 VASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD---VS 162

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
           P V+IT+F +L V+ N   +RF+GE E+    +K                      +R G
Sbjct: 163 PAVFITVFGILFVVTNIYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQERLG 222

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
           F YWR+PG F  Y   + G  GK              Y+G +   I+A E KN R ++  
Sbjct: 223 FHYWREPGPFANY--LVGGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRHAIFH 280

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
             K    RI++ Y++++ +L + V YND L+             PFV+A+  AGI VLPH
Sbjct: 281 GAKNVFLRIIVLYLVTVFILTLIVPYNDKLI---ATGTGTARSSPFVIAMNRAGIKVLPH 337

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           I NA +L   +SA N  +   SR L+ LA   +APKIF +T+  G+PY  +     F  L
Sbjct: 338 IVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFLPL 397

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           AYM+ S  SA +F +F  +VS   LL WI I   ++   +A+ AQ   +S   Y+ P  P
Sbjct: 398 AYMSCSKSSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPMGP 457

Query: 469 WSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKP 528
           ++ W S     +  L   +  F+   FD ++F + Y  IP+    +  +KL  ++K ++P
Sbjct: 458 FAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTKYLRP 517

Query: 529 EDVDL 533
            +VDL
Sbjct: 518 HEVDL 522

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  251 bits (641), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 155/496 (31%), Positives = 253/496 (51%), Gaps = 13/496 (2%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK  L+ RH+ M                       PAS+LI +   G ++Y+++  LGE+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALGEL 145

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+ G FT+YA+R++D + G+A  + Y+ ++ +V P ++ + ++ + +W +  K   
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F ++IV+IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 206 G-FVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGG 264

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           +YW DPGAF     A      K              + G+EL G+ A+E+ +PR+SVP+A
Sbjct: 265 KYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVPKA 319

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            K   +RI LFY++S+L++G+ V YNDP LI            PFV+AIK  GI  LP +
Sbjct: 320 AKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAAS--PFVIAIKTHGIKGLPTV 377

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L+ V S  NS +Y  SRT+  LA  R  P+IFA  +  G P   +AV+  F L+A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIA 437

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           ++  S     +FN+ + +  +  L +W  I I ++RF KA+ AQ  D    S+ +P   W
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 470 STWVSLFFCCLIGLIKNYTVF--LGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-KLI 526
            ++  LF   ++ + + Y     +G +   + F   Y+  P+    Y+G+K+  R+ KL 
Sbjct: 498 GSYWGLFMVVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHKIYKRNWKLF 557

Query: 527 KP-EDVDLYTFKAAID 541
            P ED+D+ T +  +D
Sbjct: 558 IPAEDMDIDTGRREVD 573

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  251 bits (641), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 152/486 (31%), Positives = 243/486 (50%), Gaps = 6/486 (1%)

Query: 52  KKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMA 111
           ++ L  R VSM                       P S+LI++    ++   +  C+  M 
Sbjct: 118 RRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLSKCMCVMV 177

Query: 112 AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPG 170
            ++P+ G F  +  R+VD + GFAVG+ Y          ++TA  +V++YW   +K+   
Sbjct: 178 TYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWT--DKIPKA 235

Query: 171 VWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFR 230
             I++ ++L   +N   V FFGE EF+LS  K                   P H   GF+
Sbjct: 236 ALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHTVLGFK 295

Query: 231 YWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAI 290
            W +PGAF  Y     GS G+              + G +  G  A+EA NPR+ +P + 
Sbjct: 296 NWSNPGAFAEYIS--DGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVIPSSF 353

Query: 291 KLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXX-XXPFVVAIKNAGIPVLPHI 349
           +    R+++FY+   + +G+ + YNDP +I             P+V A+K  GI VLPHI
Sbjct: 354 RKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRVLPHI 413

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L  + SA NS LY ASR L+ LA+D +AP+IF  T   GVP Y     ++ C LA
Sbjct: 414 VNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVICGLA 473

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           Y++VS+ +  +  +F+NV +    + +I I ++YL+F K  +AQ  D     Y +   P+
Sbjct: 474 YLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSSSLPY 533

Query: 470 STWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPE 529
             W SLF+  L+ L+  YTVFL  ++D ++F+  Y  IP + +   G+KL   +K ++P 
Sbjct: 534 LAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGTKSVRPL 593

Query: 530 DVDLYT 535
           ++DL+T
Sbjct: 594 EMDLFT 599

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  249 bits (636), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 146/465 (31%), Positives = 237/465 (50%), Gaps = 14/465 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           ++ + L+ RH+ +                       PA +LI+Y  +   V+++M  + E
Sbjct: 54  KIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTE 113

Query: 110 MAAFIPLDG---FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREK 166
           M   IPL G     S A  Y++  + F  G+   +   ++ P ++TA A+++QYW     
Sbjct: 114 MVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYWT---D 170

Query: 167 VNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR 226
            N  ++I+IF+V+ +L+  + V+ FGE EFW+SS+K                   P  D 
Sbjct: 171 ANSAIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDH 230

Query: 227 T-GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGT-ELCGIVAAEAKNPRR 284
             GF YW++PGAF P+     G+ G+              +    E     +AE   PRR
Sbjct: 231 VLGFHYWKNPGAFNPHLA--EGNTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRR 288

Query: 285 SVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXX-XXXXXXXPFVVAIKNAGI 343
           ++P+A +  +YR+ +FY++  L++G+ V +N+  LI             PFV+ I+ AGI
Sbjct: 289 NMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGI 348

Query: 344 PVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSV 403
            +LPHI NAC+L   +S     LY +SRTLY +A+   APKIFAK N +G PYYS  ++ 
Sbjct: 349 KILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLAS 408

Query: 404 LFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIA-QFGDKSGFSY 462
           LF  LAY+N S  ++ +FN+  N+ +I G +SWI + +TY+RF K + A    D+  F  
Sbjct: 409 LFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINALDLNDRVPFR- 467

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGI 507
             PFQ    +++  F  ++ L   Y VF+   ++   F + Y+ I
Sbjct: 468 -RPFQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTI 511

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  246 bits (628), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 153/497 (30%), Positives = 243/497 (48%), Gaps = 14/497 (2%)

Query: 42  VDGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVY 101
           +D       + + L++RHV                         PA +LISYS +   V+
Sbjct: 55  IDTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVW 114

Query: 102 TVMACLGEMAAFIPLDGFTSYAS---RYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVM 158
            +M  + EM   IPL G +S AS    Y++    F  G+   +   +V P ++TA A+++
Sbjct: 115 AIMNQMTEMVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLI 174

Query: 159 QYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXX 218
           +YW      N  +++TIF++L  L++ + V+ FGE EF +S +K                
Sbjct: 175 EYWT---DANAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVIFF 231

Query: 219 XXXP-NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGT-ELCGIVA 276
              P  H   GF YW  PGAF  Y   + GS G               +    E+    +
Sbjct: 232 GGGPAQHKVLGFHYWNTPGAFNSY--LVKGSTGAFLAVWKAIIKSGFAFVMIPEITSSCS 289

Query: 277 AEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXX-XXXXXXXPFV 335
           AEA  PR+++PRA +  +YR+ +FYV+  L++G+ V Y++  L              PFV
Sbjct: 290 AEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGKANAAASPFV 349

Query: 336 VAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVP 395
           + I+ AGI +LPHI NAC+L   +S   S+LY ASR L+ LA+   APK F+K N +GVP
Sbjct: 350 IGIQEAGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGVP 409

Query: 396 YYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAV-IAQF 454
           YYS+A + LF +LAY+N S  S  +FN+  N+ +I G ++W+ + ITYLRF K     + 
Sbjct: 410 YYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLKI 469

Query: 455 GDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICY 514
            D+    Y    Q    + S  F  L+ +   + VF+   ++   F + Y+ I    + +
Sbjct: 470 NDR--VPYRRRGQRALAYASAIFFALLAITNGFYVFIAGNWNVSDFFTCYVTIGFVGVLF 527

Query: 515 VGYKLVHRSKLIKPEDV 531
           +G  + ++    +  DV
Sbjct: 528 IGSSIYYKEWTFRDMDV 544

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  244 bits (624), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 156/489 (31%), Positives = 247/489 (50%), Gaps = 12/489 (2%)

Query: 46  HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMA 105
           ++  RLK+ L+ RH+ M                       PA + ++Y  VG++V     
Sbjct: 45  NDRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQI 104

Query: 106 CLGEMAAFIPLDGFT-SYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSR 164
            + E+A+F+P  G T  +A +++D ++GF  G+  +  Y  + P +L+A A+VM+YW   
Sbjct: 105 AIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVVMRYWTD- 161

Query: 165 EKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNH 224
             +NP VWITIF +L VL N   +RF+GE E++   +K                      
Sbjct: 162 --INPAVWITIFGILFVLTNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGA-KQ 218

Query: 225 DRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRR 284
           +R GF YWR+PG F  Y   + G  GK              Y+G +   I+A E KN R 
Sbjct: 219 ERLGFHYWREPGPFAEY--IVKGEIGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRH 276

Query: 285 SVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIP 344
           ++    +    RI++ Y+I++L+L + V YND L+             P+V+AI+ A I 
Sbjct: 277 AIFHGARNVFLRIIVLYLIAVLVLTLIVPYNDKLI---ATGTGTAKSSPYVIAIQRANIK 333

Query: 345 VLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVL 404
           +LPHI NA +L   +SA N  +   SR L+ LA   +APKIF  TN  G+PY  +A    
Sbjct: 334 ILPHIINAIILTSAWSAGNLAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISA 393

Query: 405 FCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTA 464
           F  L+YM+VSS SA +F++F  +VS   LL WI I   ++   +A+ AQ   +S   ++ 
Sbjct: 394 FLPLSYMSVSSSSANVFSWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHST 453

Query: 465 PFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK 524
              P++ W S     +  L   +  F+   FD ++F + Y  IP+  I +  +KL  ++K
Sbjct: 454 CLGPFAAWFSGIMSLIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKLFKKTK 513

Query: 525 LIKPEDVDL 533
            ++P +VDL
Sbjct: 514 YLRPAEVDL 522

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  244 bits (623), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 156/496 (31%), Positives = 245/496 (49%), Gaps = 13/496 (2%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           L+  L+ RH+ M                       PA ILI +   G ++Y ++  + E+
Sbjct: 84  LQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAEL 143

Query: 111 AAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+  GFT+YA+R++D + GFA  + Y+ ++ +  P ++ A ++ + YW + +K   
Sbjct: 144 AIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRD 203

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F V+IV+IN  GVR +GE EF  S  K                   P     G 
Sbjct: 204 G-FVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGA 262

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           RYW  PGAF     A   S  K              + G+EL G+ AAEA NPR+ VP A
Sbjct: 263 RYWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGA 317

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            K   +RI +FYV+ +LL+GM V Y DP LI            PFV+AIKN GI  LP +
Sbjct: 318 AKQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAAS--PFVIAIKNQGISGLPTL 375

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L+ V S  NS +Y  SRTL  LA     PK F+  +  G P   +AV+  F L+A
Sbjct: 376 VNVVILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIA 435

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           ++  S    ++F++ + +  +  L +W +I + ++RF +A+ AQ    +  ++ +P   W
Sbjct: 436 FVAQSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVW 495

Query: 470 STWVSLFFCCLIGLIKNYTVF--LGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-KL- 525
                LF C ++   + Y     LG       F  GY+ +P+    ++G+K+  ++ KL 
Sbjct: 496 GAAWGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKNWKLF 555

Query: 526 IKPEDVDLYTFKAAID 541
           IK ED+D+ T +  +D
Sbjct: 556 IKAEDMDIDTGRRELD 571

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  241 bits (616), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 150/486 (30%), Positives = 241/486 (49%), Gaps = 7/486 (1%)

Query: 52  KKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMA 111
           ++ L  R VSM                       P S+LI++    ++   +  C+  M 
Sbjct: 46  RRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQCMCVMV 105

Query: 112 AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPG 170
            ++P+ G F  +  R+VD + GF+VG+ Y          ++TA  +V+++W   +K+   
Sbjct: 106 TYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWT--DKIPKA 163

Query: 171 VWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFR 230
             I+I + L   +N   V  FGE EF+LS  K                   P H   GF+
Sbjct: 164 ALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHKVLGFK 223

Query: 231 YWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAI 290
            W +PGAF  Y     GS GK              + G +  G  A+EA NPR+ +P + 
Sbjct: 224 NWSNPGAFAEYIS--KGSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKVIPSSF 281

Query: 291 KLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXX-XXPFVVAIKNAGIPVLPHI 349
           +    R+++FY+   + +G+ V +ND  +I             P+V A+K  GI VLPHI
Sbjct: 282 RKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIGVLPHI 341

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L  + SA NS LY ASR L+ LA++ +APK+F K    GVP Y     +L C LA
Sbjct: 342 VNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLF-KITKRGVPIYCCVAVLLVCGLA 400

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           Y++VS+ +  +  +F+NV +    + +I I I+YL+F K   AQ  D     Y++ F P+
Sbjct: 401 YLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSSSFLPY 460

Query: 470 STWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKPE 529
             W SLF+  L+  +  Y VFL  ++D ++FI  Y  IP + + + G+KL  +++ +KP 
Sbjct: 461 LGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTRFVKPV 520

Query: 530 DVDLYT 535
           ++DL++
Sbjct: 521 EMDLFS 526

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  242 bits (617), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 151/496 (30%), Positives = 249/496 (50%), Gaps = 13/496 (2%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK  L+ RH+ M                       PAS+LI +   G ++Y ++  LGE+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGEL 145

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+ G FT+YA+R++D + G+A  + Y+ ++ +V P ++ + ++ + +W +  K   
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F + IV+IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 206 G-FVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGG 264

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           +YW DPGAF     A      K              + G+EL G+ A+E+  PR+SVP+A
Sbjct: 265 KYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKA 319

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            K   +RI LFY++S+L++G+ V YND  LI            PFV+AIK  GI  LP +
Sbjct: 320 AKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAAS--PFVIAIKTHGIKGLPSV 377

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L+ V S  NS +Y  SRT+  LA  R  P+IF+  +  G P   +AV+  F L+A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIA 437

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           ++  S    ++FN+ + +  +  L +W  I I ++RF KA+ AQ       S+ +P   W
Sbjct: 438 FVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPTGVW 497

Query: 470 STWVSLFFCCLIGLIKNYTVF--LGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-KLI 526
            ++  LF   ++ + + Y     +G +   + F   Y+  P+  + Y+G+K+  R+ KL 
Sbjct: 498 GSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIYKRNWKLF 557

Query: 527 KP-EDVDLYTFKAAID 541
            P E +D+ T +  +D
Sbjct: 558 IPAEKMDIDTGRREVD 573

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  240 bits (613), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 146/499 (29%), Positives = 246/499 (49%), Gaps = 14/499 (2%)

Query: 49  IRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLG 108
           + L K L  RH+                         PAS++I +  +   ++TV+  LG
Sbjct: 68  VNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALG 127

Query: 109 EMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           EMAA  P+  GF  Y +R+VDP++GFAV   YL ++ ++ P +L A +M ++YW   + +
Sbjct: 128 EMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYW--NDTI 185

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           N   W+ IF  +I   N + V+ FGE EF LS VK                   P     
Sbjct: 186 NSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYL 245

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YW +PG+F  ++   SG+K K              Y+G E+  + AAE+K+PRR++P
Sbjct: 246 GGKYWHNPGSFVGHT---SGTKFKGLCSVFVTAAFS--YSGIEMTAVSAAESKDPRRTIP 300

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
           +A K T + I   Y+  + L+G  V Y++P L+            P V+AI+N GI  LP
Sbjct: 301 KAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASS-PLVIAIENGGIKGLP 359

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
            + NA +L+ + S  NS +Y  SR +  +A     P++    +  G P  ++  ++ F L
Sbjct: 360 SLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGL 419

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           L+++  S   A++F +   +  +  +  W++I I+++RF +A+  Q        Y +   
Sbjct: 420 LSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTG 479

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFL---GHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK 524
            W +W  +    L+ ++  +T      G   D ++F  GY+  P+   CYVG+KLV+R K
Sbjct: 480 VWGSWYGVIVLFLVLIVSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVYRKK 539

Query: 525 --LIKPEDVDLYTFKAAID 541
             ++  ED+D+ T +  +D
Sbjct: 540 QIVVALEDMDIDTGRRQVD 558

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  239 bits (610), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 146/476 (30%), Positives = 237/476 (49%), Gaps = 11/476 (2%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK  L+ RH+ M                       PAS+LI +   G ++Y ++  LGE+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGEL 145

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+ G FT+YA+R++D + G+A  + Y+ ++ +V P ++ + ++ + +W +  K   
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F V+IV+IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 206 G-FVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGG 264

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           +YW DPGAF     A      K              + G+EL G+ A+E+  PR+SVP+A
Sbjct: 265 KYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVPKA 319

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            K   +RI LFY++S+L++G+ V YND  LI            PFV+AIK  GI  LP +
Sbjct: 320 AKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAAS--PFVIAIKTHGIKGLPSV 377

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L+ V S  NS +Y  SRT+  LA  R  P+IFA  +  G P   + V+  F L+A
Sbjct: 378 VNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIA 437

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           ++  S     +FN+ + +  +  L +W  I I ++RF KA+ AQ  D    S+ +P   W
Sbjct: 438 FVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPTGVW 497

Query: 470 STWVSLFFCCLIGLIKNYTVF--LGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
            ++  LF   ++ + + Y     +G +   + F   Y+  P+    Y+G+K+  R+
Sbjct: 498 GSYWGLFMVVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHKIYKRN 553

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  238 bits (606), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 156/500 (31%), Positives = 249/500 (49%), Gaps = 21/500 (4%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK+ L+ RH+ M                       PA ILI ++  G ++Y ++  +GE+
Sbjct: 77  LKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGEL 136

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+ G FT+YA+R++D + G+A  + Y+ ++ +V P ++ A ++ + YW +  K   
Sbjct: 137 AVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 196

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F V+IV IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 197 G-FVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYIGG 255

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX-XYTGTELCGIVAAEAKNPRRSVPR 288
             W +PGAF      +  + GK               + G+EL G+ +AE  NPR+S+PR
Sbjct: 256 ANWHNPGAF------VGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPR 309

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K   +RI LFY+IS+ L+G+ V YND  LI            PFV+AIKN GI  LP 
Sbjct: 310 AAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAAS--PFVLAIKNHGIKGLPS 367

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           + N  +L+ V S  NS ++  SRTL  LA     PKIF   +  G P   +  +  F LL
Sbjct: 368 VVNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLL 427

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           +++  S    ++F++ + +  +  L +W++I I +LRF +A+ AQ       S+ +P   
Sbjct: 428 SFIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPA-- 485

Query: 469 WSTWVSLFFCCLIGLIKNYTVF-----LGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
              W S++   LI LI     +     +G   D K F   Y+ +PV  + Y+G+K   R+
Sbjct: 486 -GVWGSIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRN 544

Query: 524 -KL-IKPEDVDLYTFKAAID 541
            KL I+ E++D+ T +  +D
Sbjct: 545 WKLFIRAENIDIDTGRREVD 564

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  237 bits (605), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 147/496 (29%), Positives = 243/496 (48%), Gaps = 13/496 (2%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           L++ L+ RH+ M                       PA++LI +  +GL++Y+V+  +GE+
Sbjct: 80  LQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGEL 139

Query: 111 AAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+  GFT+Y  R+VD + GFA+ Y Y+ ++ +V P ++ A ++ + YW +  K   
Sbjct: 140 AVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRD 199

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F V+IV+IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 200 G-FVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGG 258

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           +YW +PGAF         +  +              + GTEL G+ AAE +NPR+++PRA
Sbjct: 259 KYWHNPGAFNG-----DNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALPRA 313

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            K   +RI LFY+IS+ L+G+ V Y    LI            PFV+AIK  GI  LP +
Sbjct: 314 AKQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAAS--PFVLAIKTHGISGLPSV 371

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L+ V S  NS +Y  SRTL  LA     P+IF+  +  G P   +  +  F LL 
Sbjct: 372 INVVILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLC 431

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           ++  S     +FN+ + +  +  L +W  I I +LRF +A+ AQ       ++T+    W
Sbjct: 432 FIAQSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVW 491

Query: 470 STWVSLFFCCLIGLIKNYTVF--LGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI- 526
            ++  +   CL+ + + +     +G T +   F   Y+ + V    Y+ +KL  R+    
Sbjct: 492 GSYFGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLYTRNWTFA 551

Query: 527 -KPEDVDLYTFKAAID 541
            + +D+D+ T +  +D
Sbjct: 552 KRAKDIDIDTGRRELD 567

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  236 bits (602), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 150/502 (29%), Positives = 252/502 (50%), Gaps = 20/502 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           +L K L  RH+                         PAS++I+++ +   ++T++  LGE
Sbjct: 63  KLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNSLGE 122

Query: 110 MAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           ++A  P+  GF  Y +R+V+P+ GFAV + YL ++ I+ P +L A ++ ++YW   + +N
Sbjct: 123 LSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYW--NKSIN 180

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
           P  W++IF V I   N + V+ FGE EF LS VK                   P+    G
Sbjct: 181 PDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFIG 240

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
            +YW DPGAF   + A      +              Y+G EL G+ AAE++NPR ++P+
Sbjct: 241 GKYWNDPGAFVGDTPA-----QRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLPK 295

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K T + I + Y++ + L+G  V  NDPLL+            P V+AI+N GI  LP 
Sbjct: 296 AAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAAAS-PLVIAIQNGGIKGLPS 354

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           + NA +L+ + S  NS +Y  SR +  +A     P+  A  +  G P Y++A+++L  LL
Sbjct: 355 LMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLL 414

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           +++  S+   ++F +   +  +  L  W +I + +LRF  A+  Q        Y +    
Sbjct: 415 SFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGE 474

Query: 469 WSTWVSLFFCCLIG--LIKNYTVFL----GHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
           W +W   + C +IG  LI ++   L    G+  D  +F   Y+ +P++  CY+G+K+  R
Sbjct: 475 WGSW---YGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHKIWKR 531

Query: 523 S-KL-IKPEDVDLYTFKAAIDA 542
           + +L IK  +VD+ + +   DA
Sbjct: 532 NLRLYIKLSEVDVDSGRTDTDA 553

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  236 bits (602), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 154/496 (31%), Positives = 245/496 (49%), Gaps = 13/496 (2%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           L+  L++RH+ M                       PA ILI +S  G +++T++  LGE+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMALGEL 147

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+ G FT+YA+R++D + GFA  + Y+ ++ +V P ++ A ++ + YW +  +   
Sbjct: 148 AVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVRYTD 207

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F +++V+IN  GVR +GE EF  S +K                   P     G 
Sbjct: 208 G-FVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYVGA 266

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           RYW +PGAF       S S  K              + G+EL G+  +EAKNPR++VP A
Sbjct: 267 RYWHNPGAFVG-----STSGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVPSA 321

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            K   +RI+LFY+I +LL+G  V YNDP LI            PFV+AI   GI  LP +
Sbjct: 322 AKQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASAS--PFVIAIVTHGISGLPSV 379

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L+ V S  NS +Y  SRTL  L+     PKI +  +  G P   +A+S  F L+A
Sbjct: 380 INVVILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIA 439

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           ++  S+   ++FN+ + +  +    +W +I I ++RF  A+ AQ        + +P    
Sbjct: 440 FVAASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPFVSPAGVI 499

Query: 470 STWVSLFFCCLIGLIKNYTVF--LGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK--L 525
            ++  LF   L+ + + Y     +G +     F S Y+  PV    Y+ +KL  ++   L
Sbjct: 500 GSYWGLFLNILMLIAQFYIALFPIGGSPSAYEFFSAYLAAPVILAFYIAHKLWKKNWKFL 559

Query: 526 IKPEDVDLYTFKAAID 541
           I  EDVD+ T +   D
Sbjct: 560 IPLEDVDIDTGRRDTD 575

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  235 bits (600), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 156/550 (28%), Positives = 267/550 (48%), Gaps = 36/550 (6%)

Query: 3   ESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSM 62
           ESL K N  +    +  E+    D +E+            +     + L + L  RH+  
Sbjct: 35  ESLTKSNYDVQVMGKKYED---MDDVEKAIF---------NTTKRSLNLNRDLSIRHLLT 82

Query: 63  XXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPL-DGFTS 121
                                  PAS++I+++ +   ++T++  LGE+AA  P+  GF  
Sbjct: 83  LAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVNALGELAAVFPVVGGFNV 142

Query: 122 YASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIV 181
           Y +R VDP+LGFAV   YL ++ ++ P +L A ++ ++YW     VN   W+ +F V I 
Sbjct: 143 YVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYW--NNSVNSDAWVAVFYVCIF 200

Query: 182 LINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPY 241
           L + + V+ FGE EF LS VK                   P +   G +YW DPG+F   
Sbjct: 201 LASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKNGYIGAKYWNDPGSFVGA 260

Query: 242 SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFY 301
           S    GS+ K              Y+GTEL G+ AAE+ NPR ++P+A K T + I L Y
Sbjct: 261 SP---GSQFKGLCSVFVTAAFS--YSGTELVGVSAAESANPRYTLPKASKRTFWLITLSY 315

Query: 302 VISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSA 361
           ++ + ++G  V ++DP L+            P V+AI+N GI  LP + NA +L+ + S 
Sbjct: 316 LLVLTIIGCLVRHDDPKLLSASSSVDVAAS-PLVIAIENGGIQGLPSLMNAIILIAIISV 374

Query: 362 CNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIF 421
            NS +Y  SR +  +A     P+IF   +  G P  ++  +++F LL+++  S+   +IF
Sbjct: 375 ANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVFGLLSFIAASNKQEEIF 434

Query: 422 NYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTA-PFQPWSTWVSLFFCCL 480
            +   +  +  L  W++I I+++RF +A+  Q     G+S    P+   +  +  ++ C+
Sbjct: 435 VWLSALSGLSTLFCWLAINISHIRFRRALNTQ-----GYSLDELPYLSMTGVIGSWYGCV 489

Query: 481 IGLIKNYTVFLGHTF-------DYKTFISGYIGIPVYAICYVGYKLVHR--SKLIKPEDV 531
           + ++     F    F       D+++F  GY+ +P++  C+VG+KL  R  S +I+   +
Sbjct: 490 VIILVLIASFWTSLFPAGSSGADWESFFKGYLSLPIFLFCFVGHKLYKRNWSWMIRSNKI 549

Query: 532 DLYTFKAAID 541
           D+ T +  ID
Sbjct: 550 DVNTGRRMID 559

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  234 bits (596), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 148/493 (30%), Positives = 242/493 (49%), Gaps = 16/493 (3%)

Query: 48  GIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACL 107
           G  L K L+ RH+                         PAS++I +  +   ++TV+  L
Sbjct: 75  GENLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINAL 134

Query: 108 GEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREK 166
           GE+AA  P+  GF  Y +R+VDP+  FAV   YL  + +  P +L A ++ ++YW    +
Sbjct: 135 GELAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYW--NRE 192

Query: 167 VNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR 226
           +N   W+TIF V I L+N + V+FF E EF +S +K                   P    
Sbjct: 193 INSDAWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGY 252

Query: 227 TGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSV 286
            G +YW DPGAF   S   +GS+ K              Y+G E+  + AAE+KNPR+++
Sbjct: 253 IGGKYWNDPGAFHGDS---AGSRFKGLCSVFVIAAFS--YSGVEMTAVSAAESKNPRKTI 307

Query: 287 PRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVL 346
           P+A K T + I   Y+  + L+G+ V YND  L+            P V+AI+NAGI  L
Sbjct: 308 PKATKRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASAS-PLVIAIENAGIKGL 366

Query: 347 PHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC 406
           P + NA +L+ + S  NS +YV SR +  +A+    PK+F+K +  G P YS+  ++   
Sbjct: 367 PSLMNAIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVG 426

Query: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF 466
           LL+++  S    ++F +   +  +  +  WI I + ++RF  A+  Q       +Y +  
Sbjct: 427 LLSFIAASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQS 486

Query: 467 QPWSTWVSLFFCCLIGLIKNYTVFL----GHTFDYKTFISGYIGIPVYAICYVGYKL-VH 521
             W +W  +    L+ LI ++ V L      + D + F  GY+  P+    Y+G+K+ + 
Sbjct: 487 GIWGSWYGVIILVLV-LIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIK 545

Query: 522 RSKLIKP-EDVDL 533
             K + P E++D+
Sbjct: 546 NWKWVIPLEEIDI 558

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  233 bits (593), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 147/497 (29%), Positives = 239/497 (48%), Gaps = 15/497 (3%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK  L+ RH+ M                       PA ILI +   G ++Y+++  +GE+
Sbjct: 79  LKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAVGEL 138

Query: 111 AAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+  GFT+YA+R+VD + GFA  + Y+ ++ +V P ++ A ++ + YW +  K   
Sbjct: 139 AVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 198

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F V+IV+IN  GV+ +GE EF  S +K                    +H   G 
Sbjct: 199 G-FVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYIGA 257

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX-XYTGTELCGIVAAEAKNPRRSVPR 288
           +YW +PGAF      +  + G+               + G+EL G+  +EA+ PR+SVP 
Sbjct: 258 QYWYNPGAF------VGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVPG 311

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K   +RI LFY++ +LL+GM V  + P LI            PFV+AI N GI  LP 
Sbjct: 312 AAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAAS--PFVIAIVNHGIKGLPS 369

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           + N  +L+ V S  NS +Y  SRTL  LA     P I    +  G P   +A+S  F L+
Sbjct: 370 VVNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLI 429

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           A++  S     +FN+ + +  +  L +W  I + ++R+  A+ AQ        + AP   
Sbjct: 430 AFVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPAGV 489

Query: 469 WSTWVSLFFCCLIGLIKNYTVFL--GHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-KL 525
           W ++   F C L+ + + Y      G   +   F   Y+   ++   Y  +K+  R+ KL
Sbjct: 490 WGSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYLSFCIFIALYAFHKIWKRNWKL 549

Query: 526 IKP-EDVDLYTFKAAID 541
             P +D+D+ T +  +D
Sbjct: 550 FIPLKDLDIDTGRREVD 566

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  232 bits (592), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 155/545 (28%), Positives = 257/545 (47%), Gaps = 30/545 (5%)

Query: 6   EKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIR---LKKALEARHVSM 62
            K + GI   N+T  +  + D+  R            D + E I    L K L  RH+  
Sbjct: 51  SKDSPGI---NQTTNDITSSDRFRRNE----------DTEQEDINNTNLSKDLSVRHLLT 97

Query: 63  XXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPL-DGFTS 121
                                  PAS++I +  +   ++TV+  LGE++A  P+  GF  
Sbjct: 98  LAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNV 157

Query: 122 YASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIV 181
           Y+ R+++P+  FAV   YL ++ ++ P +L A ++ ++YW   +K+N   W+ IF   I 
Sbjct: 158 YSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--NDKINSDAWVAIFYATIA 215

Query: 182 LINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPY 241
           L N + V+ FGE EF LS +K                   P+    G +YW DPGAF  +
Sbjct: 216 LANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGH 275

Query: 242 SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFY 301
           S   SG++ K              Y+G E+  + AAE+KNPR ++P+A K T + I   Y
Sbjct: 276 S---SGTQFKGLCSVFVTAAFS--YSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASY 330

Query: 302 VISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSA 361
           V  + L+G  V  NDP L+            P V+AI+N GI  LP + NA +L+ V S 
Sbjct: 331 VTILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGGIKGLPSLMNAIILIAVVSV 389

Query: 362 CNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIF 421
            NS +Y  SR +  +A     PK   + +  G P  ++ +++ F LL+++  S   A++F
Sbjct: 390 ANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVF 449

Query: 422 NYFVNVVSIFGLLSWISILITYLRFHKAVIAQ---FGDKSGFSYTAPFQPWSTWVSLFFC 478
            +   +  +  +  W++I ++++RF +A+  Q     +    S T     W  ++ LF  
Sbjct: 450 TWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLV 509

Query: 479 CLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR--SKLIKPEDVDLYTF 536
            +     +     G     ++F  GY+  P+  +CYVG+KL  R  + ++K ED+DL T 
Sbjct: 510 LIASFWTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTG 569

Query: 537 KAAID 541
           +  +D
Sbjct: 570 RKQVD 574

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  231 bits (590), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 148/504 (29%), Positives = 235/504 (46%), Gaps = 18/504 (3%)

Query: 46  HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMA 105
           H+   LKK ++ RHV M                       PA +LI Y+ +G ++Y ++ 
Sbjct: 111 HKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQ 170

Query: 106 CLGEMAAFIP--LDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVS 163
             GEMA        G+ +Y S  VD   GFAV + Y  ++  V P +L   +M ++YW +
Sbjct: 171 ACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 230

Query: 164 REKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPN 223
              VNP V++ IF VL++ IN  G R + E EF+ +  K                    N
Sbjct: 231 --SVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGN 288

Query: 224 HDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPR 283
               G +YW DPGAF     AI   KG               + G+E   I  AE  NPR
Sbjct: 289 DGFIGGKYWHDPGAFNG-KHAIDRFKG----VAATLVTAAFAFGGSEFIAITTAEQSNPR 343

Query: 284 RSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGI 343
           +++P A K  +YRI+  ++ +I+LLG  V YN   L+            P+V+A+ + G+
Sbjct: 344 KAIPGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKAS--PYVIAVASHGV 401

Query: 344 PVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSV 403
            V+PH  NA +LL V S  NS  Y ++R    L+    APK+F+  +  G P  ++ VS 
Sbjct: 402 RVVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSA 461

Query: 404 LFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYT 463
           LF ++A+   S    Q+F + + +  +  L +W +I +++LRF +A+  Q        + 
Sbjct: 462 LFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFK 521

Query: 464 APFQPWSTWVSLFFCCLIGLIKNYTVFLG----HTFDYKTFISGYIGIPVYAICYVGYKL 519
           +    W +  +     LI LI  + V +        D + F   Y+ +P+    YVGYK+
Sbjct: 522 SQTGVWGSAYACIMMILI-LIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKV 580

Query: 520 VHRS-KL-IKPEDVDLYTFKAAID 541
            H+  KL I+ + +DL + +   D
Sbjct: 581 WHKDWKLFIRADKIDLDSHRQIFD 604

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  228 bits (580), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 142/453 (31%), Positives = 220/453 (48%), Gaps = 11/453 (2%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           RLK+ L+ RH+ M                       P  +LI+Y FVG++V      + E
Sbjct: 47  RLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAE 106

Query: 110 MAAFIPLDGFT-SYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           +A+F+P  G T  +A +++D ++GF  G+  +  Y  + P +L+A A++M+YW     V+
Sbjct: 107 VASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMKYWT---DVS 161

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
           P V+IT+F VL V  N   +RF+GE E+    +K                      +R G
Sbjct: 162 PAVFITVFGVLFVATNIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLGGVKGQERLG 221

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
           F YWRDPG F  Y   ++G  GK              Y+G +   I+A E KN R ++  
Sbjct: 222 FHYWRDPGPFANY--LVAGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRYAIFH 279

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
             K    RI++ Y++++ +L + V YND L+             PFV+A+  AGI VLPH
Sbjct: 280 GAKNVFLRIIVLYLVTVFVLTLIVPYNDKLI---ATGTGTAKSSPFVIAMNRAGIKVLPH 336

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           I NA +L   +SA N  +   SR L+ LA   +AP+IF KT+  G+PY  +     F  L
Sbjct: 337 IVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISSFLPL 396

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           AYM+ S  SA +F +F  +VS   LL WI I   ++   +A+ AQ   +S    +    P
Sbjct: 397 AYMSCSESSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCSTRIAP 456

Query: 469 WSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFI 501
           ++ W S     +      +  F+   FD ++F+
Sbjct: 457 FAAWFSGIMSVIFLFTGGFYNFMHGHFDIESFL 489

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  230 bits (586), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 145/501 (28%), Positives = 244/501 (48%), Gaps = 20/501 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           +L K L  RH+                         PAS+++++  V   ++T++  LGE
Sbjct: 87  KLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNALGE 146

Query: 110 MAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           +AA  P+  GF  Y +R+V+P+ GFAV   YL ++ ++ P +L A ++ ++YW     +N
Sbjct: 147 LAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYW--NNTIN 204

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
              W+ IF   I L N + V+ FGE EF LS +K                   P+ +  G
Sbjct: 205 SDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYIG 264

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX-XYTGTELCGIVAAEAKNPRRSVP 287
            RYW DPGAF      +  + G+               Y+GTEL  + AAE+ NPR ++P
Sbjct: 265 GRYWNDPGAF------VGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLP 318

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
           +A K T + I L Y+  + ++G  V YND  L+            P V+AI+N GI  LP
Sbjct: 319 KASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAAS-PLVIAIENGGIKGLP 377

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
            + NA +L+ + S  NS +Y  SR +  +A     PK     +  G P Y++  +++F L
Sbjct: 378 SLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGL 437

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSG-----FSY 462
           L+++  S    ++F +   +  +  L  W SI ++++RF +A+ AQ  D+S       S 
Sbjct: 438 LSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQ--DRSLNELPFVSI 495

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
           T  +  W   + +F   +     +         D ++F  GY+ +P++ +CY+G+K+  +
Sbjct: 496 TGVYGSWYGCIVIFLVLIASFWTSLFPVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKK 555

Query: 523 S-KL-IKPEDVDLYTFKAAID 541
             +L +K +D+DL T +  ID
Sbjct: 556 DWRLYVKTKDMDLDTGRREID 576

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  229 bits (585), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 150/544 (27%), Positives = 259/544 (47%), Gaps = 17/544 (3%)

Query: 4   SLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSMX 63
           +LE+K++  L    +L+  V  +K++             D  +  + L K L  RH+   
Sbjct: 31  ALEEKDS-TLSPLASLDSKVPHEKIQTTTDFASVISHEDDINN--VNLNKNLSIRHLLTL 87

Query: 64  XXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPL-DGFTSY 122
                                 PAS++I +  +   ++TV+  LGEMAA  P+  GF  Y
Sbjct: 88  AVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINALGEMAAAFPVVGGFNVY 147

Query: 123 ASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVL 182
            +R++DP++GFAV   YL ++ ++ P +L A +M ++YW   E +N   W+ IF  +I L
Sbjct: 148 ITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYW--NETINSDAWVAIFYCVIAL 205

Query: 183 INTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYS 242
            N + V+ FGE EF LS +K                   P+    G +YW  PG+F  ++
Sbjct: 206 ANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFIGGKYWNHPGSFVGHN 265

Query: 243 EAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYV 302
              SG+K K              Y+G E+  + AAE+K+PR ++P+A K T + I   YV
Sbjct: 266 ---SGTKFKGLCSVFVTAAFS--YSGIEMTAVSAAESKDPRTTIPKAAKRTFWLITASYV 320

Query: 303 ISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSAC 362
             + L+G  V Y+DP L+            P V+AI+N GI  LP + NA +L+ + S  
Sbjct: 321 TILTLIGCLVPYDDPRLLSGTSSVDAASS-PLVIAIENDGIKGLPSLMNAIILISIISVA 379

Query: 363 NSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFN 422
           NS +Y  SR +  +A     P+I  + +  G P  ++  ++ F LL+++  S   A +F 
Sbjct: 380 NSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFT 439

Query: 423 YFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTW---VSLFFCC 479
           +   +  +  +  W++I ++++RF +++  Q        + +    W +W   + LF   
Sbjct: 440 WLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLVL 499

Query: 480 LIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK--LIKPEDVDLYTFK 537
           +     +     G + D ++F  GY+  P+   CY G+KL  R +  ++   D+DL T +
Sbjct: 500 VASFWTSLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKREFMVGLADMDLDTGR 559

Query: 538 AAID 541
             +D
Sbjct: 560 RQVD 563

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  229 bits (584), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 146/497 (29%), Positives = 239/497 (48%), Gaps = 14/497 (2%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           L+  L+ RH+ M                       PA ILI +   G ++Y+++  LGE+
Sbjct: 81  LQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMALGEL 140

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+ G FT+YA+R++D + GFA    Y+ ++ +V P ++ A ++ + YW +  +   
Sbjct: 141 AVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGTNPRYRD 200

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F + I +IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 201 G-FVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVKGYIGG 259

Query: 230 RYWRDPGAFKPYSEAISGSKG-KXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
           RYW       PY   +  S G +              + G+EL G+ +AE  NPR+SVP+
Sbjct: 260 RYWH-----HPYGAFVGDSAGARFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSVPK 314

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K   +RI LFY++++ ++G+ V Y +  LI            PFV+AI   GI  LP 
Sbjct: 315 AAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAAS--PFVIAITTHGIRGLPS 372

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           + N  +L+ V S  NS +Y  SRTL  LA     PK F   +  G P YS+ V+  F L+
Sbjct: 373 VVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTSGFGLV 432

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           A++  S    ++FN+ + +  +  L +W  I + ++RF KA+ AQ       S+ +P   
Sbjct: 433 AFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFVSPAGV 492

Query: 469 WSTWVSLFFCCLIGLIKNYTVFL--GHTFDYKTFISGYIGIPVYAICYVGYKLVHRS--K 524
           + ++  LF   L+ + + Y      G   + K F   Y+  P+   CY+G+K+  ++   
Sbjct: 493 YGSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIACYLGHKIYKKNWKI 552

Query: 525 LIKPEDVDLYTFKAAID 541
            IK ED+D+ T +   D
Sbjct: 553 FIKAEDMDIDTGRKDDD 569

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  229 bits (584), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 147/496 (29%), Positives = 249/496 (50%), Gaps = 13/496 (2%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK  L++RH+ M                       PAS++I +S  G ++Y+++  + EM
Sbjct: 89  LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEM 148

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+ G FT+YA+R++D + GFA  + Y+ ++ +V P ++ + ++ + YW +  K   
Sbjct: 149 AVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRD 208

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F ++IV+IN  GV+ +GE EF  S++K                   P     G 
Sbjct: 209 G-FVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGA 267

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           +YW DPGAF     A +G++ +              ++G+EL GI  +EA+NPR++VP A
Sbjct: 268 KYWHDPGAF---VGATAGAQFQGFCSVFVTAAFS--FSGSELIGIAGSEAENPRKAVPPA 322

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            K   +RI+LFY++S+L +G+ V  ND  LI            PFV+AI   GI  LP +
Sbjct: 323 AKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAAS--PFVIAITVHGIRGLPSV 380

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L+ V S  NS +Y  SRTL  LA     PK+ +  +  G P   +A+S  F L+A
Sbjct: 381 INVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVA 440

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           ++  S     +FN+ + +  +    +W +I + ++RF  A+ AQ        + +P   +
Sbjct: 441 FVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVF 500

Query: 470 STWVSLFFCCLIGLIKNYTVF--LGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-KLI 526
            ++  LF   L+   + Y     +G T     F S Y+ +PV  + Y+ +KL  ++ K+ 
Sbjct: 501 GSYWGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKNWKIF 560

Query: 527 KP-EDVDLYTFKAAID 541
            P   +DL T +  +D
Sbjct: 561 IPLGQLDLDTGRKQLD 576

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  228 bits (582), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 146/496 (29%), Positives = 246/496 (49%), Gaps = 18/496 (3%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK+ L++RH+ M                       PA ILI ++  G ++Y ++  +GE+
Sbjct: 76  LKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 111 AAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+  GFT+YASR+VD + GFA    Y+ ++ +V P ++ A ++ + YW + +K   
Sbjct: 136 AVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRD 195

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F V+IV IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 196 G-FVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGG 254

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           R W +PGAF       +G KG               + G+EL G+ AAE  NPR+S+P A
Sbjct: 255 RLWHNPGAFA------NGFKG----VCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSA 304

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            K   +RI LFY++++L++G+ V Y    LI            PFV++I+NAGI  LP +
Sbjct: 305 AKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAAS--PFVISIQNAGIKGLPSV 362

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L+ V S  NS ++  SR++  LA     PKIF   +  G P   + V+ +F LL+
Sbjct: 363 INVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLS 422

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           ++  S    ++F++ + +  +  L +W  I++ ++R  +A+ AQ    +  S+TAP   W
Sbjct: 423 FIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVW 482

Query: 470 STWVSLFFCCLIGLIKNYTVF--LGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-KL- 525
            +        LI + + +     +G       F   Y+  P+    Y+G+K+  ++ KL 
Sbjct: 483 GSVYGFVLIILILMAQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLF 542

Query: 526 IKPEDVDLYTFKAAID 541
           I+ +++D+ T +   D
Sbjct: 543 IRAKNIDIDTGRRETD 558

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  228 bits (582), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 142/496 (28%), Positives = 244/496 (49%), Gaps = 13/496 (2%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK  L+ RH+ M                       PAS+LI +  +G ++Y ++  LGE+
Sbjct: 85  LKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMALGEL 144

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+ G FT+YA+R++D + GFA  + Y+ ++ +  P ++ + ++ + YW +  K   
Sbjct: 145 AVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPKYRD 204

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F ++IV IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 205 G-FVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYIGG 263

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           +Y+ DPGAF     A      K              + G+EL G+ A+E+ +PR+SVP+A
Sbjct: 264 KYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVPKA 318

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            K   +RI LFY++S+L++G+ V YND  LI            PFV+AI   GI  LP +
Sbjct: 319 AKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAAS--PFVIAIVTHGIKGLPSV 376

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L+ V S  NS ++  SRT   LA     P+IFA  +  G P   + ++    L+A
Sbjct: 377 VNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIA 436

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           ++  S+    +FN+ + +  +  L +W  I I ++RF KA+ +Q       S+ +P   W
Sbjct: 437 FVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTGVW 496

Query: 470 STWVSLFFCCLIGLIKNYTVF--LGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-KLI 526
            ++  LF   ++ + + Y     +  +   + F   Y+  P+    Y+G+K+  R+ KL+
Sbjct: 497 GSYWGLFMIVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGHKIYKRNWKLL 556

Query: 527 KPE-DVDLYTFKAAID 541
            P  ++D+ + +  +D
Sbjct: 557 IPAGEMDIDSGRREVD 572

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  228 bits (582), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 146/496 (29%), Positives = 243/496 (48%), Gaps = 13/496 (2%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           L+  L+ R  +M                       PA ++I +     ++Y+++  LGE+
Sbjct: 103 LQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGEL 162

Query: 111 AAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+  GFT+YA+R+VD + G+A  + Y  ++ +V P ++ + ++ + YW +  +   
Sbjct: 163 AVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRD 222

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F ++IV+IN  GV+ FGE EF  S +K                   P     G 
Sbjct: 223 G-FVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGA 281

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           +YW DPGAF  +     GS  +              + G+EL GI AAEA NPR+S+P A
Sbjct: 282 KYWHDPGAFVGH-----GSGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGA 336

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            K  ++RIVLFY+ ++ ++G+ V YND  LI            PFV+AI   GI  LP +
Sbjct: 337 AKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAAS--PFVIAIVTHGIKGLPSV 394

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L+ V S  NS ++  SRT+  L+     PK+F   +  G P   +A++  F LLA
Sbjct: 395 INVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLA 454

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           ++  S    ++FN+ + +  +  L +W  I + ++RF  A+ AQ  D +  ++ +P    
Sbjct: 455 FVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGVA 514

Query: 470 STWVSLFFCCLIGLIKNYTVFL--GHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-KLI 526
            ++  LF   L+ + + Y      G   D + F   Y+  P+    Y G+K+  R+ KL 
Sbjct: 515 GSYWGLFMIVLMFIAQFYVALFPPGGKPDAEVFFQSYLSFPIVVATYFGHKIYKRNWKLF 574

Query: 527 KP-EDVDLYTFKAAID 541
            P ED+D+ T +   D
Sbjct: 575 IPLEDMDIDTGRRETD 590

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  227 bits (578), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 140/463 (30%), Positives = 236/463 (50%), Gaps = 15/463 (3%)

Query: 86  PASILISYSFVGLLVYTVMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYF 144
           PAS+++ +  +   ++TV+  LGE+AA  P+  GF  Y +R+VDP++GFAV   YL ++ 
Sbjct: 78  PASLVVGWVIISTCLFTVINSLGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWL 137

Query: 145 IVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXX 204
           ++ P +L A ++ ++YW   +K+N   W+ IF V IVL N + V+ FGE EF LS VK  
Sbjct: 138 VLLPLELVAASLTIKYW--NDKINSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKIL 195

Query: 205 XXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX 264
                            P+    GF+YW +PGAF   + A      K             
Sbjct: 196 AIIGFTILGIVLASGGGPSGGYLGFKYWNNPGAFVGGTNA-----SKFKGLCSVFVTAAF 250

Query: 265 XYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXX 324
            ++G E+  + AAE+KNPR+ +P+A K T + +   YV+ + L+G  V YND  L+    
Sbjct: 251 SFSGIEMIAVSAAESKNPRKVIPKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAAT 310

Query: 325 XXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPK 384
                   P V+AI+N GI  LP + NA +L+ + S  NS +Y  SR +  +A     PK
Sbjct: 311 SVDAAAS-PLVIAIENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPK 369

Query: 385 IFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYL 444
           + +K +  G P  +L V+++F LL+++  S    ++F +   +  +  +  W++I  + +
Sbjct: 370 VLSKVDKKGRPMNALIVTLIFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLI 429

Query: 445 RFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVF--LGHTF-DYKTFI 501
           RF +A+  Q        Y +    W  W  +    L+ +   +T    LG    D ++F 
Sbjct: 430 RFRRAMQVQNRSLDELPYLSQTGIWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFF 489

Query: 502 SGYIGIPVYAICYVGYKL--VHRSKL-IKPEDVDLYTFKAAID 541
             ++ +P+  +CY G+KL      +L I  E++D+ + +  ID
Sbjct: 490 ESFLSLPILLVCYFGHKLYFARNWRLQIGAEEMDIDSGRKIID 532

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  228 bits (580), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 149/497 (29%), Positives = 252/497 (50%), Gaps = 15/497 (3%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           L++ L+ RH+ M                       PA +LI +  +GL++Y V+  +GE+
Sbjct: 77  LQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGEL 136

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+ G FT+YA+R+VD + GFA+ Y Y+ ++ +V P ++ A ++ + +W +  K   
Sbjct: 137 AVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRD 196

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F ++IV+IN  GVR +GE EF  S +K                   P     G 
Sbjct: 197 G-FVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGG 255

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           +YW +PGAF   S   +GS+ K              + GTEL G+ +AE  NPR+++PRA
Sbjct: 256 KYWHNPGAF---SGDDAGSRFKGVCSVFVTAAFS--FAGTELVGLASAETANPRKALPRA 310

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            K   +RI+LFY+IS+ L+G+ V +    LI            PFV+AI+  GI  LP +
Sbjct: 311 AKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAAS--PFVLAIQTHGIKGLPSV 368

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L+ V S  NS +Y  SR++  LA     P IFA  +  G P  ++  + +F LL+
Sbjct: 369 INVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLS 428

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           ++  S     +FN+ + +  +  L SW +I I ++RF +A+ AQ       ++ +     
Sbjct: 429 FIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIA 488

Query: 470 STWVSLFFCCLIGLIKNYTVF---LGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-KL 525
            ++  +    L+ LI  + V    +G + + + F S Y+  PV    Y+ +K+  R+ KL
Sbjct: 489 GSYFGVILVLLV-LIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRNWKL 547

Query: 526 -IKPEDVDLYTFKAAID 541
             + +D+D+ T +  +D
Sbjct: 548 FTRAKDIDIDTGRREMD 564

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  229 bits (584), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 153/538 (28%), Positives = 244/538 (45%), Gaps = 26/538 (4%)

Query: 17  ETLEED----VAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSMXXXXXXXXXX 72
           E LE D    ++ + L+R              K E   LKK+++ RHV M          
Sbjct: 107 EDLENDLTTAISMNSLDRVQNKPTGNGQM---KFEEEALKKSIKPRHVVMISLGTGIGTG 163

Query: 73  XXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIP--LDGFTSYASRYVDPA 130
                        PA ++I Y+ +G  +Y ++   GEMA      L GF +Y S  VDP 
Sbjct: 164 LLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPG 223

Query: 131 LGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRF 190
            GFAV + Y  ++  V P +L   ++ ++YW +   VNP  ++ IF V+I+ I   G R 
Sbjct: 224 FGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTT--TVNPDAFVVIFYVVIIFIQIFGARG 281

Query: 191 FGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKG 250
           + E EF+ +  K                    N    G +YW DPGAF+  +  I   KG
Sbjct: 282 YAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAFRG-TNGIQRFKG 340

Query: 251 KXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGM 310
                          +  TE   + AAE  NPR+++P A K  LYR++  +V +I LLG 
Sbjct: 341 ----IMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLGF 396

Query: 311 TVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVAS 370
            V ++   L+            P+V+AI   G+ V+PH  NA +L+ VFS  NS  Y +S
Sbjct: 397 LVPWDSDQLMGAGGSATKAS--PYVLAISIHGVRVVPHFINAVILISVFSVANSAFYSSS 454

Query: 371 RTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSI 430
           R L GLA    APK F   +  G P+ ++  + LF ++A+   S    Q+F + + +  +
Sbjct: 455 RLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGL 514

Query: 431 FGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVF 490
             L +WI+I ++++RF +A+  Q        + A    + ++ +     L  LI  + V 
Sbjct: 515 SQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVL-ALIAQFWVA 573

Query: 491 LG-----HTFDYKTFISGYIGIPVYAICYVGYKLVHRS--KLIKPEDVDLYTFKAAID 541
           +         D + F   Y+ +P+    Y GYKL  R     I+ +D+DL +++   D
Sbjct: 574 IAPIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDIDLDSYRQVFD 631

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  227 bits (578), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 145/498 (29%), Positives = 240/498 (48%), Gaps = 14/498 (2%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            L K L  RH+                         PAS++I +  +G  ++TV+  LGE
Sbjct: 85  NLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVINSLGE 144

Query: 110 MAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           ++A  P+  GF  Y  R+V+P+  FAV   YL ++ ++ P +L A ++ ++YW   +K+N
Sbjct: 145 LSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--NDKIN 202

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
              W+ IF   I L N + V+ FGE EF LS +K                   P+    G
Sbjct: 203 SDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGGYIG 262

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
            +YWR+PGAF  ++   SG+K K              Y+G E+  + AAE+KNPR ++P+
Sbjct: 263 GKYWRNPGAFVGHN---SGTKFKGLCSVFVTAAFS--YSGIEMTAVSAAESKNPRETIPK 317

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K T + I   YV  + L+G  V  NDP L+            P V+AI+N  I  LP 
Sbjct: 318 AAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGRIKGLPS 376

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           + NA +L+ V S  NS +Y  SR +  +A     PK   + +  G P  ++ +++ F LL
Sbjct: 377 LMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLL 436

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQ---FGDKSGFSYTAP 465
           +++  S+  A++F +   +  +  +  W++I ++++RF KA+  Q     +    S T  
Sbjct: 437 SFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELPFISQTGV 496

Query: 466 FQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR--S 523
              W  +V LF   +     +           ++F  GY+  P+  +CY G+K+  R  +
Sbjct: 497 LGSWYGFVVLFLVLIASFWTSLFPIGSSGASAESFFEGYLSFPILIVCYFGHKIYTRNWT 556

Query: 524 KLIKPEDVDLYTFKAAID 541
            ++K ED+DL T +  +D
Sbjct: 557 LMVKIEDIDLDTGRKQVD 574

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  226 bits (577), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 142/497 (28%), Positives = 246/497 (49%), Gaps = 15/497 (3%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           L++ L+ RH+ M                       PA ILI +  +  ++  +   LGEM
Sbjct: 84  LQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSLGEM 143

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+ G +T+YA+R++D + GFA    Y+ +  +V P ++ A ++ + YW  + +   
Sbjct: 144 AVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQYR- 202

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
             ++ +F + IV IN  GV+ +GE EF  S +K                   P H+  G 
Sbjct: 203 AAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYIGS 262

Query: 230 RYWRDPGAFKPYSEAISGSKG-KXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
           ++W +PGAF      +  + G K              +  TEL G+ AAE ++PR+SVP+
Sbjct: 263 KFWSNPGAF------VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVPK 316

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K   +RI LFY++S+L++G+ V Y DP L+            PFV+A+KN GI  LP 
Sbjct: 317 AAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAAS--PFVLALKNHGIKGLPS 374

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           + N  +L  V S  NS ++  SR L  L+     P +F   +  G P  S+  S  F LL
Sbjct: 375 VINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLL 434

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
            ++ VS    +IF++ +++  +  L  W++I + ++RF KA+ AQ       ++ +P   
Sbjct: 435 CFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGI 494

Query: 469 WSTWVSLFFCCLIGLIKNY-TVFLGHTF-DYKTFISGYIGIPVYAICYVGYKLVHRS--K 524
           W ++ S+F   ++ +++ +  +F GH       F   Y+ +P+    Y+G+K+  ++   
Sbjct: 495 WGSYYSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKNWKL 554

Query: 525 LIKPEDVDLYTFKAAID 541
           LI P+ +D+ T +  +D
Sbjct: 555 LIDPKYMDIDTGRRELD 571

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  227 bits (578), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 149/496 (30%), Positives = 241/496 (48%), Gaps = 13/496 (2%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK  L+ RH+ M                       PA I+I +     ++Y ++  LGE+
Sbjct: 95  LKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGEL 154

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+ G FT+YA+R++D + GFA  + Y  ++    P ++ + ++ + YW + E+   
Sbjct: 155 AVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRD 214

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F ++IV+IN  GVR FGE EF  S++K                   P     G 
Sbjct: 215 G-FVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGG 273

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           RYW +PGAF   +   +G++ K              + G+EL GI AAEA NPR+SVPRA
Sbjct: 274 RYWHNPGAFVGDN---AGTQFKGVCSVFVTAAFS--FAGSELVGITAAEAANPRKSVPRA 328

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            K  ++RIVLFY+ S++++G+ V Y DP LI            PFV+AI   GI  LP +
Sbjct: 329 AKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASAS--PFVIAIVTHGIRGLPSV 386

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L+ V S  NS ++  SRT+  L+     P+IF   +  G P   + V   F L+A
Sbjct: 387 INVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIA 446

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           ++  S    ++F + + +  +  L +W  I + ++RF  A+ AQ    +   + +P    
Sbjct: 447 FIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGII 506

Query: 470 STWVSLFFCCLIGLIKNYTVFL--GHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-KL- 525
            +   LF   L+ + + Y      G     + F   Y+  P+    Y G+K+  ++ KL 
Sbjct: 507 GSSWGLFMLLLMFIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKIYKKNWKLF 566

Query: 526 IKPEDVDLYTFKAAID 541
           IK ED+D+ T +   D
Sbjct: 567 IKAEDMDIDTGRRETD 582

>ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} similar
           to uniprot|Q03770 Saccharomyces cerevisiae YDR160W SSY1
           Component of the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p) which senses external amino
           acid concentration and transmits intracellular signals
           that result in regulation of expression of amino acid
           permease genes
          Length = 836

 Score =  231 bits (588), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 150/557 (26%), Positives = 253/557 (45%), Gaps = 60/557 (10%)

Query: 44  GKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTV 103
           G  +   +++ L  RH+ M                       P   L+ +S  G +V   
Sbjct: 255 GTGDSHHIQRKLRVRHIQMIGIGACLGVGIFLTSGKAFSIAGPFGTLLGFSLSGSIVLAT 314

Query: 104 MACLGEMAAFIPLD-GFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
           +    E++  IPL  GF+  ASR+V+ A GFA+G+ Y F   I  P Q+ A    ++Y+ 
Sbjct: 315 LLSFTELSTLIPLSSGFSGLASRFVEDAFGFALGWTYWFSCMITMPTQVVACTFYLKYFD 374

Query: 163 SREKVNPGV---WITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXX 219
           S   +N G    + T+F++  VL+N + VR  GE  +    +K                 
Sbjct: 375 SL-NLNKGAIAGFATLFMLYAVLVNLLDVRLMGEIVYITGLIKIIISIIMILAMVILNSG 433

Query: 220 XXPNHDRTGFRYWRDP--------GAFKPY----------SEAISGSKGKXXXXXXXXXX 261
               +DR GFR+W           G F+P           ++ I GS G+          
Sbjct: 434 TGTKYDRVGFRFWDSSKSSSNLTYGLFRPTFDLNDIGDGSTKGIEGSGGRFLALASTMLI 493

Query: 262 XXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLI- 320
               YTG E+  + + EA NPR+++P A K T   +++ YV +I  + + +   DP L  
Sbjct: 494 STFAYTGVEMAFVASGEAINPRKTIPSATKRTFCIVLVIYVFTIFSVSINIYCGDPRLQP 553

Query: 321 --------------------------------XXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
                                                       P+V+A++N G+     
Sbjct: 554 YFTGSYSARYQAVQRGVGSQWQLSHKCHTNIPYSTKDPVDHNSSPWVLALQNFGLCTFAA 613

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           +FN  ++ F   A  S L+ +SRTLY +A+ RKAP IF + N  GVPY S+  S +F ++
Sbjct: 614 VFNGILIFFTSGAEISSLFSSSRTLYSMAVQRKAPTIFQRCNKRGVPYVSVIFSGMFGVV 673

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFG----DKSGFSYTA 464
            Y+ V SG+ + FN   N+ S    + W+ + +++LRF+ A+  +      D+  + Y +
Sbjct: 674 GYLAVDSGAVENFNVLSNMSSASTSIIWMGLNVSFLRFYYALKTRRDIISRDEKSYPYRS 733

Query: 465 PFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK 524
           PFQP+  +  LF CCL  +   +T F+ H ++ K+F S Y G+ ++ +CY+GYK++  SK
Sbjct: 734 PFQPYLAFYGLFGCCLFIIFMGFTNFIHHFWNVKSFFSAYGGLILFVVCYLGYKMIGTSK 793

Query: 525 LIKPEDVDLYTFKAAID 541
           + + + +D+ T +  +D
Sbjct: 794 IQRLDQLDMDTGRREMD 810

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  227 bits (578), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 150/509 (29%), Positives = 240/509 (47%), Gaps = 21/509 (4%)

Query: 42  VDGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVY 101
           V GK E   LK +++ RHV M                       PA ++I Y+ +G  +Y
Sbjct: 116 VAGKSE--ELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIY 173

Query: 102 TVMACLGEMAAFIP--LDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQ 159
            ++   GEMA      + GF SY S  ++PALGF+V + Y  ++  V P +L   +M ++
Sbjct: 174 CIIQATGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIK 233

Query: 160 YWVSREKVNPGVWITIFLVLIVLINTVG-VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXX 218
           YW +  KV+P V++ IF VLI+LIN +G    + E EF+ +S K                
Sbjct: 234 YWTT--KVDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILIC 291

Query: 219 XXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAE 278
               +    G RYW DPGAF+    AI   KG               +  +E+ G+ A+E
Sbjct: 292 GGAGDDGYIGGRYWHDPGAFRG-EHAIDRFKG----VVSTLVNAAFAFGLSEMIGVTASE 346

Query: 279 AKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAI 338
             NPR+++P A K  +YRIV  Y+ S++++G  V +N   L+            P+V+A+
Sbjct: 347 QSNPRKAIPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKAS--PYVLAV 404

Query: 339 KNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYS 398
              G+ V+PH  NA +LL V S  NS  Y +SR L GLA    APKIF   +  G P   
Sbjct: 405 STHGVRVVPHFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMG 464

Query: 399 LAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKS 458
           + V+ L  ++++   S    Q+F + + +  +  L +W +I ++++RF +A+  Q     
Sbjct: 465 MCVAALVNVISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLG 524

Query: 459 GFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLG----HTFDYKTFISGYIGIPVYAICY 514
              + +    W +W +     LI LI  + V +        D + F   Y+  P+    Y
Sbjct: 525 EIGFKSQCGVWGSWYAFIMMMLI-LIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALY 583

Query: 515 VGYKLVHRS--KLIKPEDVDLYTFKAAID 541
            GYK+  +     I+ +D+DL   +   D
Sbjct: 584 FGYKIYTKDWRLFIRAKDIDLDINRDVFD 612

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  226 bits (575), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 152/498 (30%), Positives = 251/498 (50%), Gaps = 17/498 (3%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK  L++RH+ M                       PA ILI ++  G ++Y+++  +GE+
Sbjct: 87  LKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAVGEL 146

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+ G FT+YA+R++D + GFA+ + Y+ ++ I  P ++ + ++ + YW    K   
Sbjct: 147 AVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAKYRD 206

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F V  V+IN  GV+ +GE EF  + +K                   P     G 
Sbjct: 207 G-FVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIGA 265

Query: 230 RYWRDPGAFKPYSEAISGSKG-KXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
           +YW  PGAF      +  + G K              + G+E+ G+  +E++NPR+SVP 
Sbjct: 266 KYWHHPGAF------VGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVPG 319

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K   +RI LFYV+ +LL+GM V YND  LI            PFV+A+ N GI  LP 
Sbjct: 320 AAKQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAAS--PFVIAVVNQGIRGLPS 377

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           + N  +L+ V S  NS +Y+ SRTL  LA     PKI A  +  G P  ++ ++  F L+
Sbjct: 378 VINVVILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLI 437

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           A++  SS   ++FN+ + +  +  L SW +I I ++RF +A++AQ        + +    
Sbjct: 438 AFVAESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGI 497

Query: 469 WSTWVSLFFCCLIGLIKNYTVFL---GHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-K 524
             ++  +F C L+ LI  + V L   G + + K F   Y+  P+    Y+ +K+  ++ K
Sbjct: 498 AGSYWGIFICVLM-LIAQFYVGLFPAGASPNAKDFFMAYLSFPIVLAFYIFHKIWKKNWK 556

Query: 525 L-IKPEDVDLYTFKAAID 541
           L IK ED+D+ T +  +D
Sbjct: 557 LYIKAEDMDIDTGRREVD 574

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  225 bits (573), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 147/499 (29%), Positives = 232/499 (46%), Gaps = 17/499 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            LKKA+++RHV M                       P +++I Y  V  + Y ++   GE
Sbjct: 65  HLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQAAGE 124

Query: 110 MAAFIPL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA   P     F +Y S ++   +GFA  + +L ++  V P +L  G M +QYW   + +
Sbjct: 125 MAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYW--NDSI 182

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           N  VWI IF V ++ ++  GV+ +GE EF  ++ K                         
Sbjct: 183 NADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDGYI 242

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YW++PG+F     A S S G+              Y GTEL  +   E  NPRRS P
Sbjct: 243 GAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRSTP 297

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
           +A K ++YRI++ Y+++++L+G  V +++  L+            P+V+A    G+ V+P
Sbjct: 298 KAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHAS--PYVLAASIHGVKVVP 355

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           HI NA +L+ V S  NS LY A R    LA    APK  A  +  G P  +LA   +  +
Sbjct: 356 HIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAVVGV 415

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           +A+   SS   Q+F +   + ++  L +W +IL++++RF  A+  Q  D +   Y A   
Sbjct: 416 IAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTG 475

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFL---GHTFDYKTFISGYIGIPVYAICYVGYKLVHR-- 522
            W +     FC L+  I  + V L   G T   + F   Y+  P++   Y  Y L  R  
Sbjct: 476 VWGSMWGFGFCVLV-FIAQFWVALSPPGGTISAEGFFESYLAFPLWLFFYFAYMLWKRDF 534

Query: 523 SKLIKPEDVDLYTFKAAID 541
           + L K ED+DL   +   D
Sbjct: 535 TFLTKLEDIDLDAHRRIYD 553

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  225 bits (574), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 138/462 (29%), Positives = 234/462 (50%), Gaps = 14/462 (3%)

Query: 86  PASILISYSFVGLLVYTVMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYF 144
           PAS++I +  +   ++TV+  LGE++A  P+  GF  Y+ R+V+P+  FAV   YL ++ 
Sbjct: 121 PASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWL 180

Query: 145 IVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXX 204
           ++ P +L A ++ ++YW   +K+N   W+ IF   I L N + V+ FGE EF LS +K  
Sbjct: 181 VLLPLELVAASITIKYW--NDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKIL 238

Query: 205 XXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX 264
                            P+    G +YW DPGAF  +S   SG++ K             
Sbjct: 239 SIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHS---SGTQFKGLCSVFVTAAFS- 294

Query: 265 XYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXX 324
            Y+G E+  + AAE+KNPR ++P+A K T + I   YV  + L+G  V  NDP L+    
Sbjct: 295 -YSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSS 353

Query: 325 XXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPK 384
                   P V+AI+N GI  LP + NA +L+ V S  NS +Y  SR +  +A     PK
Sbjct: 354 SVDAASS-PLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPK 412

Query: 385 IFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYL 444
              + +  G P  ++ +++ F LL+++  S   A++F +   +  +  +  W++I ++++
Sbjct: 413 FLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHI 472

Query: 445 RFHKAVIAQ---FGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFI 501
           RF +A+  Q     +    S T     W  ++ LF   +     +         + ++F 
Sbjct: 473 RFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAESFF 532

Query: 502 SGYIGIPVYAICYVGYKLVHR--SKLIKPEDVDLYTFKAAID 541
            GY+  P+  +CY G+K+  R  + ++K ED+DL T +  +D
Sbjct: 533 EGYLSFPILIVCYFGHKIYTRNWTLMVKLEDIDLDTGRKQVD 574

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  226 bits (575), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 146/504 (28%), Positives = 235/504 (46%), Gaps = 18/504 (3%)

Query: 46  HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMA 105
           H+   LKK ++ RHV M                       PA +LI Y+ +G ++Y ++ 
Sbjct: 111 HKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQ 170

Query: 106 CLGEMAAFIP--LDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVS 163
             GEMA        G+ +Y S  VD   GFAV + Y  ++  V P +L   +M ++YW +
Sbjct: 171 ACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT 230

Query: 164 REKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPN 223
              VNP V++ IF VL++ IN  G R + E EF+ +  K                    N
Sbjct: 231 --SVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGN 288

Query: 224 HDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPR 283
               G +YW +PGAF     AI   KG               + G+E   I  AE  NPR
Sbjct: 289 DGYIGGKYWHEPGAFNGV-HAIDRFKG----VVATLVTAAFAFGGSEFIAITTAEQSNPR 343

Query: 284 RSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGI 343
           +++P A K  +YRI+  ++ +I+++G  V YN   L+            P+V+AI + G+
Sbjct: 344 KAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKAS--PYVIAIASHGV 401

Query: 344 PVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSV 403
            V PH  NA +LL V S  NS  Y ++R    L+    APKIF+  +  G P  ++ VS 
Sbjct: 402 RVAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSA 461

Query: 404 LFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYT 463
           LF ++A+   S    Q+F + + +  +  L +W +I ++++RF +A+  Q        + 
Sbjct: 462 LFAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFK 521

Query: 464 APFQPWSTWVSLFFCCLIGLIKNYTVFLG----HTFDYKTFISGYIGIPVYAICYVGYKL 519
           +    W +  S     LI LI  + V +        D + F   Y+ +P+  + YVGYK+
Sbjct: 522 SQTGVWGSIYSCIMMILI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIVLYVGYKM 580

Query: 520 VHRS-KL-IKPEDVDLYTFKAAID 541
            ++  KL I+ + +DL + +   D
Sbjct: 581 WNKDWKLFIRADKIDLTSHRQIFD 604

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  225 bits (573), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 141/462 (30%), Positives = 237/462 (51%), Gaps = 14/462 (3%)

Query: 86  PASILISYSFVGLLVYTVMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYF 144
           PAS++I +  +   ++TV+  LGE+AA  P+  GF  Y +R+VDP+  FAV   YL ++ 
Sbjct: 113 PASLVIDWVIISTCLFTVINSLGELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWL 172

Query: 145 IVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXX 204
           ++ P +L A ++ ++YW S   +N   W+ IF  +I L N + V+ FGE EF LS VK  
Sbjct: 173 VLLPLELVAASITIKYWNS--TINSDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKIL 230

Query: 205 XXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX 264
                            P     G +YW +PGAF  ++   SG+K K             
Sbjct: 231 AIIGFTILGIVLSCGGGPKGGYLGGKYWHNPGAFVGHT---SGTKFKGLCSVFVTAAFS- 286

Query: 265 XYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXX 324
            Y+G E+  + AAE+K+PR+++P+A K T + I   YV  + L+G  V Y+DP L+    
Sbjct: 287 -YSGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTS 345

Query: 325 XXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPK 384
                   P V+AI+N GI  L  + NA +L+ + S  NS +Y  SR +  +A     PK
Sbjct: 346 SVDAAAS-PLVIAIENGGIKGLDSLMNAIILISIISVANSAVYACSRCMVSMAHIGNLPK 404

Query: 385 IFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYL 444
              K +  G P  +  V++ F LL+++  S    ++F +   +  +  +  W++I I+++
Sbjct: 405 KLGKVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINISHI 464

Query: 445 RFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFL---GHTFDYKTFI 501
           RF +A+I Q        Y +    W +   +    L+ +   +T      G + D ++F 
Sbjct: 465 RFRQAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVASFWTSLFPLGGDSADVQSFF 524

Query: 502 SGYIGIPVYAICYVGYKLVHR--SKLIKPEDVDLYTFKAAID 541
            GY+ +P+  +CY+G+KL  +  S ++  E++DL T + A+D
Sbjct: 525 EGYLSLPILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKALD 566

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  224 bits (572), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 144/499 (28%), Positives = 242/499 (48%), Gaps = 14/499 (2%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            L K L  RH+                         PAS++I +  V   ++TV+  LGE
Sbjct: 87  NLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINSLGE 146

Query: 110 MAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           +AA  P+  GF  Y +R+++P+  FA+   YL ++ ++ P +L A ++ ++YW   +K+N
Sbjct: 147 LAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYW--NDKIN 204

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
              W+ IF   I L N + V+ FGE EF LS VK                   P+    G
Sbjct: 205 SDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGYIG 264

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
            +YW +PGAF  +S   +GS+ K              Y+G E+  + AAE++NP+ ++P+
Sbjct: 265 GKYWHNPGAFVGHS---AGSQFKGLCSVFVTAAFS--YSGIEMTAVSAAESRNPKETIPK 319

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K T + I + YV  + L+G  V YNDP L+            P V+AI+N GI  LP 
Sbjct: 320 AAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAAS-PLVIAIENGGIKGLPS 378

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           + NA +L+ + S  NS +Y  SR +  +A     PK  +K +  G P  ++ +++ F LL
Sbjct: 379 LMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLL 438

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           +++  S    ++F +   +  +  +  W++I ++ +RF  A+ AQ        + +    
Sbjct: 439 SFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQSGT 498

Query: 469 WSTWVSLFFCCLIGLIKNYTVFL---GHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-K 524
           W  W  +    L+ +   +T        T   K+F  GY+ +P+   CYVG+KL  R  +
Sbjct: 499 WGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKRDWR 558

Query: 525 LIKP-EDVDLYTFKAAIDA 542
           L+ P  ++DL + +  +DA
Sbjct: 559 LLVPLMEMDLDSGRRVLDA 577

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  224 bits (572), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 156/551 (28%), Positives = 257/551 (46%), Gaps = 25/551 (4%)

Query: 1   MSESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHV 60
           +  S EK  A I  +   ++E++    L             ++ K +   LKK ++ RHV
Sbjct: 103 VKNSPEKDTASITSNEMMIDEEIL--SLSNLDGQRVPPPRKIENKSD--ELKKTIKPRHV 158

Query: 61  SMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMA-AFIPL-DG 118
            M                       PA +L+ +  +G  +Y ++  +GEMA A+  L  G
Sbjct: 159 LMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGEMAVAYSDLVGG 218

Query: 119 FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLV 178
           F +Y S  VDPA GF+V + Y  ++  V P +L   +M ++YW +  KV+P V++ IF V
Sbjct: 219 FNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTT--KVDPDVFVIIFYV 276

Query: 179 LIVLINTVG-VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGA 237
           LI+ IN VG    + E EF  +S K                    N    G +YW +PGA
Sbjct: 277 LILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIGGKYWHEPGA 336

Query: 238 FKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRI 297
           F+    AI   KG               +  +E  G+ A+E  NPR+++P A K  LYRI
Sbjct: 337 FRG-EHAIDRFKG----VMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMLYRI 391

Query: 298 VLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLF 357
           V  ++ SI ++G  V Y+   L+            P+V+A+   G+ V+PH  NA +L+ 
Sbjct: 392 VCMFLASITIVGFLVPYDSDQLLGSSGGGVKAS--PYVLAVSTHGVKVVPHFINAVILIS 449

Query: 358 VFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGS 417
           V S  NS  Y +SR L  LA    APKIF   +  G P   +A++ LF ++A+   S   
Sbjct: 450 VLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAFCATSPKE 509

Query: 418 AQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW-STWVSLF 476
            ++F + + +  +  L +WI+I ++++RF +A+  Q        + +    W S++ ++ 
Sbjct: 510 DEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWGSSYAAIM 569

Query: 477 FCCLIGLIKNYTVFLG----HTFDYKTFISGYIGIPVYAICYVGYKLVHR--SKLIKPED 530
             C+  LI  + V +        D K F   Y+ +P+    Y GYK+  +  +  I+ +D
Sbjct: 570 MVCI--LIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKNWTIFIRAKD 627

Query: 531 VDLYTFKAAID 541
           +DL + +   D
Sbjct: 628 IDLVSHRNIFD 638

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  223 bits (568), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 143/466 (30%), Positives = 236/466 (50%), Gaps = 20/466 (4%)

Query: 86  PASILISYSFVGLLVYTVMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYF 144
           PAS++I +  +   ++TV+  LGE+AA  P+  GF  Y +R+VDP++ FA+   YL ++ 
Sbjct: 127 PASLVIDWVIISTCLFTVINALGELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWL 186

Query: 145 IVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXX 204
           ++ P +L A ++ ++YW   + +N   W+ IF  +I L N + V+ FGE EF LS VK  
Sbjct: 187 VLLPLELVAASITIKYW--NDTINSDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKIL 244

Query: 205 XXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAF---KPYSEAISGSKGKXXXXXXXXXX 261
                            P     G  YW DPG+F   KP ++     KG           
Sbjct: 245 AIIGFTILGIVLACGGGPQGGFLGGHYWHDPGSFVGDKPGTQF----KG----LCSVFVT 296

Query: 262 XXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIX 321
               Y+G EL  + AAE+K+PR+++P+A K T + +   YV  + ++G  V ++DP L+ 
Sbjct: 297 AAFSYSGIELTAVSAAESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLN 356

Query: 322 XXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRK 381
                      P V++IKNAGI  L  + NA +L+ + S  NS +Y  SR +  +A    
Sbjct: 357 GSSSVDAAAS-PLVISIKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGN 415

Query: 382 APKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILI 441
            PK+ ++ +  G P  ++  ++ F LL+++  S   A++F +   +  +  +  W++I  
Sbjct: 416 LPKVLSRVDKRGRPVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINY 475

Query: 442 TYLRFHKAVIAQFGDKSGFSYTAPFQPWSTW--VSLFFCCLIGLIKNYTVFLGH-TFDYK 498
           +++RF  A+  Q        Y +      +W  V + F  L+         LG  T D  
Sbjct: 476 SHIRFRAAMKVQNKTLDELPYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTADVT 535

Query: 499 TFISGYIGIPVYAICYVGYKLVHRS--KLIKPEDVDLYTFKAAIDA 542
           +F  GY+ +P+   CYVG+KL  R+   L+K ED+DL T +  IDA
Sbjct: 536 SFFEGYLSLPILIACYVGHKLYVRNLQVLVKLEDMDLETGRKHIDA 581

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  223 bits (568), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 145/499 (29%), Positives = 231/499 (46%), Gaps = 18/499 (3%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LKK ++ RHV M                       PA +LI Y  +G ++Y ++   GEM
Sbjct: 116 LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEM 175

Query: 111 AAFIP--LDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           A        G+ +Y S  VD   GFAV + Y  ++  V P +L   +M ++YW +   VN
Sbjct: 176 ALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT--SVN 233

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
           P V++ IF VL++ IN  G R + E EF+ +  K                    N    G
Sbjct: 234 PDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIG 293

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
            +YW DPGAF     +I   KG               + G+E   I  AE  NPR++VP 
Sbjct: 294 GKYWHDPGAFNG-KHSIDRFKG----VVATLVTAAFAFGGSEFIAITTAEQANPRKAVPG 348

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K  +YRI+  ++ +I+LLG  V YN   L+            P+V+A+ + G+ V+PH
Sbjct: 349 AAKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKAS--PYVIAVASHGVRVVPH 406

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
             NA +LL V S  NS  Y ++R L  L+    AP++F   +  G P  ++ VS LF ++
Sbjct: 407 FINAVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVI 466

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           A+   S    Q+F + + +  +  L +W +I ++++RF +A+  Q        + +    
Sbjct: 467 AFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGV 526

Query: 469 WSTWVSLFFCCLIGLIKNYTVFLG----HTFDYKTFISGYIGIPVYAICYVGYKLVHRS- 523
           W +  +     LI LI  + V +        D + F   Y+ +P+    YVGYK+  +  
Sbjct: 527 WGSTYACIMMILI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDW 585

Query: 524 KL-IKPEDVDLYTFKAAID 541
           KL I+ + +DL + +   D
Sbjct: 586 KLFIRADKIDLISHRQIFD 604

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  223 bits (567), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 142/502 (28%), Positives = 238/502 (47%), Gaps = 21/502 (4%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           +LKK ++ RHV M                       PA ++I Y+ +   +Y ++  +GE
Sbjct: 98  KLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAVGE 157

Query: 110 MAA--FIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA      + GF +Y    VDPAL F++ + Y  ++F V P +L   +M +QYW +  KV
Sbjct: 158 MAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTT--KV 215

Query: 168 NPGVWITIFLVLIVLINTVG-VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR 226
           N  +++ IF +L++ IN  G  R + E EF  +S K                    N   
Sbjct: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275

Query: 227 TGFRYWRDPGAFKPYSEAISGSKG--KXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRR 284
            G +YWRDPGAF+       GS G  +              +  TE   I A+E  NPR+
Sbjct: 276 IGGKYWRDPGAFR-------GSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328

Query: 285 SVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIP 344
           ++P A K  +YR +L Y+ SI+++G+ V Y+   L+            P+V+A+   G+ 
Sbjct: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKAS--PYVLAVSTHGVR 386

Query: 345 VLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVL 404
           V+PH  NA +L+ VFS  +S  Y +SR L  LA    APK+F   +  G P     V  +
Sbjct: 387 VVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAV 446

Query: 405 FCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTA 464
             ++A+   SS   ++FN+ + +  +  + +W  I ++++RF +A+  Q        Y +
Sbjct: 447 IAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKS 506

Query: 465 PFQPWSTWVSLFFCCLIGLIKNYT--VFLGH-TFDYKTFISGYIGIPVYAICYVGYKLVH 521
               W +  +     LI + + +   V +G  + D + F   Y+ +PV+ + Y+GYK+  
Sbjct: 507 QVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWK 566

Query: 522 RS--KLIKPEDVDLYTFKAAID 541
           R     I+ +D+DL + +   D
Sbjct: 567 RDWRLFIRAKDIDLISHRHIHD 588

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  222 bits (566), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 145/505 (28%), Positives = 233/505 (46%), Gaps = 18/505 (3%)

Query: 45  KHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVM 104
             +   LK+ ++ RHV +                       PA +LI YS +G  +Y ++
Sbjct: 100 NQKNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCII 159

Query: 105 ACLGEMA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
              GE+A ++  L G F  Y S  VDPA GF+V + Y  ++  V P +L   +M ++YW 
Sbjct: 160 QAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWT 219

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
           +   VN  +++ IF VLI++INT G R + E EF+ +  K                    
Sbjct: 220 T--TVNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAG 277

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
           N    G RYW  PGAF      I   KG               +  TE   + AAE  NP
Sbjct: 278 NDGYIGDRYWHTPGAFAG-DRPIDHFKG----IMATMVTAAFAFGATEFIALTAAEQSNP 332

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           R+++P A K  LYRI+  ++ SI L+G  V Y+   L+            P+V+A+   G
Sbjct: 333 RKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKAS--PYVLAVSTHG 390

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
           + V+PH  NA +LL V S  NS  Y +SR LY LA    APK F   +  G P+ ++  +
Sbjct: 391 VKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCA 450

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
            +F ++++   S    Q+F + + +  +  + +W +I ++++RF KA+  Q        +
Sbjct: 451 GVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGF 510

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLG----HTFDYKTFISGYIGIPVYAICYVGYK 518
            A    W ++   F   +I LI  + V +        D + F   Y+ +P+  + YVGYK
Sbjct: 511 KAQTGVWGSYYVCFMLVMI-LIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYK 569

Query: 519 LVHR--SKLIKPEDVDLYTFKAAID 541
           +  +  S  I+  ++DL   +   D
Sbjct: 570 IWKKDWSLFIRANNIDLDKHRQIFD 594

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  220 bits (561), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 150/507 (29%), Positives = 233/507 (45%), Gaps = 26/507 (5%)

Query: 16  NETLEEDVAFDKLERXXXXXXXXXXXVDG-----KHEGIRLKKALEARHVSMXXXXXXXX 70
             ++++    DKLE             D       H G+  K+AL+ RH+S+        
Sbjct: 4   TNSIQQREDLDKLEPKIAEVELQRLETDSLNEFDPHSGV--KRALKNRHISLLALGGIIG 61

Query: 71  XXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDG-FTSYASRYVDP 129
                          P ++L+ +  +GL+ +++M  +GE+    P  G F + A R+   
Sbjct: 62  PGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSE 121

Query: 130 ALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVR 189
            L    GY Y+  +F V  N+    + ++Q+W  +  +    +  IF    ++   +GV 
Sbjct: 122 GLSAVSGYAYIVVFFAVLANEYNTISSILQFWGPQVPIYG--YTLIFWFFFLVFQLIGVG 179

Query: 190 FFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSK 249
            FGE E+WL+  K                   P     GF+YW++PGA       I+   
Sbjct: 180 AFGECEYWLAWFKILGLVAFYIFSIVYMSGGIPGKPPIGFQYWKNPGALSHGFRGIA--- 236

Query: 250 GKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLG 309
                           Y+GTE   + A E++NPR++VP A++ T +RI++ Y+      G
Sbjct: 237 -------VVFVFCSTFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYG 289

Query: 310 MTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVA 369
           +TV YNDP L             P  +A+  AG     H+ NA +L+   SA NS LY+ 
Sbjct: 290 VTVPYNDPTL----GAQTKSLKSPISIALSRAGWAGGVHLVNAFILMTCISAINSSLYIG 345

Query: 370 SRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVS 429
           SRTL  LA +  AP+I A T+  GVP  +L V     L++ MNVS G++  +NY VN+  
Sbjct: 346 SRTLSHLAHEGLAPRILAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLSG 405

Query: 430 IFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTV 489
           +   + W +I IT+LRF KA +AQ    S   Y A F PW+T  SL     + LI+ +T 
Sbjct: 406 VGVFIVWSAISITHLRFRKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGWTS 465

Query: 490 FLGHTFDYKTFISGYIGIPVYAICYVG 516
            +   F  K F+  YI +P   + YVG
Sbjct: 466 LV--PFVAKDFVDAYILLPAAGLLYVG 490

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  222 bits (566), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 142/508 (27%), Positives = 243/508 (47%), Gaps = 16/508 (3%)

Query: 42  VDGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVY 101
           +  K E   L+K+++ RHV M                       PA ++I Y+ +G  +Y
Sbjct: 118 ITSKEEDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLY 177

Query: 102 TVMACLGEMA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQ 159
            ++   GEMA ++  L G F +Y +  VD   GFAV + Y  ++  V P +L   +M + 
Sbjct: 178 CIIQACGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTID 237

Query: 160 YWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXX 219
           YW +  KVN  +++ IF VLI+LIN  G + + E +F+ ++ K                 
Sbjct: 238 YWTT--KVNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAG 295

Query: 220 XXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEA 279
                   G +YW DPGAF+        S  +              +  +E   I A+E 
Sbjct: 296 GAGTSGYIGAKYWHDPGAFRG-----DRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQ 350

Query: 280 KNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIK 339
            NPRR++P A K+ +YRI+  ++ SI L+G  V Y+   L+            P+V+AI 
Sbjct: 351 SNPRRAIPSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKAS--PYVLAIS 408

Query: 340 NAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSL 399
           + G+ V+PH  NA +LL V S  NS  Y + R L+ L+    AP+ F   +  G P  ++
Sbjct: 409 SHGVRVVPHFINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAM 468

Query: 400 AVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSG 459
            +S+LF ++A+   SS   ++F + + +  +  + +W++I ++++RF +A+  Q    S 
Sbjct: 469 IISILFGIIAFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISE 528

Query: 460 FSYTAPFQPWST--WVSLFFCCLIGLIKNYTVFLGHT-FDYKTFISGYIGIPVYAICYVG 516
             + +    W +    ++ F  LI         +G    D K+F   Y+ +P+  + Y G
Sbjct: 529 LGFRSQLGVWGSVYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFG 588

Query: 517 YKLVHRS-KL-IKPEDVDLYTFKAAIDA 542
           YK+ +R  KL I+ +++DL T +   DA
Sbjct: 589 YKIYNRDWKLFIRAKNIDLITHRNIFDA 616

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  221 bits (563), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 144/508 (28%), Positives = 242/508 (47%), Gaps = 17/508 (3%)

Query: 43  DGKHEGIR---LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLL 99
           D + E I    L K L  RH+                         PAS++I +  +   
Sbjct: 75  DVQQEDINNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTC 134

Query: 100 VYTVMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVM 158
           ++TV+  LGE++A  P+  GF  Y+ R+V+P+  FAV   YL ++ ++ P +L A ++ +
Sbjct: 135 LFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITI 194

Query: 159 QYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXX 218
           +YW   +K+N   W+ IF   I + N + V+ FGE EF LS +K                
Sbjct: 195 KYW--NDKINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLSC 252

Query: 219 XXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAE 278
              P+    G +YW DPGAF  +    SG+K K              Y+G E+  + AAE
Sbjct: 253 GGGPHGGYIGGKYWNDPGAFVGHD---SGTKFKGLCSVFVTAAFS--YSGIEMTAVSAAE 307

Query: 279 AKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAI 338
           +KNPR ++P+A K T + I + YV  + L+G  V  NDP L+            P V+AI
Sbjct: 308 SKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASS-PLVIAI 366

Query: 339 KNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYS 398
           +N  I  LP + NA +L+ V S  NS +Y  SR +  +A     PK   + +  G P  +
Sbjct: 367 ENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINA 426

Query: 399 LAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKS 458
           + +++ F LL+++  S   A++F +   +  +  +  W++I ++++RF +A+  Q     
Sbjct: 427 IVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLD 486

Query: 459 GFSYTAPFQPWST---WVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYV 515
              + +    W +   +V LF   +     +         + ++F  GY+  P+  +CY 
Sbjct: 487 ELPFISQTGVWGSIYGFVVLFLVLIASFWTSMFPIGSSGANAESFFEGYLSFPILIVCYF 546

Query: 516 GYKLVHRS--KLIKPEDVDLYTFKAAID 541
           G+K+  R    L+K ED+DL T +  +D
Sbjct: 547 GHKIYTRDWRLLVKLEDMDLDTGRKQVD 574

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  221 bits (564), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 154/502 (30%), Positives = 244/502 (48%), Gaps = 24/502 (4%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LKK ++ RHV M                       PA+++I Y+ +G  +Y ++   GE+
Sbjct: 120 LKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQAAGEL 179

Query: 111 AA-FIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           A  +  L+G F +Y S  VDPALGF+V + Y  ++  V P +L   +M ++YW +  KV+
Sbjct: 180 AVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTT--KVD 237

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
           P V++ IF VLI+ INT G R + E EF+ +  K                    N    G
Sbjct: 238 PDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGYLG 297

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
            +YW DPGAF    ++I   KG               +  TE   + AAE  NPR+++P 
Sbjct: 298 AKYWHDPGAFNG-DKSIDRFKG----VMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPS 352

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K  LYRIV  ++ SI L+G  V YN   L+            P+V+A+ + G+ V+PH
Sbjct: 353 AAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKAS--PYVIAVSSHGVRVVPH 410

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
             NA +LL V S  NS  Y +SR L  LA    APK F   +  G P+ ++ +S LF ++
Sbjct: 411 FINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVI 470

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQ---FGDKSGFSYTAP 465
           A+   S    ++F++ + +  +  L +WI+I ++++RF +A+  Q    G+    S +  
Sbjct: 471 AFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGV 530

Query: 466 FQPWSTWVSLFFCCLIGLIKNYTVFLG----HTFDYKTFISGYIGIPVYAICYVGYKLVH 521
           +      + LF    + LI  + V +        D + F   Y+ +P+    Y GY++  
Sbjct: 531 YGSAYAAIMLF----LALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWK 586

Query: 522 RS-KL-IKPEDVDLYTFKAAID 541
           R  KL I+ +D+DL T +   D
Sbjct: 587 RDWKLFIRAKDIDLDTHRQIFD 608

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  221 bits (562), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 143/501 (28%), Positives = 243/501 (48%), Gaps = 14/501 (2%)

Query: 47  EGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMAC 106
           +G  L K L  RH+                         PAS++I +  V   ++TV+  
Sbjct: 85  DGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVINS 144

Query: 107 LGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSRE 165
           LGE+AA  P+  GF+ Y +R++DP++ F++   YL ++ ++ P +L A ++ ++YW   +
Sbjct: 145 LGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYW--ND 202

Query: 166 KVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHD 225
           K+N   W++IF  +I L+N + V+ FGE EF LS +K                   P   
Sbjct: 203 KINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGG 262

Query: 226 RTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRS 285
             G +YW DPGAF  ++   +GS+ K              Y+G E+  + AAE+ +PR++
Sbjct: 263 YIGGKYWHDPGAFVGHT---AGSQFKGLCSVFVTAAFS--YSGIEMIAVSAAESIDPRKT 317

Query: 286 VPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPV 345
           +P A K T + I   YV  + L+G  V Y+DP L+            P V+AI+N GI  
Sbjct: 318 IPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASS-PLVIAIENGGIKG 376

Query: 346 LPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLF 405
           LP + NA +L+ V S  NS +Y  SR +  +AI    PK   + +  G P  +  V++ F
Sbjct: 377 LPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFF 436

Query: 406 CLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAP 465
            L++++  S   A++F +   +  +  +  W+ I I+++RF +A+  Q        Y + 
Sbjct: 437 GLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQ 496

Query: 466 FQPWSTWVSLFFCCLIGLIKNYTVFL---GHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
              + +W       L+ +   +T          +  TF  GY+ +P+   CYVG+K   +
Sbjct: 497 VGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFK 556

Query: 523 S-KLIKP-EDVDLYTFKAAID 541
           + +L  P  ++DL + K  ID
Sbjct: 557 NWRLFTPYNEIDLDSGKRDID 577

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  220 bits (560), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 148/496 (29%), Positives = 243/496 (48%), Gaps = 18/496 (3%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK+ L++RH+ M                       PA ILI ++  G ++Y ++  +GE+
Sbjct: 76  LKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAMGEL 135

Query: 111 AAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+  G+T+YASR+VD + GFA    Y   + I  P ++ A ++ + YW +  K   
Sbjct: 136 AVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAKYRD 195

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
             ++ +F V+IV IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 196 A-FVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYIGG 254

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           R W +PGAF       +G KG               + G+EL G+ AAE  NPR+S+P A
Sbjct: 255 RLWHNPGAFA------NGFKG----VCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSA 304

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            K   +RI LFY++++L++G+ V Y    LI            PFV++I+NAGI  LP +
Sbjct: 305 AKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAAS--PFVISIQNAGIKGLPSV 362

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L+ V S  N  ++  SR++  LA     PKIF   +  G P   + V+ +F LL+
Sbjct: 363 INVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLS 422

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           ++  S    ++F++ + +  +  L +W  IL+ ++R  +A+ AQ    +  S+TAP   W
Sbjct: 423 FIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVW 482

Query: 470 STWVSLFFCCLIGLIKNYTVF--LGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-KL- 525
            +  SL    LI + + +     +G       F   Y+  P+Y + Y+G+K+  ++ KL 
Sbjct: 483 GSVYSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVFYIGHKIWKKNWKLF 542

Query: 526 IKPEDVDLYTFKAAID 541
           IK  D+D+ + +   D
Sbjct: 543 IKASDIDIDSGRRETD 558

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  221 bits (562), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 147/508 (28%), Positives = 234/508 (46%), Gaps = 19/508 (3%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           D    G +LKK ++ RHV +                       PA ++I Y  +G L+Y 
Sbjct: 108 DEGDTGDKLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYC 167

Query: 103 VMACLGEMAA--FIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQY 160
           ++   GEMA      + GF +Y +  +DP   FA  + Y  ++  V P +L   +M ++Y
Sbjct: 168 IIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLCVCPLELVTASMTIKY 227

Query: 161 WVSREKVNPGVWITIFLVLIVLINTVG-VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXX 219
           W +  KV+P V++ IF V I+ IN +G  R + E EF  +S K                 
Sbjct: 228 WTT--KVDPDVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMMIGFFILGIIIICG 285

Query: 220 XXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEA 279
                   G RYW DPGAF+    A+   KG               +  +E   + A+E 
Sbjct: 286 GAGTDGYIGGRYWHDPGAFRG-ERAVDRFKG----VVATLVTAAFSFGQSEFIAVTASEQ 340

Query: 280 KNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIK 339
            NPRR++P A K  +YR +  Y+ SI+LLG  V YN   L+            P+V+A+ 
Sbjct: 341 SNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNSSQLLGAQSNGIKAS--PYVLAVA 398

Query: 340 NAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSL 399
           N G+ V+PH  NA +++ V S  NS  Y + R L  L+    APKIF+  +  G P   +
Sbjct: 399 NHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTMGI 458

Query: 400 AVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSG 459
            V+ LF ++A+   S    Q+F + + V  +  + +W+SI +++LRF +A+  Q      
Sbjct: 459 IVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSLGE 518

Query: 460 FSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFL----GHTFDYKTFISGYIGIPVYAICYV 515
             + +    + +  S F   LI L+  + V L        D  +F   Y+  P++   Y+
Sbjct: 519 CGFLSQVGIYGSAYSFFVLALI-LVGQFWVALKPVGSKKVDANSFFENYLAAPIWIALYI 577

Query: 516 GYKLVHRS-KL-IKPEDVDLYTFKAAID 541
           GYK   +  +L IK +D+DL   +   D
Sbjct: 578 GYKCYTKDWRLYIKSQDIDLVAHRQIYD 605

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  219 bits (559), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 145/501 (28%), Positives = 237/501 (47%), Gaps = 19/501 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           +LKK ++ RHV M                       PA ++I Y+ +   +Y VM  +GE
Sbjct: 98  KLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAVGE 157

Query: 110 MAA--FIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA      + GF++Y    +DP L FAV + Y  ++F V P +L   +M +QYW +  KV
Sbjct: 158 MAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTT--KV 215

Query: 168 NPGVWITIFLVLIVLINTVG-VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR 226
           N  +++ IF +L++ IN  G  R + E EF+ +  K                    N   
Sbjct: 216 NADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAGNSGF 275

Query: 227 TGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSV 286
            G RYW  PGAF+     I+  KG               + GTE   I A+E  NPR+++
Sbjct: 276 IGARYWHSPGAFRG-DNGINRFKG----IVSTLVTAAFAFGGTEFLAITASEQANPRKAI 330

Query: 287 PRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVL 346
           P A K  +YR ++ YV SI+++G  V YN   L+            P+V+A+ + GI V+
Sbjct: 331 PSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKAS--PYVIAVASHGIRVV 388

Query: 347 PHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC 406
           PH  NA +L+ VFS  +S  Y +SR L  LA    APKIF   +  G P     V  +  
Sbjct: 389 PHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGAIIA 448

Query: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF 466
           ++++   SS  A +FN+ +++  +  + +W  I ++++RF +A+  Q        + +  
Sbjct: 449 IISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFKSQA 508

Query: 467 QPWSTWVSLFFCCLIGLIKNYTVFL----GHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
             W + V  F   ++ LI  + V +      + D  +F   Y+ +PV+ + Y GYK+ +R
Sbjct: 509 GVWGS-VYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYKIWNR 567

Query: 523 S--KLIKPEDVDLYTFKAAID 541
                I+ +++DL   +   D
Sbjct: 568 DWRLFIRAKNIDLIAHRHIYD 588

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  220 bits (560), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 143/499 (28%), Positives = 230/499 (46%), Gaps = 18/499 (3%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LKK ++ RHV M                       PA +LI Y+ +G ++Y ++   GE+
Sbjct: 116 LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEL 175

Query: 111 AAFIP--LDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           A        G+ +Y S  VD   GFAV + Y  ++  V P +L   +M ++YW +   VN
Sbjct: 176 ALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT--SVN 233

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
           P V++ IF VL++ IN  G R + E EF+ +  K                    N    G
Sbjct: 234 PDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIG 293

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
            +YW DPGAF     +I   KG               + G+E   I  AE  NPR+++P 
Sbjct: 294 GKYWHDPGAFNG-KHSIDRFKG----VVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPG 348

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K  +YRI+  ++ +I++LG  V YN   L+            P+V+AI + G+ V+PH
Sbjct: 349 AAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKAS--PYVIAIASHGVRVVPH 406

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
             NA +LL V S  NS  Y ++R    L+    APK F+  +  G P  ++ VS LF ++
Sbjct: 407 FVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVI 466

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           A+   S    Q+F + + +  +  L +W +I  +++RF +A+  Q        + +    
Sbjct: 467 AFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 469 WSTWVSLFFCCLIGLIKNYTVFLG----HTFDYKTFISGYIGIPVYAICYVGYKLVHRS- 523
           W +  +     LI LI  + V +        D + F   Y+ +P+    YVGYK+  +  
Sbjct: 527 WGSMYACIMMLLI-LIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDW 585

Query: 524 KL-IKPEDVDLYTFKAAID 541
           KL I+ + +DL + +   D
Sbjct: 586 KLFIRADKIDLESHRQIFD 604

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  219 bits (559), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 151/561 (26%), Positives = 251/561 (44%), Gaps = 36/561 (6%)

Query: 6   EKKNAGILYSNETLEEDV----------------AFDKLERXXXXXXXXXXXVDGKHEGI 49
           ++ N  +L   +T EE +                +F +++             +   E  
Sbjct: 56  DESNNAVLIQEKTQEETIHNSDGSSRSPFGKFVDSFKRVDEKQTTSDLESGLGEVPGENS 115

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            LK+ ++ RHV +                       P  ++I YS +G  +Y ++   GE
Sbjct: 116 DLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQACGE 175

Query: 110 MA---AFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREK 166
           +A   + +P   F  Y +  VD A GFAV + Y  ++  V P +L   +M ++YW +   
Sbjct: 176 LAVCYSSLP-SNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTT--S 232

Query: 167 VNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR 226
           VNP ++++IF VLI++INT G R + E EF+ +S K                        
Sbjct: 233 VNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGY 292

Query: 227 TGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSV 286
            G +YW  PGAF   +  I   KG               +  +E   + AAE  NPR+++
Sbjct: 293 IGAKYWHSPGAFNG-NRPIDHFKG----VMATFTTAAFAFGASEFISLTAAEQSNPRKAI 347

Query: 287 PRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVL 346
           P+A K+ +YRI+  ++ SI L+G  V YN P L+            P+VVA+ + G+ V+
Sbjct: 348 PKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKAS--PYVVAVASHGVRVV 405

Query: 347 PHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC 406
           PH  NA +LL V S  NS  Y +SR L  LA    APK+F   +  G P  ++  S LF 
Sbjct: 406 PHFINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFM 465

Query: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF 466
            +A+   S    Q+F + + +  +  L +W++I I++LRF +A+  Q        + +  
Sbjct: 466 TIAFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQV 525

Query: 467 QPWSTWVSLFFCCLIGLIKNYTVFL----GHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
             + +  +     ++ LI  + V L    G+  D + F   Y+ +P+  + Y GYK+  R
Sbjct: 526 GIYGSLYAATM-LILALIAQFWVALAPIGGNGLDARNFFQNYLAMPILLVLYFGYKIRKR 584

Query: 523 S-KL-IKPEDVDLYTFKAAID 541
             K  I    +DL + +   D
Sbjct: 585 DWKFWIPAHRIDLVSHRKVFD 605

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  219 bits (557), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 144/493 (29%), Positives = 231/493 (46%), Gaps = 19/493 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           +LKK++++RHV M                       PA+++I Y  V  + Y ++   GE
Sbjct: 90  KLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQAAGE 149

Query: 110 MAAFIPL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA   P     F +Y+S ++  + GFA  + Y F++  V P +L   +M +Q+W   +K+
Sbjct: 150 MAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFW--NDKI 207

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           NP ++I IF V +V I+  GV+ +GE EF  +  K                    N    
Sbjct: 208 NPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYI 267

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G  YW +PGAF     A   S G+              + G EL  +   E  NPR+S P
Sbjct: 268 GATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTP 322

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K ++YRIV+ Y+++++L+G  V YND  L+            P+V+A    G+ ++P
Sbjct: 323 VAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKIVP 380

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           HI NA +L+ V S  NS LY   R +  LA    APK     +  G P  +L V  +F +
Sbjct: 381 HIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGV 440

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           +A++  SS    +F +   +  +  L +W SI++++LRF +A+  Q        Y A   
Sbjct: 441 IAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTG 500

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFL-----GHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            W +   +FF  L+  +  + V L     G   D ++F   Y+  P++   Y GY + +R
Sbjct: 501 IWGSIYGVFFNILV-FVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMVYNR 559

Query: 523 S-KLIKPED-VDL 533
              L+ P D +DL
Sbjct: 560 DFTLLNPLDKIDL 572

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  218 bits (556), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 137/462 (29%), Positives = 231/462 (50%), Gaps = 14/462 (3%)

Query: 86  PASILISYSFVGLLVYTVMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYF 144
           PAS++I ++ V   ++TV+  LGE+AA  P+  GF  Y +R+VDP+  F+V   YL ++ 
Sbjct: 121 PASLVIGWTIVSTALFTVINSLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWL 180

Query: 145 IVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXX 204
           ++ P +L A ++ ++YW   + +N   W+ IF  LI++ N + V+ FGE EF LS VK  
Sbjct: 181 VLLPLELVAASLTIRYW--DDTINSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKIL 238

Query: 205 XXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX 264
                            P     G +YW DPGAF   S   +G++ K             
Sbjct: 239 AIIGFFILGIVLTCGGGPKGGYIGGKYWHDPGAFVGDS---AGTQFKGLCSVFVTAAFS- 294

Query: 265 XYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXX 324
            Y G E+  + AAE++NPR+++P A K T + I   Y+  + L+G  VAYND  L+    
Sbjct: 295 -YAGIEMIAVSAAESQNPRKTIPTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSS 353

Query: 325 XXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPK 384
                   P V+AI+N GI  LP + NA +L+ + S  NS +Y  SR +  +A+    PK
Sbjct: 354 SVDVAAS-PLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPK 412

Query: 385 IFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYL 444
             +  +  G P  ++  ++ F LL+++  S    ++F +   +  +  +  W+ I I ++
Sbjct: 413 GLSVVDKRGRPLRAIFTTLFFGLLSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHI 472

Query: 445 RFHKAVIAQ---FGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFI 501
           RF +A+  Q     +    S T  +  +     LF   +     +     G   D + F 
Sbjct: 473 RFRQAMTVQNRSLDEMPYLSQTGIYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFF 532

Query: 502 SGYIGIPVYAICYVGYKLVHRS-KLIKP-EDVDLYTFKAAID 541
            GY+  P+   CY+G+KL  ++ +++ P E++DL T +  +D
Sbjct: 533 EGYLSFPILIACYIGHKLYFKNWRIMTPLEEIDLLTGRKEVD 574

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  218 bits (556), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 152/513 (29%), Positives = 240/513 (46%), Gaps = 31/513 (6%)

Query: 42  VDGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVY 101
           +DG      LK+ L+ARH+ M                       P +++I +S  G  + 
Sbjct: 76  LDGSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIV 135

Query: 102 TVMACLGEMAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQY 160
             +  LGE+    P+ G F +Y++R++DP++ F +   Y+ ++F V P ++ A AM +QY
Sbjct: 136 GTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQY 195

Query: 161 WVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXX 220
           W   + ++P VW+ IF  +IV IN  G R FGE EF  SS+K                  
Sbjct: 196 W--NQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGG 253

Query: 221 XPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAK 280
            P+HD  G RYW DPG     S    G                    GTE+  + + E  
Sbjct: 254 GPDHDFVGARYWHDPGCL---SHGFPG-------VLSVLVVASYSLGGTEMVCLASGET- 302

Query: 281 NPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKN 340
           NPR  +P AIK T +RI+ F++IS+ L+G  V Y +P L+            PFV+AIK 
Sbjct: 303 NPRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSSVNNS----PFVIAIKL 357

Query: 341 AGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLA 400
             I  LP I NA +L+ + S  NS ++ +SRTL  +A     PK F   +  G P   + 
Sbjct: 358 HHIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGIL 417

Query: 401 VSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGF 460
            + LF LLA++  SS   ++F++ + +  +   + W+SI I+++RF  A+ AQ       
Sbjct: 418 TNSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDEL 477

Query: 461 SYTAPFQPWSTWVSLFFCCLIGLIKNYTVF--LGHTFDY----KTFISGYIGIPVYAICY 514
            + +    W +  S     LI + + Y     +G   D     KTF   Y+   + A  +
Sbjct: 478 EFVSAVGMWGSAYSALINSLILIAQFYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLF 537

Query: 515 VGYKLVHRSK------LIKPEDVDLYTFKAAID 541
           V +K+ +R K      ++  + +DL T +  ID
Sbjct: 538 VCHKVFYRYKTGKWWAIMDLDKIDLETDRKNID 570

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  219 bits (558), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 144/498 (28%), Positives = 232/498 (46%), Gaps = 16/498 (3%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK+ +  RHV M                       PA ++I YS +G ++Y ++   GEM
Sbjct: 130 LKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQATGEM 189

Query: 111 A-AFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           A A+  L  G+  Y S  V+   GFA+ + Y  ++  V P +L   ++ ++YW +   VN
Sbjct: 190 AIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTT--SVN 247

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
             +++ IF  LI++IN  G + + E EF+ +  K                    N    G
Sbjct: 248 SDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGYLG 307

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
             YW  PGAF+  S +I   KG               Y GTE   + AAE  NPR ++P 
Sbjct: 308 GLYWHTPGAFRGDS-SIDHFKG----ICGTLVTAAFAYGGTEFLALTAAEQSNPRAAIPS 362

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K  LYRI+  Y+ISIL++G  V ++   L+            P+V+A    G+ V+PH
Sbjct: 363 AAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSAS--PYVLAASLHGVRVVPH 420

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
             NA +L+ V S  NS  Y +SR L  LA    APK F   +  G P  ++ +S LF ++
Sbjct: 421 FINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFGVI 480

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           A+   S    ++F + + +  +  L +W +I ++++RF  A+  Q        Y A    
Sbjct: 481 AFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQTGV 540

Query: 469 WSTWVSLFFCCLIGLIKNYTVFL---GHTFDYKTFISGYIGIPVYAICYVGYKLVHR--S 523
           W +W +LF   LI + + +             + F   Y+ +P+  + Y+GYK+ ++  +
Sbjct: 541 WGSWYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYKDWT 600

Query: 524 KLIKPEDVDLYTFKAAID 541
            LIK ED+DL + +   D
Sbjct: 601 LLIKAEDIDLQSHRQIFD 618

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  218 bits (555), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 145/501 (28%), Positives = 234/501 (46%), Gaps = 18/501 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           + K+++++RHV M                       PA +LI YS V ++ Y +M   GE
Sbjct: 81  KFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYIMMQAAGE 140

Query: 110 MAAFIPL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA   P     F  Y+S ++  + GFA  + Y  ++  V P +L   ++ ++YW S   +
Sbjct: 141 MAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTIKYWNS--SI 198

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           NP  +I IF  +IV I+  G   +GE EF  S+ K                         
Sbjct: 199 NPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCGGAGTGGYI 258

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G  YWR+PGAF   S       G               Y G EL  +   E  NPR++VP
Sbjct: 259 GGEYWRNPGAFAGGSPI-----GHFKGIAYVLVTAYFSYGGMELFALTVNEQANPRKAVP 313

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K  +YRI++ Y+++++L+G  V YN   L+            P+V+A+ + G+ V+P
Sbjct: 314 SATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHAS-PYVIAVASHGVKVVP 372

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           HI NA +L+ V S  NS +Y A R L  LA    APKIF+  +  G P  +L    +F L
Sbjct: 373 HIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVGCSIFGL 432

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           L+++  S    Q+F +   +  +  L +W +I ++++RF  A+  Q    S   Y +   
Sbjct: 433 LSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELGYKSKTG 492

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFL-----GHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            W +  ++FF  ++  +  + V L     G   D + F   Y+  P++  CYVGYK+  +
Sbjct: 493 YWGSIYAIFFNIIV-FVAQFWVALAPIGNGGKADAEAFFQSYLAFPIWISCYVGYKIYSK 551

Query: 523 S-KLIKP-EDVDLYTFKAAID 541
             KL+ P +++DL + +   D
Sbjct: 552 EWKLLVPLDEIDLNSHRHIFD 572

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  218 bits (554), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 152/500 (30%), Positives = 238/500 (47%), Gaps = 25/500 (5%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK+ L+ RH+ M                       PA+++I++   G +VY+V+  LGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A  +P+ G + SY SR+++P+ GFA+ Y YL    I  P +L A ++ + YW    K   
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKY-A 207

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR-TG 228
             ++ +F ++IV IN  GV+ +GE EF  S +K                   P+ +   G
Sbjct: 208 DAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIG 267

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
            RYW +PG F        G KG               + G+E+  + AAE +NPR+ +PR
Sbjct: 268 ARYWYNPGGFA------HGFKG----FAAIFVTSAFSFAGSEMFALAAAETENPRKDLPR 317

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K   +RI LFYVIS+ L+G  V Y D  L             PFV+AI  AGI  LP 
Sbjct: 318 AAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASAS--PFVIAIARAGIKGLPS 375

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           + N  +L+ V S  N  +Y ASR +  LA     P+ F   +  G P   + +  +F LL
Sbjct: 376 VVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLL 435

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           ++++ SS   ++F++ + +  +     W SI + +LRF +A+  Q       SY A    
Sbjct: 436 SFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQT-- 493

Query: 469 WSTWVSLFFCCLIGLIKNYTVF-----LGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
              W SL+   LI ++  +  +     +G + +   F S Y+ +PV    Y  +KL  RS
Sbjct: 494 -GIWGSLYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTRS 552

Query: 524 K--LIKPEDVDLYTFKAAID 541
              LIK  D+D+ T +  +D
Sbjct: 553 WTFLIKSSDIDIDTGRREMD 572

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  218 bits (554), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 149/497 (29%), Positives = 238/497 (47%), Gaps = 15/497 (3%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK  L+ RH+ M                       PA ILI +   G ++Y ++  +GE+
Sbjct: 81  LKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCMVMAMGEL 140

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           +   P+ G FT+YA+R++D + GFA  + Y+ ++  V P ++ A ++ + YW +  K   
Sbjct: 141 SVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWGTDPKYRD 200

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F V+IV+IN  GV+ +GE EF  S +K                   P     G 
Sbjct: 201 G-FVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIGG 259

Query: 230 RYWRDPGAFKPYSEAISGSKG-KXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
           +Y+ DPGAF      +  + G +              + G+EL GI AAE+  PR+SVP+
Sbjct: 260 KYFHDPGAF------VGDTAGARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPRKSVPK 313

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K   +RI LFY++S+L++G+ V Y D  LI            PFV+AI + GI  LP 
Sbjct: 314 AAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAAS--PFVIAITSHGIRGLPS 371

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           + N  +L+ V S  NS +Y  SRTL  LA     PKIF   +  G P + +A +  F L+
Sbjct: 372 VVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLV 431

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           A++  S    ++F + + +  +  L +W  I   ++RF  A+ AQ        + AP   
Sbjct: 432 AFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELPFKAPAGI 491

Query: 469 WSTWVSLFFCCLIGLIKNYTVFL--GHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-KL 525
           + +   LF   L+ + + Y      G     + F   Y+  PV    Y G+KL  R+ KL
Sbjct: 492 YGSMWGLFMIVLMFMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLAFYFGHKLYARNWKL 551

Query: 526 IKP-EDVDLYTFKAAID 541
           + P   +D+ T +  +D
Sbjct: 552 LIPLSKLDIDTGRREMD 568

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  218 bits (554), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 144/504 (28%), Positives = 238/504 (47%), Gaps = 16/504 (3%)

Query: 45  KHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVM 104
           +    +LK+ +  RHV M                       PA ++I Y+ +G  +Y ++
Sbjct: 84  RQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCII 143

Query: 105 ACLGEMA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
              GE+A ++  L G F +Y S  ++ A GF+V + Y  ++  V P +L   ++ ++YW 
Sbjct: 144 QAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWT 203

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
           +   VNP +++ IF VLI+L+N  G R + E EF+ +  K                    
Sbjct: 204 T--SVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAG 261

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
           N    G RYW +PGAF   ++ I   KG               +  TE   + AAE  NP
Sbjct: 262 NDGYIGGRYWNNPGAFYG-TKPIHHFKG----IISTMVTAAFAFGATEFIALTAAEQANP 316

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           RR++P A K  +YRI+L ++  I+L+G  V +N P L+            P+V+A+ + G
Sbjct: 317 RRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHAS--PYVIAVASHG 374

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
           + V+PH  NA +LL V S  NS  Y +SR L  LA    AP      +  G P  ++ VS
Sbjct: 375 VRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVS 434

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
            +F L++++  S     +F + + +  +  L +WISI ++++RF KA+I Q        Y
Sbjct: 435 CVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGY 494

Query: 463 TAPFQPWSTWVSLFF--CCLIGLIKNYTVFLGHT-FDYKTFISGYIGIPVYAICYVGYKL 519
            +      ++ + F   C LIG        +G    D  +F   Y+ +P++ + Y G+K+
Sbjct: 495 KSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFGFKI 554

Query: 520 VHRS-KLIKP-EDVDLYTFKAAID 541
             R  +L  P E +DL + +   D
Sbjct: 555 WKRDWRLYIPLEQIDLDSHRKTFD 578

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  218 bits (556), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 142/507 (28%), Positives = 233/507 (45%), Gaps = 18/507 (3%)

Query: 44  GKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTV 103
            + +   L+K ++ RHV +                       P  ++I Y+ +G  +Y +
Sbjct: 124 AEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCI 183

Query: 104 MACLGEMA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           +   GEMA A+  L G F +Y S  VD A GF+V + Y  ++  V P +L   +M +QYW
Sbjct: 184 IQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYW 243

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
            +   VN  V++ IF VLI+ IN  G + + E EF+ +S K                   
Sbjct: 244 TT--TVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGA 301

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
            N    G +YW +PGAF+        S  +              +  +E   I A+E  N
Sbjct: 302 GNDGYIGAKYWHNPGAFRG-----DKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSN 356

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PRR++P A K  +YRI+  ++ SI L+G  V YN   L+            P+V+A+ + 
Sbjct: 357 PRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKAS--PYVIAVASH 414

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G+ V+PH  NA +LL V S  NS  Y + R LY L+    AP  F   +  G P  ++ +
Sbjct: 415 GVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIM 474

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           S LF ++A+   SS    +F + + +  +  L +WI+I ++++RF +A+  Q        
Sbjct: 475 SALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIG 534

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLG----HTFDYKTFISGYIGIPVYAICYVGY 517
           + +    W +  +     L  LI  + V +        D + F   Y+ +P+  + Y GY
Sbjct: 535 FKSQVGVWGSSYAAIMMTL-ALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGY 593

Query: 518 KLVHRS-KL-IKPEDVDLYTFKAAIDA 542
           K+  R  KL I+ +D+DL + +   D 
Sbjct: 594 KICKRDWKLFIRAKDIDLVSHRKIYDG 620

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  217 bits (553), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 141/499 (28%), Positives = 233/499 (46%), Gaps = 16/499 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           +LKK +++RHV M                       PA ++I Y+ +G  +Y ++   GE
Sbjct: 95  KLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGE 154

Query: 110 MA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           +A  +  L G F +Y S  +DPALGF+V + Y  ++  V P +L   ++ ++YW +   V
Sbjct: 155 LAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTT--SV 212

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           NP +++ IF V+I+ IN  G R + E EF+ ++ K                    N    
Sbjct: 213 NPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVNCGGAGNDGYI 272

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YW DPG+F    + I   KG               +  TE   + AAE  NPR+S+P
Sbjct: 273 GGKYWNDPGSFSG-DKPIDHFKG----VVSTLVTAAFAFGATEFIALTAAEQANPRKSIP 327

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K  LYRI++ YV SI+L+G  V +N   L+            P+V+AI + G+ V+P
Sbjct: 328 SAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHAS--PYVIAIASHGVKVVP 385

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           H+ NA +LL V S  NS  Y +SR L  LA    AP      +  G P  ++ +S +F L
Sbjct: 386 HLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSVFGL 445

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           ++++  S     +F + + +  +  L +W +I ++++RF +A+  Q        + +   
Sbjct: 446 ISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVG 505

Query: 468 PWSTW--VSLFFCCLIGLIKNYTVFLGH-TFDYKTFISGYIGIPVYAICYVGYKLVHR-- 522
            W ++    +    LIG        +G    D + F   Y+ +P+    Y GYK+  R  
Sbjct: 506 VWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDW 565

Query: 523 SKLIKPEDVDLYTFKAAID 541
           +  I    +DL + +   D
Sbjct: 566 TLYIPASKIDLISNRRIFD 584

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  217 bits (552), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 155/536 (28%), Positives = 249/536 (46%), Gaps = 19/536 (3%)

Query: 14  YSNETLEEDVAFDK--LERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSMXXXXXXXXX 71
           YSN +       D   L R           VDG  +   + K L+ RH+           
Sbjct: 60  YSNSSTGAGGKGDSHSLTRDEAGSGVMKEDVDGHPQ---MNKDLDVRHLLTLAVGGAIGT 116

Query: 72  XXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPL-DGFTSYASRYVDPA 130
                         PAS++I +  +   ++TV+  LGE+AA  P+  GF  Y +R++DP+
Sbjct: 117 GLFVNSGAALSSGGPASLVIDWVIISTCLFTVVNSLGELAAAFPVVGGFNVYITRFIDPS 176

Query: 131 LGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRF 190
            GFAV   YL ++ ++ P +L A ++ ++YW   +K+N   W+ IF   I   N + V+ 
Sbjct: 177 FGFAVNINYLAQWLVLLPLELVAASITIRYW--NDKINSDAWVAIFYAAIAFANMLDVKS 234

Query: 191 FGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKG 250
           FGE EF LS +K                   P     G +YW DPGAF   +   SG+K 
Sbjct: 235 FGETEFILSMIKILAIVGFTILGIVLSCGGGPKGGYIGGKYWHDPGAFVGET---SGTKF 291

Query: 251 KXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGM 310
           K              Y+G EL  + AAE+ NPR ++P+A K T + I L YV  + L+G 
Sbjct: 292 KGLCSVFVTAAFS--YSGMELTAVSAAESLNPRETIPKAAKRTFWLITLSYVTILTLIGC 349

Query: 311 TVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVAS 370
            V YN+P L+            P V+AI+N GI  LP + NA +L+ + S  NS +Y  S
Sbjct: 350 LVPYNNPKLLNGSSSVDAASS-PLVIAIENGGIRGLPSLMNAIILIAIVSVANSAVYACS 408

Query: 371 RTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSI 430
           R +  +A  R  P+   + +  G P  +  +++ F LL+++  S    ++F +   +  +
Sbjct: 409 RCMVSMARIRNLPRFLGRVDRKGRPLNATLLTLFFGLLSFIAASDKQEEVFTWLSALSGL 468

Query: 431 FGLLSWISILITYLRFHKAVIAQ---FGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNY 487
             + +W++I ++++RF +A+  Q     +    S T     W   + LF   +     + 
Sbjct: 469 STIFAWMAINLSHIRFRQAMAHQGISLDELPYISMTGVSGSWYGVIVLFLVLVASFWTSL 528

Query: 488 TVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSK--LIKPEDVDLYTFKAAID 541
               G   D  +F  GY+  P+  +CYVG+KL  R K  LI   D+DL + +  +D
Sbjct: 529 FPLGGKGADATSFFEGYLSFPILIVCYVGHKLYIRKKRLLIDVADMDLVSDRKVVD 584

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  216 bits (551), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 145/506 (28%), Positives = 237/506 (46%), Gaps = 16/506 (3%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           D      +L K L  RH+                         P SILI+++ +   ++T
Sbjct: 101 DAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFT 160

Query: 103 VMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
           ++  LGE+A+  P+  GF  Y +R+V+P+ GFAV   YL ++ ++ P +L A ++ ++YW
Sbjct: 161 IVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYW 220

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
               K+N   W+ IF V I L N + V+ FGE EF LS VK                   
Sbjct: 221 --NNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGG 278

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKG-KXXXXXXXXXXXXXXYTGTELCGIVAAEAK 280
           P     G +YW DPGAF      +  + G +              Y+GTEL G+ AAE+ 
Sbjct: 279 PVGGFIGAKYWHDPGAF------VGDTPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESI 332

Query: 281 NPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKN 340
           NPR ++PRA K + + I   Y++ + + G  V  NDP L+            P V+AI+N
Sbjct: 333 NPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAAS-PLVIAIEN 391

Query: 341 AGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLA 400
            GI  +P + NA +L+ + S  NS +Y  SR +  +A     PK+F   +  G P  ++ 
Sbjct: 392 GGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAIL 451

Query: 401 VSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQ---FGDK 457
            +++F LL+++  S     IF +   +  +  L  W +I I+++RF +A+ AQ     + 
Sbjct: 452 ATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDEL 511

Query: 458 SGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGY 517
              S T     W     L F  ++    +           ++F  GY+  P++ ICY+ +
Sbjct: 512 PYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYLSFPIFLICYISH 571

Query: 518 KLVHRS-KLIKPE-DVDLYTFKAAID 541
           KL  R  +L  P   +D+ + + A+D
Sbjct: 572 KLYKRDWRLFIPAGQIDVDSGRRALD 597

>AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR132C (AGP2)
          Length = 566

 Score =  215 bits (547), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 140/491 (28%), Positives = 244/491 (49%), Gaps = 11/491 (2%)

Query: 53  KALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAA 112
           + LE RHV +                         S+L+ ++   + +  +     EM  
Sbjct: 55  RKLENRHVQLIGISGVIGTALFVSIGKALYRGGSVSLLLGFALWCVPILCITVSTAEMVC 114

Query: 113 FIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGV 171
           ++PL+  F   ASR V+ +L    G+ + F   +  P ++ A   ++ YW  R+  +  +
Sbjct: 115 YLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQIPFEIVAVNSIIHYW--RDDYSAAI 172

Query: 172 WITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRY 231
            + + ++L +LI+   VR++GE EFWL+S K                   P  DR GFRY
Sbjct: 173 TLVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVGLFCFTFVTMVGGNPKRDRYGFRY 232

Query: 232 WRDPGAFKPYS---EAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
             +   FK YS   E IS S G                 G +   ++A E K PR+ +P 
Sbjct: 233 IGE-APFKQYSPTMEPISSSAGYFQGFLACLIQASFTIAGPDYVSMIAGETKLPRKVLPV 291

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDP-LLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
           A K    R+ + ++   L +G+  + NDP L              P+V+A+ + GI +LP
Sbjct: 292 AFKQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAINASRPGAGSSPYVIAMNHLGIKILP 351

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
            I NA ++   FSA N+  Y +SR+LYGLA+D  AP IF + N +GVP Y+++VSV++ +
Sbjct: 352 DIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAIFKRCNRFGVPIYAVSVSVMWSV 411

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           L+ + ++S SA + N+ +++++   L+++  + + YL F +A +AQ  +    S+ + +Q
Sbjct: 412 LSLLQLNSNSAVVLNWLISLITASQLINFGVLCVVYLYFRRAYLAQQDNLPELSFKSWWQ 471

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR---SK 524
           P++ +V L    LI +++ YTVF    ++ K F+  Y+ + +    Y+GY+ + R     
Sbjct: 472 PYTAYVGLTCVLLIVVVQGYTVFYSALWNVKDFLFCYLMVFIDIAIYLGYRYIWRRGKDA 531

Query: 525 LIKPEDVDLYT 535
           +I P +VDL T
Sbjct: 532 VIPPTEVDLTT 542

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  214 bits (546), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 151/505 (29%), Positives = 231/505 (45%), Gaps = 34/505 (6%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           ++KK +++RH+ M                       P  ++I Y     ++Y ++   GE
Sbjct: 63  KMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLYCIIQAAGE 122

Query: 110 MA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           +   +  + G +T+Y+S  VDPALGF+V + Y  ++  V P QL   A+ ++YW      
Sbjct: 123 LGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIKYWTD---T 179

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           NP +++ I   LIV IN  G + + E EF  ++ K                    N    
Sbjct: 180 NPDIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAGNDGYI 239

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G RYW  PGAF       +G KG               Y G E+  + A+E +NPR+S+P
Sbjct: 240 GARYWHTPGAFS------TGFKG----VCYVFCYAAFAYGGIEVMVLTASEQENPRKSIP 289

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K  +YRI+L Y+++ L++   V Y+ P L             PFV+AI + GI V+P
Sbjct: 290 SACKKVIYRILLIYMLTTLIVCFLVPYDAPEL---TSTGSASRASPFVIAIASHGISVVP 346

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           HI NA +L+ V S  NS LY A R L  L+    APK+F   +  G P     V++   L
Sbjct: 347 HIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGL 406

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           LA++  S     +F++ + +  +  L  WISI ++++RF  A+ AQ        Y +   
Sbjct: 407 LAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKSQTG 466

Query: 468 PWSTW----VSLF-----FCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYK 518
            W +W    VSLF     F   I  I N     G     K F   Y+  PV    Y GYK
Sbjct: 467 YWGSWFAIIVSLFVLVAQFWVAIAPIGN-----GGKLSAKDFFQSYLAAPVLIFIYFGYK 521

Query: 519 LVHRS-KLIKP-EDVDLYTFKAAID 541
           + ++  +L  P  +VDL + +   D
Sbjct: 522 IYYKDWRLCIPATEVDLNSHRKIFD 546

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  215 bits (547), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 138/504 (27%), Positives = 232/504 (46%), Gaps = 17/504 (3%)

Query: 47  EGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMAC 106
           +   L+K++  RHV M                       P +++I Y  +G  +Y ++  
Sbjct: 115 DDAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQA 174

Query: 107 LGEMA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSR 164
            GEMA  +  L G F +Y S  VD  + F V + Y  ++  V P +L   +M + YW + 
Sbjct: 175 CGEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTT- 233

Query: 165 EKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNH 224
            KVN  V++ IF VLI LINT G + + E EF+ +S K                    N 
Sbjct: 234 -KVNSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGND 292

Query: 225 DRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRR 284
              G +YW +PGAF+        S  +              +  +E   I A+E  NPRR
Sbjct: 293 GYIGAKYWHNPGAFRG-----DKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRR 347

Query: 285 SVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIP 344
           ++P A K  +YRI+  ++ SI L+G  V Y+   L+            P+V+A+ + G+ 
Sbjct: 348 AIPSAAKTMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQAS-PYVIAVASHGVR 406

Query: 345 VLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVL 404
           V+PH  NA +LL V S  NS  Y + R LY LA    APK F   +  G P  ++ V+ +
Sbjct: 407 VVPHFINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTI 466

Query: 405 FCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTA 464
           F ++A+ + S     +F + +++  +  L +W +I ++++RF +A+  Q        + +
Sbjct: 467 FGVIAFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKS 526

Query: 465 PFQPWSTWVSLFFCCLIGLIKNYTVFLG----HTFDYKTFISGYIGIPVYAICYVGYKLV 520
               W +  +     ++ LI  + V +        D + F   Y+ +P+  + Y GYK+ 
Sbjct: 527 QVGVWGSGYAAIM-MILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIY 585

Query: 521 HRS-KL-IKPEDVDLYTFKAAIDA 542
            +  KL I+ +D+DL + +   D 
Sbjct: 586 KKDWKLFIRAKDIDLISHRTIFDG 609

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  214 bits (544), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 134/503 (26%), Positives = 242/503 (48%), Gaps = 14/503 (2%)

Query: 45  KHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVM 104
           + +  R  K L  RH+                         P S++I +  +   ++T++
Sbjct: 66  EDQDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIV 125

Query: 105 ACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVS 163
             LGE+++  P+  GF  Y SR+V+P+ GFAV   YL ++ ++ P +L A ++ ++YW  
Sbjct: 126 NALGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYW-- 183

Query: 164 REKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPN 223
              +N   W+ IF  +I+L N + V+ FGE EF LS VK                   P 
Sbjct: 184 NHTINSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPK 243

Query: 224 HDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPR 283
               G +YW +PGAF  ++     +  +              Y+GTEL  + AAE+ NPR
Sbjct: 244 GGYIGGKYWSNPGAFVGHT-----AGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPR 298

Query: 284 RSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGI 343
            ++P+A K T + I + Y++ + L+G  V+ +DP L+            P V+AI+N GI
Sbjct: 299 ITLPKACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAAS-PLVIAIENGGI 357

Query: 344 PVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSV 403
             LP + NA +L+ V S  NS +Y  SR +  +A     PK+F   +  G P Y++  ++
Sbjct: 358 KGLPSLMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATL 417

Query: 404 LFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYT 463
           +F LL+++  S    ++F +   +  +  L  W +I ++++RF + +  +        + 
Sbjct: 418 IFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFV 477

Query: 464 APFQPWSTWVSLFFCCLIGLIKNYTVFL---GHTFDYKTFISGYIGIPVYAICYVGYKLV 520
           +    W ++       ++ ++  +T      G   + ++F   Y+  P+   CY G+KL 
Sbjct: 478 SMTGVWGSYYGCIVIFIVLVVCFWTSLFPGGGEGANAESFFETYLSFPILLACYFGHKLY 537

Query: 521 HRS-KLIKP-EDVDLYTFKAAID 541
            RS +L+ P +++DL + + A+D
Sbjct: 538 TRSWRLLTPTKEIDLDSGRRAVD 560

>Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}
           complement(18362..20104) [1743 nt, 581 aa]
          Length = 580

 Score =  213 bits (543), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 140/501 (27%), Positives = 239/501 (47%), Gaps = 10/501 (1%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           +  + L  RHV +                       PA +LI+++   + +  +     E
Sbjct: 66  KTHRKLLNRHVQLIAISGVIGTALFVAIGKALYHGGPAFLLIAFALWCIPILCITVSTAE 125

Query: 110 MAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           M +F+P+   F   AS+  D +L     + + F   +  P ++ +   ++ YW  R+  N
Sbjct: 126 MVSFLPVASPFLRLASKCADESLAVTASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYN 183

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
             + + + +VL + I+   V+++GE EFWL+S K                   P HDR G
Sbjct: 184 AAIPLVVQVVLYLFISIATVKYYGEMEFWLASFKIILAIGLFFFTLVTMLGGNPKHDRYG 243

Query: 229 FRYWRDPGAFKPYSEAISG---SKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRS 285
           FRYW +    K Y +  +    S G                 G E   ++A E K PR+ 
Sbjct: 244 FRYWGEEPFKKYYPDNNTNGTDSLGYFQGFLTCLIQAAFTIAGGEYISMLAGEIKLPRKV 303

Query: 286 VPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXX-XXXXXPFVVAIKNAGIP 344
           +P+A K   +R+ + ++ + L LG+  + NDP L              PFV+A+ N  I 
Sbjct: 304 LPKAFKQVFWRLTIIFLGTCLCLGIVCSPNDPSLTAAINEARPGAGSSPFVIAMNNLRIR 363

Query: 345 VLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVL 404
           VLP I NA ++   FSA N+  Y +SRTLYG+A+D  APKIF + N +GVP Y++ VS+L
Sbjct: 364 VLPDIVNAALITSAFSAGNAYTYCSSRTLYGMALDGYAPKIFTRCNKYGVPIYAVGVSLL 423

Query: 405 FCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTA 464
           + L++ + ++S SA + N+ VN+++   L++++ + + YL F +A  AQ        + +
Sbjct: 424 WALISLLQLNSNSAIVLNWLVNLITASQLINFVFLCVIYLFFRRAYNAQKDKLPPLPFRS 483

Query: 465 PFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLV---H 521
             QP++    L     +  I+ YTVF+   ++ + F+  Y+ + +    Y+GYK +    
Sbjct: 484 WGQPYTAIFGLVCAFSMIFIQGYTVFIHSLWNTRDFLFCYLMVFINVAIYLGYKFIWKRG 543

Query: 522 RSKLIKPEDVDLYTFKAAIDA 542
           + K I P  VD  T    I+A
Sbjct: 544 KDKFIDPHKVDFITDLKEIEA 564

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  214 bits (546), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 151/548 (27%), Positives = 248/548 (45%), Gaps = 32/548 (5%)

Query: 13  LYSNETLEEDVAFDKLERXXXXXXXXXXXVD--------GKHEGIRLKKALEARHVSMXX 64
           L  ++ +  D+  D LE             D         +     L++ ++ RHV M  
Sbjct: 113 LEDDQKVGPDIYIDDLENKQQVELIGTTIQDEELLPGQKKEDSNAELRQTIKPRHVIMMS 172

Query: 65  XXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMA-AFIPLDG-FTSY 122
                                PA ++I Y  +G  +Y ++   GEMA A+  L G F ++
Sbjct: 173 LGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCIIQACGEMAVAYGNLTGSFNTF 232

Query: 123 ASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVL 182
            S  VDP   FAV + Y  ++  V P +L   +M +QYW +  KV+P V++ IF VLI+L
Sbjct: 233 PSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYWTT--KVDPDVFVVIFYVLILL 290

Query: 183 INTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYS 242
           IN  G + + E EF  ++ K                         G +YW DPGAF+  +
Sbjct: 291 INFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAGTDGYIGAKYWNDPGAFRGQT 350

Query: 243 EAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYV 302
           + I   KG               +  TE   + AAE  NPR+++P A K  +YR+++ ++
Sbjct: 351 K-IERFKG----VMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKIIYRVLVIFL 405

Query: 303 ISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSAC 362
            +I+L+G  V Y+   L+            P+V+AI   G+ V  H  NA +L+ V S  
Sbjct: 406 NTIILIGFLVPYDSDQLLGSGGSATKAS--PYVLAISLHGVRVAQHFVNAVILISVISVG 463

Query: 363 NSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFN 422
           NS  Y +SR L  LA    APKIF   +  G P  ++  S +  ++A+   S    ++F 
Sbjct: 464 NSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVIAFCATSPKETEVFT 523

Query: 423 YFVNVVSIFGLLSWISILITYLRFHKAVIAQ---FGDKSGFSYTAPFQPWSTWVSLFFCC 479
           + + +  +  L +W +I +++LRF +A+  Q    G+    S T      S + ++    
Sbjct: 524 WLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGYLSQTGILG--SLYAAIMM-- 579

Query: 480 LIGLIKNYTVFL----GHTFDYKTFISGYIGIPVYAICYVGYKLVHRS--KLIKPEDVDL 533
           ++ LI  + V L     HT D  +F S Y+ +P+  + Y GYK+  R     I+ +D+DL
Sbjct: 580 ILALIAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKIWKRDWRLFIRAKDIDL 639

Query: 534 YTFKAAID 541
            + +   D
Sbjct: 640 ISHRTIYD 647

>Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON}
           YBR132C (REAL)
          Length = 598

 Score =  213 bits (541), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 133/488 (27%), Positives = 233/488 (47%), Gaps = 9/488 (1%)

Query: 52  KKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMA 111
           ++ LE RHV +                       PAS+L++++   + +  +     EM 
Sbjct: 87  RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMV 146

Query: 112 AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPG 170
            F P+   F   A++ VD +      + + F   +  P ++ +   ++ YW  R+  + G
Sbjct: 147 CFFPVSSPFLRLATKCVDDSFAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAG 204

Query: 171 VWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFR 230
           + + + +VL +LI+   V+++GE EFWL+S K                   P HDR GFR
Sbjct: 205 IPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFITMLGGNPKHDRYGFR 264

Query: 231 -YWRDP-GAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
            Y   P   + P  + +  S G                 G E   ++A E K PR+ +P+
Sbjct: 265 NYGESPFKKYFPDGKDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPK 324

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDP-LLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
           A K    R+   ++ S L +G+  + NDP L              P+V+A+ N  I +LP
Sbjct: 325 AFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILP 384

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
            I N  ++   FSA N+  Y +SRT YG+A+D  APK+F + N  GVP YS+A+S+++ L
Sbjct: 385 DIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVAISLVWAL 444

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           ++ + ++S SA + N+ +N+++   L++++ + ITYL F +A   Q        + +  Q
Sbjct: 445 VSLLQLNSNSAVVLNWLINLITASQLINFVVLCITYLFFRRAYHVQQDSLPKLPFRSWGQ 504

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLV---HRSK 524
           P++  + L  C  + LI+ YTVF    +  + F+  Y+ + +    YVGYK +    + K
Sbjct: 505 PYTAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIWKRGKDK 564

Query: 525 LIKPEDVD 532
              P ++D
Sbjct: 565 FKNPHEID 572

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  213 bits (542), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 142/504 (28%), Positives = 233/504 (46%), Gaps = 23/504 (4%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           +L K ++ RH+ M                       PA ++I Y    +++Y V+   GE
Sbjct: 105 QLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMIYCVVQAAGE 164

Query: 110 MA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           +   +  L G +T+Y +  +DPA+GFAV   Y  ++  V P QL   AM ++YW +   V
Sbjct: 165 LGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTIRYWTT--NV 222

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           NP +++   LVL++ IN  G + + E EF+ +  K                    + +  
Sbjct: 223 NPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINCGGAGDKEYI 282

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YW+ PGAF       +G KG               Y G E+  + A E  NPR+++P
Sbjct: 283 GVKYWQTPGAFA------NGFKG----VAAVFCYAAFSYGGIEVLVLTANEQANPRKAIP 332

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A +  +YR++  Y+++ +++   V YN P L+            PFV+A+ + G+ V+P
Sbjct: 333 DACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDASPFVIAVASHGVQVVP 392

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           HI NA +L+ V S  NS LY   R L  L+    APK F   +  G P   + VSV   L
Sbjct: 393 HIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIICVLVSVAMGL 452

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGD---KSGFSYTA 464
           +A++       ++F + + V  +  +  W+SI I++LRF  A+ +Q G    +    YTA
Sbjct: 453 IAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRSQLGGLRARDVVEYTA 512

Query: 465 PFQPWSTWVSLFFCCLIGLIKNYTVF--LGHT--FDYKTFISGYIGIPVYAICYVGYKLV 520
                 + V+L     I + + +     LGH    D + F   Y+  PV    Y+ YK+ 
Sbjct: 513 QTGYVGSLVALAISIFILVCQFWVAIAPLGHNGQLDVQIFFENYLAAPVLLGGYLAYKIW 572

Query: 521 HRS-KLIKP-EDVDLYTFKAAIDA 542
           HR  +L  P  ++DL     A ++
Sbjct: 573 HRDWRLCIPANEIDLSVLPLARES 596

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  213 bits (543), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 154/561 (27%), Positives = 252/561 (44%), Gaps = 37/561 (6%)

Query: 2   SESLEKKNAGILYSNETLEEDVAFDKL-------ERXXXXXXXXXXXVDGKHEGIRLKKA 54
           S S   +NA   YS +  + D+   K        E            V+ + E  +LK+ 
Sbjct: 94  SSSTADENAVENYSMQEFDNDLENKKSNLHIRDDELDYATVNVDSQPVEQQDENAQLKQT 153

Query: 55  LEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMA-AF 113
           ++ RHV M                       PA ++I Y  +G  +Y ++   GE+A A+
Sbjct: 154 IKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQACGELAVAY 213

Query: 114 IPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVW 172
             ++G F ++ S  VDP   FAV + Y  ++  V P +L   +M ++YW +  KV+P V+
Sbjct: 214 SKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTT--KVDPDVF 271

Query: 173 ITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYW 232
           + IF VLI+LIN  G + + E EF+ +  K                         G +YW
Sbjct: 272 VVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGYIGAKYW 331

Query: 233 RDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKL 292
            DPGAF+  ++ I   KG               +  TE   + AAE  NPR+++P A K 
Sbjct: 332 NDPGAFRGQTK-IERFKG----VMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKK 386

Query: 293 TLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNA 352
             YRI+L ++ SI+L+G  V YN   L+            P+V+A    G+ V+ H  NA
Sbjct: 387 VAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSAS--PYVLAASLHGVHVVQHFINA 444

Query: 353 CVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMN 412
            +LL V S  NS  Y +SR L GLA    APK F   +  G P  S+  + +  ++A+  
Sbjct: 445 VILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAVIAFCA 504

Query: 413 VSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQ--------FGDKSGF--SY 462
            S     +F + + +  +  + +W +I ++++RF + +  Q        F  ++G   SY
Sbjct: 505 TSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFRAQTGVLGSY 564

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            A    +   V+ F+  L+ +         HT D + F   Y+ +P+    YVG+KL  R
Sbjct: 565 YAAIMLFLALVAQFWVALVPMNT-------HTLDAENFFQNYLAMPILLALYVGFKLWRR 617

Query: 523 S--KLIKPEDVDLYTFKAAID 541
                I+ +++DL + +   D
Sbjct: 618 DFRLFIRAKNIDLISHRIIFD 638

>YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}
           AGP2High affinity polyamine permease, preferentially
           uses spermidine over putrescine; expression is
           down-regulated by osmotic stress; plasma membrane
           carnitine transporter, also functions as a low-affinity
           amino acid permease
          Length = 596

 Score =  212 bits (539), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 133/488 (27%), Positives = 232/488 (47%), Gaps = 9/488 (1%)

Query: 52  KKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMA 111
           ++ LE RHV +                       PAS+L++++   + +  +     EM 
Sbjct: 85  RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMV 144

Query: 112 AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPG 170
            F P+   F   A++ VD +L     + + F   +  P ++ +   ++ YW  R+  + G
Sbjct: 145 CFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAG 202

Query: 171 VWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFR 230
           + + + +VL +LI+   V+++GE EFWL+S K                   P HDR GFR
Sbjct: 203 IPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFTFTFITMLGGNPEHDRYGFR 262

Query: 231 -YWRDP-GAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
            Y   P   + P    +  S G                 G E   ++A E K PR+ +P+
Sbjct: 263 NYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPK 322

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDP-LLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
           A K    R+   ++ S L +G+  + NDP L              P+V+A+ N  I +LP
Sbjct: 323 AFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILP 382

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
            I N  ++   FSA N+  Y +SRT YG+A+D  APKIF + N  GVP YS+A+S+++ L
Sbjct: 383 DIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTRCNRHGVPIYSVAISLVWAL 442

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           ++ + ++S SA + N+ +N+++   L++++ + I YL F +A   Q        + +  Q
Sbjct: 443 VSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLFFRRAYHVQQDSLPKLPFRSWGQ 502

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLV---HRSK 524
           P++  + L  C  + LI+ YTVF    ++ + F+  Y+ + +    YVGYK +    +  
Sbjct: 503 PYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFSYLMVFINIGIYVGYKFIWKRGKDH 562

Query: 525 LIKPEDVD 532
              P ++D
Sbjct: 563 FKNPHEID 570

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  212 bits (540), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 142/507 (28%), Positives = 241/507 (47%), Gaps = 16/507 (3%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           + KHE   LK+ +++RH+ M                       PA   I +  +GL VY 
Sbjct: 84  NAKHE--NLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYC 141

Query: 103 VMACLGEMA-AFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQY 160
           V+   GE+A  +  L  GF +Y S  +DPALGFA  + Y  ++  V P +L   ++ +++
Sbjct: 142 VIQAAGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKF 201

Query: 161 WVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXX 220
           W     VNP +++ IF VLI++IN  G R + E EF+ +S K                  
Sbjct: 202 WPGSRSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGA 261

Query: 221 XPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAK 280
                  G +YWRDPG+    +      KG                  +E   + AAE  
Sbjct: 262 VGTSGYIGGKYWRDPGSLGGRTH-FDHFKG----IVATLVNAAFSLGCSEFVALTAAEQA 316

Query: 281 NPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKN 340
           NPR+S+P A K  +Y+I + ++ S++L+G  V  +   L+            P+V+A++ 
Sbjct: 317 NPRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVS--PYVIAVRM 374

Query: 341 AGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLA 400
            G+ V+P   NA +LL V S  NS  Y +SR L+ LA    APKIF   +  G P  ++ 
Sbjct: 375 HGVNVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMI 434

Query: 401 VSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGF 460
           +S+LF  + ++  S    ++F + + +  +  L +W +I ++++RF +A+  Q       
Sbjct: 435 ISILFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDEL 494

Query: 461 SYTAPFQPWSTWVS--LFFCCLIGLIKNYTVFLGHTF-DYKTFISGYIGIPVYAICYVGY 517
            + A      ++VS  +    LIG      V +G T  D ++F +GY+ +P++ + Y GY
Sbjct: 495 GFKAQTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGY 554

Query: 518 KLVHRS--KLIKPEDVDLYTFKAAIDA 542
           K+ ++     I+ + +DL + +   DA
Sbjct: 555 KIWNKDWRLFIRADQIDLVSHRRIFDA 581

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  211 bits (536), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 147/467 (31%), Positives = 221/467 (47%), Gaps = 19/467 (4%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           +K+AL+ RH+S+                       P ++L+ +S +G++ ++VM  +GEM
Sbjct: 49  VKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESIGEM 108

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
               P  G FT+ A R+   AL    GY Y+  +F V  N+    + ++Q+W    +V  
Sbjct: 109 ITLYPSGGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANEYNTLSSILQFW--GPQVPL 166

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
             +I IF     +   VGV  FGE E+WL+ +K                    N    GF
Sbjct: 167 YGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRPAFGF 226

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
            YW  PGA         G KG               Y+GTE   + A E+KNP ++VP A
Sbjct: 227 HYWNSPGALS------HGFKG----IAIVFVFCSTFYSGTESVALAATESKNPGKAVPLA 276

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
           ++ TL+RI++ Y+   +  G TV ++DP L             P  +AI  AG     H+
Sbjct: 277 VRQTLWRILVVYIGIAVFYGATVPFDDPNL----SASTKVLKSPIAIAISRAGWAGGAHL 332

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            NA +L+   SA N  LY+ SRTL  LA +  APKI A T+  GVP  ++ V     L++
Sbjct: 333 VNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFNALGLIS 392

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
            MNVS G+A  ++Y VN+  +   + W  I  T+LR  KA +AQ        Y A F PW
Sbjct: 393 LMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEELPYEALFYPW 452

Query: 470 STWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVG 516
           +  +SL     + LI+ ++ F+   FD   F+  YI +PV  + Y+G
Sbjct: 453 TPVLSLAANIFLALIQGWSYFV--PFDAGNFVDAYILLPVGILLYIG 497

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  212 bits (539), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 147/496 (29%), Positives = 243/496 (48%), Gaps = 13/496 (2%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           L+  L++RH+ M                       PA ILI +   G +++T++  LGE+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVMALGEL 147

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+ G F +YA+R++D + GFA  + Y+F++ +  P ++ A ++ + YW +  +   
Sbjct: 148 AVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWETPVRYTD 207

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
           G ++ +F +++V+IN  GVR +GE EF  S +K                   P     G 
Sbjct: 208 G-FVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVGGYVGG 266

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           RYW DPGAF  +S        +              + G+EL GI +AE+KNPR+SVP+A
Sbjct: 267 RYWHDPGAFAGHSPG-----RRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRKSVPQA 321

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            K   +RI+LFY++ +LL+G+ V Y DP L+            PFV+AI   GI  LP +
Sbjct: 322 AKQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASAS--PFVIAIVTHGISGLPSV 379

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L+ V S  NS +Y  SRTL  L+     PK  A  +  G P   +A+   F L+A
Sbjct: 380 VNVVILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFGLIA 439

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           ++  S+   Q+FN+ + +  I   L+W SI   ++RF  A+           + +P    
Sbjct: 440 FVAASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPVGII 499

Query: 470 STWVSLFFCCLIGLIKNYTVF--LGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-KLI 526
            ++  +    L+ + + Y     +G + +   F S Y+  P+    Y+ +KL  R+ KL+
Sbjct: 500 GSYWGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAHKLWKRNWKLL 559

Query: 527 KP-EDVDLYTFKAAID 541
            P +D+D+ T +   D
Sbjct: 560 IPLKDIDIDTGRRETD 575

>Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON}
           YBR132C (REAL)
          Length = 597

 Score =  211 bits (537), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 133/488 (27%), Positives = 231/488 (47%), Gaps = 9/488 (1%)

Query: 52  KKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMA 111
           ++ LE RHV +                       PAS+L++++   + +  +     EM 
Sbjct: 86  RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMV 145

Query: 112 AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPG 170
            F P+   F   A++ VD +L     + + F   +  P ++ +   ++ YW  R+  + G
Sbjct: 146 CFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAG 203

Query: 171 VWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFR 230
           + + + +VL +LI+   V+++GE EFWL+S K                   P HDR GFR
Sbjct: 204 IPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFITMLGGNPRHDRYGFR 263

Query: 231 -YWRDP-GAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
            Y   P   + P    +  S G                 G E   ++A E K PR+ +P+
Sbjct: 264 NYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPK 323

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDP-LLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
           A K    R+   ++ S L +G+  + NDP L              P+V+A+ N  I +LP
Sbjct: 324 AFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILP 383

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
            I N  ++   FSA N+  Y +SRT YG+A+D  APK+F + N  GVP YS+ +S+++ L
Sbjct: 384 DIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVGISLIWAL 443

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           ++ + ++S SA + N+ +N+++   L++++ + I YL F +A   Q        + +  Q
Sbjct: 444 VSLLQLNSNSAVVLNWLINLITASQLINFVVLCIIYLFFRRAYRVQQDSLPRLPFRSWGQ 503

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLV---HRSK 524
           P++  + L  C  + LI+ YTVF    +  + F+  Y+ + +    YVGYK +    +  
Sbjct: 504 PYTAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIWKRGKDS 563

Query: 525 LIKPEDVD 532
           L  P D+D
Sbjct: 564 LKNPHDID 571

>TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.342
           YDR160W
          Length = 840

 Score =  215 bits (548), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 140/554 (25%), Positives = 247/554 (44%), Gaps = 58/554 (10%)

Query: 46  HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMA 105
           H    +++ L  RH+ M                       P   L+ ++  G +V+  + 
Sbjct: 261 HAKYHVQRKLRVRHIQMIGIGACISVGICLTSGKAFSIAGPFGTLLGFAISGSVVFASLL 320

Query: 106 CLGEMAAFIPLD-GFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVS- 163
              E+A+ IP+  GF+  ASR+V+ A GFA+G+ Y F   I  P Q+ A    + Y+ S 
Sbjct: 321 SFTELASLIPVSSGFSGLASRFVEDAFGFALGWTYWFSSMIALPAQVVASTFFLSYYSSM 380

Query: 164 -REKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLS-SVKXXXXXXXXXXXXXXXXXXX 221
            R + +   ++T+FL+  + IN + VR  GE  +                          
Sbjct: 381 KRSRGSTAGFVTLFLLYPIFINLLDVRIMGEVVYVTGLIKIIISVVVIISMLIFNAGHGG 440

Query: 222 PNHDRTGFRYWRDP--------GAFKPY----------SEAISGSKGKXXXXXXXXXXXX 263
            +HD+ GFRYW           G F+P           +  I G+ G+            
Sbjct: 441 ASHDQVGFRYWDSSKSFSQFTFGLFRPTFDLNDAGEGSTHGIEGATGRFLAVISVILIST 500

Query: 264 XXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXX 323
             Y+G E+  + + EA NPR+++P AIK TL  +++ Y++S++ +G+ +   DP L+   
Sbjct: 501 FAYSGVEMTFVASGEAVNPRKTIPSAIKRTLNIVIIIYMLSLISVGVNIYCGDPRLLSYF 560

Query: 324 XXXXXXX--------------------------------XXPFVVAIKNAGIPVLPHIFN 351
                                                    P+V+A++N G+     + N
Sbjct: 561 SGSAERRFITAMNDDSIRWQVSERCRSGLHYETGYQRNGSSPWVLALQNFGMCTYASVLN 620

Query: 352 ACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYM 411
             ++     A  S L+  SRTLY +A+ RKAP I  +    GVPY S+  +  F  ++Y+
Sbjct: 621 GIMIFITVGAEISSLFSGSRTLYAMAVQRKAPAILQRCTKAGVPYVSVLFTSAFGAISYL 680

Query: 412 NVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFG----DKSGFSYTAPFQ 467
            V + + + F    N+ S    + W+ + +++LRF+ A+  +      D   + Y +PFQ
Sbjct: 681 AVDTTAIENFGVLSNISSASTSIIWMGLNVSFLRFYYALKLRQDIISRDDRSYPYRSPFQ 740

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIK 527
           P+ +   LF CC+  +   YT FL   ++ K+F S Y G+ +++ CY+GYK++  SK+ +
Sbjct: 741 PYLSMYGLFGCCMFVIFMGYTNFLHKYWNTKSFFSAYGGLMLFSACYLGYKIIGTSKIQR 800

Query: 528 PEDVDLYTFKAAID 541
            + +D+ T +  +D
Sbjct: 801 LDQLDMDTGRREMD 814

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  211 bits (537), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 144/500 (28%), Positives = 244/500 (48%), Gaps = 25/500 (5%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK+ L+ RH+ M                       PA++++++   G +VY+V+  +GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
              +P+ G + SY SR++DP+ GFA+ Y YL    +  P ++ A ++ + YW    K   
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR-TG 228
           G ++ +F V ++LIN +GV+ +GE EF  S +K                    N+    G
Sbjct: 204 G-FVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIG 262

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
            +YW +PG F        G KG               ++G+E+  + AAE+KNPRR +P+
Sbjct: 263 TKYWHNPGGFA------HGFKG----FAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPK 312

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K   +RI LFY+IS+ L+G  V Y +  L             PFV+AIK AGI  LP 
Sbjct: 313 AAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASAS--PFVIAIKEAGISGLPS 370

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           + N  +L+ V S  N+ ++ +SR    LA     PK FA  +  G P   L +S++F LL
Sbjct: 371 VINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLL 430

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           ++++ S     +F + + V  +    +W SI + +LRF + + AQ       ++ A    
Sbjct: 431 SFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQT-- 488

Query: 469 WSTWVSLFFCCLIGLIKNYTVF-----LGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
              W S++   LI ++  +  +     L  +     F   Y+ +PV  + Y+G+K+  R+
Sbjct: 489 -GIWGSIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSRN 547

Query: 524 -KLIKP-EDVDLYTFKAAID 541
            +L+ P +++DL T +  +D
Sbjct: 548 WRLVIPAKELDLDTGRREVD 567

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  211 bits (536), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 140/492 (28%), Positives = 224/492 (45%), Gaps = 18/492 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           +LKK +++RHV M                       PA ++I+Y  V  + Y ++   GE
Sbjct: 74  QLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAAGE 133

Query: 110 MAAFIPL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA   P     F +Y S ++    GFA  + +  ++  V P +L   AM +QYW   + +
Sbjct: 134 MAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYW--NDSI 191

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           N  V++ IF V ++ I+  GV+ +GE EF  +  K                    N    
Sbjct: 192 NADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYI 251

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YW DPGAF   + A     G+              Y G EL  +   E +NPRRS P
Sbjct: 252 GAKYWHDPGAFTSDTNA-----GRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRSTP 306

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K ++YRIV+ Y+++++L+G  V  N   L+            P+V+A    G+ V+P
Sbjct: 307 TAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHAS--PYVLAASIHGVKVVP 364

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           HI NA +L+ + S  NS LY A R +  LA    APK     +  G P ++L V  +F +
Sbjct: 365 HIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGV 424

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           + ++  SS   Q+FN+   +  +  L +W  I+I+++RF +A+  Q        Y +PF 
Sbjct: 425 IGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFG 484

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFLG----HTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
            + ++  +FF  L+  +  + V L           TF   Y+  P++   Y GY +  R 
Sbjct: 485 VYGSYFGVFFNLLV-FVAQFWVALAPPMYTEMSADTFFESYLAFPIFFAFYFGYMIWKRD 543

Query: 524 KLI--KPEDVDL 533
             +    E VDL
Sbjct: 544 FTLFSDLESVDL 555

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  209 bits (531), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 147/486 (30%), Positives = 224/486 (46%), Gaps = 21/486 (4%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           +K+AL+ RH+S+                       P ++L+ +  +G++ + VM  +GEM
Sbjct: 32  VKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLGFVIIGIIAFAVMESIGEM 91

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
               P  G FT+ A R+   AL    GY Y+  +F V  N+    + ++Q+W    +V  
Sbjct: 92  ITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEYNTLSSILQFW--GPQVPL 149

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
             +  IF ++  +   +GV  FGE E+WLS +K                    N    GF
Sbjct: 150 YAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFSIIYMSGGVRNKPAFGF 209

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
            YW+DPG+         G KG               Y+GTE   + A E+KNP +SVP A
Sbjct: 210 HYWKDPGSLS------HGFKG----IAVVFVFCSSFYSGTESVALTATESKNPTKSVPYA 259

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
           ++ TL+RIV+ Y+   +  G TV +NDP L             P  +AI  AG     H+
Sbjct: 260 VRQTLWRIVVVYIGIAIFYGSTVPFNDPNL----SVNTKVLKSPIAIAISRAGWAGGSHL 315

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            NA +L    SA N  LY+ SRTL  LA +  APK  A T+  GVP  ++ +     L++
Sbjct: 316 VNAFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAITIFNALGLIS 375

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
            MN+S G++  ++Y VN+  +   + W  I  T+LR  KA +AQ        Y A F PW
Sbjct: 376 LMNMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEELPYKALFYPW 435

Query: 470 STWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLV--HRSKLIK 527
           +   SL     + LI+ +T  +   F    F+  YI +P   I YVG  +   H  +++ 
Sbjct: 436 TPIFSLISNIFLALIQGWTSLV--PFKAPEFVDAYILLPAAIILYVGVCVFKNHNFRIVD 493

Query: 528 PEDVDL 533
              V+L
Sbjct: 494 LTSVNL 499

>Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON}
           YBR132C (REAL)
          Length = 590

 Score =  210 bits (535), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 131/489 (26%), Positives = 234/489 (47%), Gaps = 11/489 (2%)

Query: 52  KKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMA 111
           ++ LE RHV +                       PAS+L++++   + +  +     EM 
Sbjct: 79  RRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMV 138

Query: 112 AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPG 170
            F P+   F   A++ VD +L     + + F   +  P ++ +   ++ YW  R+  + G
Sbjct: 139 CFFPVSSPFLRLATKCVDESLAVMASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYSAG 196

Query: 171 VWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFR 230
           + + + +VL +LI+   V+++GE EFWL+S K                   P HDR GFR
Sbjct: 197 IPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFVTMLGGNPKHDRYGFR 256

Query: 231 YWRDPGAFKPY---SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           Y+ +   FK Y    + +  S G                 G E   ++A E K PR+ +P
Sbjct: 257 YYGE-SPFKQYFPDGKDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLP 315

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDP-LLIXXXXXXXXXXXXPFVVAIKNAGIPVL 346
           +A K    R+   ++ S L +G+  + NDP L              P+V+A+ N  I +L
Sbjct: 316 KAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNMKIRIL 375

Query: 347 PHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC 406
           P + N  ++   FSA N+  Y +SRT YG+A+D  APKIF K N  GVP Y++ +S+++ 
Sbjct: 376 PDVVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTKCNKHGVPIYAVGISLIWA 435

Query: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF 466
           L++ + ++S SA + N+ +N+++   L++++ + I YL F +    Q        + +  
Sbjct: 436 LVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIIYLFFRRTYSIQQDSLPKLPFRSWG 495

Query: 467 QPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLV---HRS 523
           QP++  + L  C  + +I+ YTVF    ++ + F+  Y+ + +    YVGYK +    + 
Sbjct: 496 QPYTAIIGLVSCLAMIMIQGYTVFFPKLWNSQDFLFSYLMVFIDIGIYVGYKFIWKRGKD 555

Query: 524 KLIKPEDVD 532
           K+  P  +D
Sbjct: 556 KVKDPYKID 564

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  209 bits (532), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 140/499 (28%), Positives = 234/499 (46%), Gaps = 28/499 (5%)

Query: 45  KHEGIR--LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
            H+ IR  L ++L  RH++M                       P S+ I+Y+ +G +VY 
Sbjct: 49  DHDKIRESLNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYL 108

Query: 103 VMACLGEMAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
            M CLGEM+ F+P+ G F SYA ++   +  FA+   Y F   +   + LTA  +V+ YW
Sbjct: 109 TMLCLGEMSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYW 168

Query: 162 VSREKVNPGVWIT--IFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXX 219
            S +   P  W    +F V ++ +N + VR +GE E+WL+ +K                 
Sbjct: 169 KSSQHNFP-YWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVG 227

Query: 220 XXPNHDRTGFRYWRDPGAFKPYSEA--ISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAA 277
             P+H+  GF+YW        Y EA  ++G KG               Y GTE   + A 
Sbjct: 228 HNPDHEYIGFKYWS-------YKEAPFVNGFKG----FVTIFVSSAFSYGGTESITLTAG 276

Query: 278 EAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVA 337
           EA+NP R+ PR +K   +RI++FYV ++  + M + Y+ P L             PF + 
Sbjct: 277 EARNPIRNTPRIVKTVFWRILIFYVATMFFISMNIPYDYPNL-----STKSVMTSPFTII 331

Query: 338 IKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKA-PKIFAKTNGWGVPY 396
            + AG        NA +L  + SA N  L+  SR LY + ++    PK+  KTN +  PY
Sbjct: 332 FQMAGTKAAGSFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPY 391

Query: 397 YSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGD 456
            ++ ++     L +     G+  ++ +  N+V +   ++W+SI +T +RF K  +AQ G 
Sbjct: 392 VAVILTWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKG-LAQQGK 450

Query: 457 KSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVG 516
                +     P+  +  + F  LI L++ ++ F    +    F S Y+ + V+  C++ 
Sbjct: 451 TQELQFKNWTYPYGPYFLVIFVTLIILVQGWSAF--DPWSTSDFFSYYLELFVFPTCWLI 508

Query: 517 YKLVHRSKLIKPEDVDLYT 535
           + +  R + +KPED+D  T
Sbjct: 509 WWIFKRDRFVKPEDMDFIT 527

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  210 bits (535), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 139/493 (28%), Positives = 228/493 (46%), Gaps = 19/493 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           +LKK++++RHV M                       PA+++I Y  V  + Y ++   GE
Sbjct: 90  KLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQAAGE 149

Query: 110 MAAFIPL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA   P     F +Y+S ++    GFA  + Y F++  V P +L   AM +++W   + +
Sbjct: 150 MAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFW--NDTI 207

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           NP ++I IF V ++ I+  GV+ +GE EF  +  K                    N    
Sbjct: 208 NPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGNDGYI 267

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YWR+PGAF     A   S G+              + G EL  +   E  NPR++ P
Sbjct: 268 GGKYWRNPGAF-----AGDTSAGRFKNVCYILVTAYFSFGGMELFALSVQEQANPRKTTP 322

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K ++YRI++ Y+++++L+G  V YND  L+            P+V+A    G+ V+P
Sbjct: 323 VAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKVVP 380

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           HI NA +L+ V S  NS LY   R +  LA     PK     +  G P  +L V  +F +
Sbjct: 381 HIINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSVFGV 440

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           + ++  SS    +F +   +  +  L +W SI++++LRF +A+  Q        Y A   
Sbjct: 441 IGFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTG 500

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFL-----GHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            W +   +FF  L+  I  + V L     G     ++F   Y+  P++   Y+GY + +R
Sbjct: 501 IWGSAYGVFFNILV-FIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGYMIYNR 559

Query: 523 S-KLIKPED-VDL 533
               + P D +DL
Sbjct: 560 DFTFLNPLDKIDL 572

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  209 bits (533), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 147/501 (29%), Positives = 228/501 (45%), Gaps = 19/501 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            LKKA+++RHV M                       PAS++I Y  V  + Y V+   GE
Sbjct: 76  NLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAAGE 135

Query: 110 MAAFIPL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA   P    GF +YAS +V    GFA  + +  ++  V P +L   +M ++YW   +K+
Sbjct: 136 MAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYW--NDKI 193

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           N  V++ I  V ++ I+  GVR +GE EF  +S K                         
Sbjct: 194 NADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYI 253

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YWRDPGAF     A   +  +              Y G EL  +   E +NPRRS P
Sbjct: 254 GGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTP 308

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K ++YRI++ Y+++++L+G  V +N   L+            P+V+A+   G+ V+P
Sbjct: 309 AAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHAS--PYVLAVSIHGVKVVP 366

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           HI NA +L+ V S  NS LY + R L  LA    APK F   +  G P  +L +  +F +
Sbjct: 367 HIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGV 426

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           +A+   S     IF +   +  +  L +W SIL++++RF  A+ AQ    +   Y +   
Sbjct: 427 IAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYISITG 486

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFLG-----HTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            W +    FF  L+  I  + V L        +  + F   Y+  PV+   Y+GY L  R
Sbjct: 487 IWGSLYGCFFNVLV-FIAQFWVALSPPGSKGVYSAEAFFESYLAFPVWLFFYLGYMLYSR 545

Query: 523 --SKLIKPEDVDLYTFKAAID 541
             + L   + +DL   +   D
Sbjct: 546 DFTFLTDLKKIDLDNHRRLYD 566

>ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]
           {ON} similar to uniprot|P38090 Saccharomyces cerevisiae
           YBR132C AGP2 Plasma membrane carnitine transporter
           expression is down-regulated by osmotic stress also
           functions as a low-affinity amino acid permease
          Length = 578

 Score =  209 bits (531), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 136/500 (27%), Positives = 234/500 (46%), Gaps = 10/500 (2%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            +++ L+ RHV +                        A++L+ ++   + +  +  C  E
Sbjct: 47  HVQRKLKNRHVQLISISGVIGTALFVSIGKALYHGGAANLLLGFAIWCIPIMCITVCTAE 106

Query: 110 MAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
           M  F+P+   F   A   VD +LG    + + F   +  P ++ +   ++ YW  R+  N
Sbjct: 107 MVCFLPVSSPFLRLAHMCVDDSLGVMASWNFWFLECVQIPYEIVSVNTIIHYW--RDDYN 164

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
             + + + LVL   I+   VR++GE EFWL+S K                   P HDR G
Sbjct: 165 AAIPLVVQLVLYGFISLCTVRYYGEAEFWLASFKIVLAIGLYFFTFVTMLGGNPRHDRYG 224

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYT--GTELCGIVAAEAKNPRRSV 286
           FRY+ +   FK Y     GS                 +T  G E   ++A E   PR+ +
Sbjct: 225 FRYYGE-APFKKYWPNGHGSNASGHFQGFLACVIQAAFTVAGGEYVSMLAGEVVLPRKVM 283

Query: 287 PRAIKLTLYRIVLFYVISILLLGMTVAYNDP-LLIXXXXXXXXXXXXPFVVAIKNAGIPV 345
           PRA K    R+ + ++ S L +G+  + NDP L              P+V+A+K+  I V
Sbjct: 284 PRAFKQVFIRLTVLFLGSCLCVGILCSPNDPDLTAAINESRPGAGSSPYVIAMKHLHIHV 343

Query: 346 LPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLF 405
           LP I NA ++   FS+ N+  Y +SRTLYG+A+D  APKIFA+    G P +++AVS+ +
Sbjct: 344 LPDIVNAALITAAFSSGNAYTYCSSRTLYGMALDGYAPKIFARCTPQGTPIFAMAVSMCW 403

Query: 406 CLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAP 465
             L+ + +   SA + N+ +N+++   L++++ + +TYL F +       +     + + 
Sbjct: 404 GFLSLLQLGDNSAVVLNWLINLITTSQLINFVILCVTYLFFRRVYKVNEHNLPRLPFKSW 463

Query: 466 FQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR--- 522
           +QPW  ++ +     +  I+ Y VF    +  K F+  Y+ + +    Y+GYK + R   
Sbjct: 464 WQPWPAYIGIICAGSMTFIQGYAVFFSSLWSTKQFLFSYLMLFIDIGLYLGYKFIWRRGK 523

Query: 523 SKLIKPEDVDLYTFKAAIDA 542
            KL  P +V+ +   A IDA
Sbjct: 524 DKLRNPTEVNFFPLLAEIDA 543

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  209 bits (532), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 139/502 (27%), Positives = 235/502 (46%), Gaps = 20/502 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           + KK+L +RHV M                       P S++I Y  V  + Y ++   GE
Sbjct: 76  QFKKSLSSRHVIMMSLGTGIGTGLLVANAKGLYYGGPGSLIIGYVLVSFVTYFMIQAAGE 135

Query: 110 MAAFIPL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA   P     F +Y S ++  + GFA  + +  ++  V P +L   ++ ++YW   +K+
Sbjct: 136 MAVAYPTLPGNFNAYQSIFISKSWGFATVWLFCIQWLTVLPLELITSSLTIKYW--NDKI 193

Query: 168 NPGVWITIFLVLIVLINTVG-VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR 226
           N  +++ IF V +V I+ VG +R +GE EF  +S K                    N   
Sbjct: 194 NADIFVMIFYVFLVAIHLVGGIRAYGETEFLFNSCKILMVIGFIILSIVINAGGAGNDGY 253

Query: 227 TGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSV 286
            G +YW +PG+F    +A S  KG               Y GTEL  +   E   PR++ 
Sbjct: 254 IGGKYWHEPGSFAE-GDATSRFKG----ICLVLVSGYFSYGGTELYVLSVNEQAEPRKAT 308

Query: 287 PRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVL 346
           P A K ++YRI++ Y+++++L+G  V +N+  L+            P+V+A    G+ ++
Sbjct: 309 PAAAKKSIYRILIIYLLTMILIGFNVPHNNDQLMGAGGSATHAS--PYVLAATIHGVKIV 366

Query: 347 PHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC 406
           PH  NA +L+ V S  NS L+   R L  LA    APKI +  +  G P  +L +S L  
Sbjct: 367 PHFINAVILISVISVANSSLFAGPRLLSSLATQGYAPKILSYVDREGRPLVALGISFLIG 426

Query: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF 466
           L+A+++ +S   ++F +   +  +  + +W  I+ +++RF  A+  Q  D +   Y A  
Sbjct: 427 LIAFVSCTSHEEEVFTWLAAIAGLSEIFTWSGIMFSHVRFRAAMKVQGKDINELGYKANT 486

Query: 467 QPWSTWVSLFFCCLIGLIKNYTVFL-----GHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
             W +    FF  L+ LI  + V L     G   D + F   Y+  P++  CY GY + +
Sbjct: 487 GVWGSAYGAFFGVLV-LIAQFWVALAPIGNGGKCDAEAFFESYLAFPIWVACYFGYMIYN 545

Query: 522 RS-KLIKPED-VDLYTFKAAID 541
           +   L+ P D +DL +++   D
Sbjct: 546 KDFTLLSPLDKIDLDSYRRIYD 567

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  210 bits (535), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 138/508 (27%), Positives = 232/508 (45%), Gaps = 19/508 (3%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           + + +   LKK+++ RH  M                       P  ++I Y+ +G  VY 
Sbjct: 137 EQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYC 196

Query: 103 VMACLGEMAAFIP--LDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQY 160
           ++   GE+A      + GF +Y    VDPALGF+V + +  ++  V P +L   +M ++Y
Sbjct: 197 IIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKY 256

Query: 161 WVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXX 220
           W +   VNP V++ IF VLIV+IN  G + + E +F+ +  K                  
Sbjct: 257 WTT--SVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGG 314

Query: 221 XPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAK 280
                  G +YWRDPGAF+     I   KG               +  +E   + A+E  
Sbjct: 315 AGTDGYIGSKYWRDPGAFRG-DTPIQRFKG----VVATFVTAAFAFGMSEQLAMTASEQS 369

Query: 281 NPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKN 340
           NPR+++P A K  +YRI+  ++ S+ L+G  V Y    L+            P+V+A+ +
Sbjct: 370 NPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKAS--PYVIAVSS 427

Query: 341 AGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLA 400
            G+ V+PH  NA +LL V S  N   Y +SR L  LA    APK F   +  G P  ++ 
Sbjct: 428 HGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAML 487

Query: 401 VSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGF 460
           VS LF ++A+   S     +F + + +  +  L +WI+I ++++RF +A+  Q       
Sbjct: 488 VSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEV 547

Query: 461 SYTAPFQPWSTWVSLFFCCLIGLIKNYTVFL-----GHTFDYKTFISGYIGIPVYAICYV 515
            Y +    W +  ++    L  LI  + V +     G     ++F   Y+ +P++   Y+
Sbjct: 548 GYKSQVGVWGSAYAVLMMVL-ALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYI 606

Query: 516 GYKLVHR--SKLIKPEDVDLYTFKAAID 541
            YK+  +  S  I  + VDL + +   D
Sbjct: 607 FYKVWKKDWSLFIPADKVDLVSHRNIFD 634

>TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa]
           {ON} 
          Length = 584

 Score =  208 bits (530), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 145/503 (28%), Positives = 237/503 (47%), Gaps = 43/503 (8%)

Query: 52  KKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMA 111
           +K L  RH+SM                       PA++LI Y  VG  ++ V+    E+A
Sbjct: 71  QKVLHQRHLSMIAIGGTLGTGLFIGLGAALTSG-PAALLIGYLLVGTSMFCVIQSAAELA 129

Query: 112 AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPG 170
              P+ G + S+ SR+VD +LGF V   Y   + ++ P++L   ++ + YW S   +NP 
Sbjct: 130 CQFPVSGSYASHVSRFVDESLGFTVATNYTLAWLVLFPSELIGCSLTISYWNS--SINPA 187

Query: 171 VWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR-TGF 229
           VW++IFLV ++ IN  GVR F E EF LS +K                   P+     G 
Sbjct: 188 VWVSIFLVFVLWINLFGVRIFAETEFILSIIKVLAIIIFIIIGIVLIAGGGPDPGGYIGT 247

Query: 230 RYWRDPGAF-KPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
           +YW DPG F KP  + +  +                 + GTE+  +   E+KN   S+ R
Sbjct: 248 KYWHDPGPFAKPVFKNLCQT----------FVAAAFSFGGTEMVLLTGTESKNVS-SIAR 296

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGI--PVL 346
           A K T YRI +FYV +++++G  V YNDP L+            PFV+A+ N G     +
Sbjct: 297 AAKGTFYRIAIFYVTTVVVIGCLVPYNDPRLLSASSSEDISAS-PFVIALSNTGSMGAKV 355

Query: 347 PHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC 406
            H  NA +L+ V S CNS +Y +SR +  L    + PKIF   +  G P   +AVS  F 
Sbjct: 356 SHFMNAVILVAVVSVCNSTVYASSRLIQALGTAGQLPKIFGYMDRKGRPLVGIAVSATFG 415

Query: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF 466
           LL ++  +   +++F +   + S+   ++W SI +  +R+  A+ A+       +Y +  
Sbjct: 416 LLGFLVATKKQSEVFTWLFALCSVAAFVTWFSICLAQVRYRMAMRARKRSLDSIAYKSIL 475

Query: 467 QPWSTWVSLFFCCLIGLIKNYTVFLGHTF------DYKTFISGY----IGIPVYAICYVG 516
             W          ++G I N+ +  G  +      + K+   G+    + IP+  + ++G
Sbjct: 476 GIWGG--------VVGCIVNFLLVAGEVYVSAFPANAKSSAEGFFKYTLSIPIMIVVFLG 527

Query: 517 YKLVHRSK----LIKPEDVDLYT 535
           +K +HR+      +K +D+DL T
Sbjct: 528 HK-IHRNDWGNWYVKRKDMDLDT 549

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  208 bits (530), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 147/502 (29%), Positives = 231/502 (46%), Gaps = 19/502 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVM-ACLG 108
           ++K+ +++RH++M                       P  ++I Y     ++Y V+ AC  
Sbjct: 75  KMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQACCE 134

Query: 109 EMAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
              ++  L G + SY S  VD    FAV + Y  ++ IV P +L   +M ++YW   + +
Sbjct: 135 LGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYW--NDSI 192

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           NP V++ IF   IV I+  G + + E EF  +S K                    +    
Sbjct: 193 NPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGASKS-GYI 251

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YW  PGAF    +AI   KG               Y G+E   + AAE  NPR+SVP
Sbjct: 252 GGKYWHTPGAFVG-EKAIDHFKG----ICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVP 306

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
           +A K  LYR+++ ++  I+L+G  V Y+ PLL+            PFV+A  + G+ V+P
Sbjct: 307 KATKRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHAS-PFVIAAASHGVKVVP 365

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           HI NA +L+ V S  NS  Y A R L  LA     PK+F   +  G P  ++    +F L
Sbjct: 366 HIINAVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGL 425

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           ++++  S     +F +   +VS+  L +W +I ++++RF  A+  Q        Y A   
Sbjct: 426 ISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKANTG 485

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFL-----GHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            W +W ++ F  ++ L   + V +     G   D   F   Y+  PV    Y GYKL +R
Sbjct: 486 YWGSWYAIAFNIIV-LAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYR 544

Query: 523 S-KLIKPED-VDLYTFKAAIDA 542
             KL  P D VDL + +   DA
Sbjct: 545 DWKLFIPADKVDLESHRKIFDA 566

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  207 bits (528), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 147/467 (31%), Positives = 215/467 (46%), Gaps = 19/467 (4%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           +K+ L+ RH+S+                       P ++L+ +  +G+L + +M  +GEM
Sbjct: 56  VKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESIGEM 115

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
               P  G FT+   R+   AL    GY Y   +F V  N+    + +MQ+W    +V  
Sbjct: 116 ITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFW--GPQVPL 173

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
             +I IF     +   +GV  FGE E+WL+  K                    N    GF
Sbjct: 174 YGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFGF 233

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           +YW DPGA        +G KG               Y+GTE   + A E+KNPRR+VP A
Sbjct: 234 QYWNDPGALS------NGFKG----IANVFVFCSTFYSGTESVALAATESKNPRRAVPIA 283

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
           I+ T +RI++ Y+   +  G+TV YND  L             P  +AI  AG P   H+
Sbjct: 284 IRQTFWRILIVYLGISIFYGVTVPYNDENL----NFATKVLKSPIAIAISRAGWPAGVHL 339

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            NA +L+   SA N  LY+ SRTL  LA +  APK+ A T+  GVP  ++ V     L++
Sbjct: 340 VNAFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLIS 399

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
            MNVS  +   +NY VN+  +   + W  I +T+LRF KA   Q   +    Y A   P 
Sbjct: 400 LMNVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPV 459

Query: 470 STWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVG 516
              VS+     +GL++ ++ F    FD K F+  YI IP   I Y+G
Sbjct: 460 FPIVSIIANIFLGLVQGWSYF--KPFDAKNFVDAYILIPAGIILYLG 504

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  208 bits (530), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 147/519 (28%), Positives = 244/519 (47%), Gaps = 43/519 (8%)

Query: 42  VDGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVY 101
           +DG  +   LK++L+ARH+ M                       P +++I ++  G  + 
Sbjct: 76  LDGSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQII 135

Query: 102 TVMACLGEMAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQY 160
             +  LGE+    P+ G F +Y++R++DP+L F +   Y+ ++F V P ++ + AM +QY
Sbjct: 136 GTIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQY 195

Query: 161 WVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXX 220
           W   + ++P VW+ IF   IV IN  G R FGE EF  SSVK                  
Sbjct: 196 W--NQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGG 253

Query: 221 XPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAK 280
            P+HD  G +YW DPG          G  G                 GTE+  + + E  
Sbjct: 254 GPDHDFVGAKYWHDPGCLA------HGFPG----VLSVLVVASYSLGGTEMVCLASGET- 302

Query: 281 NPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKN 340
           +P+  +P AIK T +RI+ F+++S+ L+G  V Y +  L+            PFV+AIK 
Sbjct: 303 DPKE-LPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLL----GGSSVNNSPFVIAIKL 357

Query: 341 AGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLA 400
             I VLP I NA +L+ + S  NS ++ +SRTL  +A     P+ F   +  G P   + 
Sbjct: 358 HQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGII 417

Query: 401 VSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGF 460
            + LF LLA++  SS  +++F++ + +  +   + W+SI I+++RF  A+ AQ       
Sbjct: 418 TNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDEL 477

Query: 461 SYTAPFQPWST----------WVSLFFCCL--IGLIKNYTVFLGHTFDYKTFISGYIGIP 508
            + +    W +           V+ F+C L  IG  +N ++        K F   Y+   
Sbjct: 478 EFVSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWENSSI------RAKKFFQSYLCAL 531

Query: 509 VYAICYVGYKLVHRSK------LIKPEDVDLYTFKAAID 541
           +  + +VG+K+ +R K      ++    +DL T +  ID
Sbjct: 532 IMIVLFVGHKIFYRYKTGKWWSMLPLNKIDLETDRKNID 570

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  208 bits (529), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 135/501 (26%), Positives = 236/501 (47%), Gaps = 24/501 (4%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           ++KK++++RH+ M                       PA ++I Y+   +++Y ++   GE
Sbjct: 69  KMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYCIIQAAGE 128

Query: 110 MA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           +   +  + G +T+Y+S  VDPALGF+V + Y  ++  V P QL   AM ++YW +    
Sbjct: 129 LGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRYWTN---A 185

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           NP +++ +F V+I++IN  G + + E EF  +  K                         
Sbjct: 186 NPDIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAGTSGYI 245

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YW  PG+F       +G KG               Y G E+  + A+E +NPR+S+P
Sbjct: 246 GAKYWHSPGSFA------AGFKG----VCYVFCYAAFSYGGIEVMVLTASEQENPRKSIP 295

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K  +YRI++ Y+++ +++   V YN   L+            P V+A+ + G+ ++P
Sbjct: 296 NACKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHAS-PLVIAVASHGVKIVP 354

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           HI NA +L+ V S  NS +Y A R L  L+    APK     +  G P    A+++L  L
Sbjct: 355 HIINAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITLLVAL 414

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           +A++  S     IF + + +  +  +  W SI ++++RF  A+ AQ        Y +   
Sbjct: 415 IAFVAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYKSQTG 474

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFLG-----HTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            W +W ++    L+ LI  + V +         + +TF   Y+  P+    Y GYK+ H+
Sbjct: 475 YWGSWFAIVISVLV-LIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGAYFGYKVYHK 533

Query: 523 S-KLIKP-EDVDLYTFKAAID 541
             +L  P  +VDL + +   D
Sbjct: 534 DWRLCIPASEVDLSSHRNISD 554

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  209 bits (531), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 148/502 (29%), Positives = 234/502 (46%), Gaps = 16/502 (3%)

Query: 47  EGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMAC 106
           E   L+K ++ RHV M                       PA ++I YS +G  +Y ++  
Sbjct: 118 ESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLYCIIQA 177

Query: 107 LGEMAA-FIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSR 164
            GEMA  +  L+G F +Y S  +DPALGF+V + Y  ++  V P +L   ++ ++YW + 
Sbjct: 178 AGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIKYWTT- 236

Query: 165 EKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNH 224
            KV+P V++ IF VLI+ IN  G R + E EF+ +  K                    N 
Sbjct: 237 -KVDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGAGND 295

Query: 225 DRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRR 284
              G +YW +PGAF+    A+   KG               +  TE   + AAE  NPR+
Sbjct: 296 GYLGAKYWHEPGAFRG-EHAVDRFKG----VMDTFVAAAFAFGATEFIALTAAEQSNPRK 350

Query: 285 SVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIP 344
           ++P A K  LYRIVL +++SI++LG  V Y+   L+            P+V+A+   G+ 
Sbjct: 351 AIPSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLGSSGSGVKAS--PYVLAVSLHGVR 408

Query: 345 VLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVL 404
           V+PH  NA +LL V S  NS  Y +SR L  L+    APK F   +  G P  ++ +S L
Sbjct: 409 VVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMSAL 468

Query: 405 FCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQ---FGDKSGFS 461
           F ++A+   S     +FN+ + +  +  L +W +I ++++RF  A+  Q    G+    S
Sbjct: 469 FGVIAFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGFHS 528

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521
            T  +        +    +               D + F   Y+ +P+    Y GYKL +
Sbjct: 529 QTGVYGSLYAATMMILALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKLYY 588

Query: 522 RS-KL-IKPEDVDLYTFKAAID 541
           R  KL IK + +DL + +   D
Sbjct: 589 RDWKLYIKADKIDLISHRQIFD 610

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  208 bits (529), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 141/493 (28%), Positives = 228/493 (46%), Gaps = 19/493 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           +LKK++++RHV M                       PA+++I Y  V  + Y ++   GE
Sbjct: 90  KLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAAGE 149

Query: 110 MAAFIPL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA   P     F +Y+S ++    GFA  + Y F++  V P +L   +M +Q+W   +K+
Sbjct: 150 MAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFW--NDKI 207

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           NP ++I IF V ++ ++  GV+ +GE EF  +  K                    N    
Sbjct: 208 NPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYI 267

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G  YW  PGAF     A   S  +              + G EL  +   E  NPR+S P
Sbjct: 268 GGAYWHKPGAF-----AGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRKSTP 322

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K ++YRIV+ Y+++++L+G  V YND  L+            P+V+A    G+ ++P
Sbjct: 323 VAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHAS--PYVLAASIHGVRIVP 380

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           HI NA +L+ V S  NS LY   R +  LA    APK     +  G P  +L V  +  +
Sbjct: 381 HIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVIGV 440

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           +A++  SS    +F +   +  +  L +W SI++++LRF +A+  Q    +   Y A   
Sbjct: 441 IAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKATTG 500

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFL-----GHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            W +    FF  L+  I  + V L     G   + + F   Y+  P++ I Y+GY + +R
Sbjct: 501 IWGSIYGSFFNILV-FIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYMIYNR 559

Query: 523 S-KLIKPED-VDL 533
              L+ P D +DL
Sbjct: 560 DFTLLNPLDKIDL 572

>KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.397
           YBR132C
          Length = 592

 Score =  207 bits (528), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 132/454 (29%), Positives = 226/454 (49%), Gaps = 9/454 (1%)

Query: 89  ILISYSFVGLLVYTVMACLGEMAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVT 147
           +LI+++   + +  +     EM +F P+   F   A + VD +L     + + F   +  
Sbjct: 118 LLIAFAMWCVPILAITVSTAEMVSFFPVSSPFLRLAKKCVDESLAVMASWNFWFLECVQI 177

Query: 148 PNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXX 207
           P ++ +   V+ YW  R+  NP + + +  V+ +LI+   V+++GE EFWL+S K     
Sbjct: 178 PYEIVSVNTVIHYW--RDDYNPAIPLVVQSVMYILISVCAVKYYGEMEFWLASFKIVLAV 235

Query: 208 XXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPY----SEAISGSKGKXXXXXXXXXXXX 263
                         P HD  GFR +R   +FK Y    ++A S S G             
Sbjct: 236 GLFFFTLVTMVGGNPKHDVYGFRNFR-IDSFKKYYPDGNDAHSRSVGYFQGFLVCLIRAA 294

Query: 264 XXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXX 323
               G E   ++A E K PR+ +P+A +    R+ + ++ S L +G+  + NDP L    
Sbjct: 295 ATIAGGEYIAMLAGEVKEPRKVLPKAFRQVFVRLTVLFLGSCLCVGIVCSSNDPALTAAI 354

Query: 324 XXXX-XXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKA 382
                     P+V+A+ N GI VLP I N  ++   FSA N+  Y +SRTLYG+A+D  A
Sbjct: 355 SESRPGAGSSPYVIAMNNLGIRVLPDIVNIALITAAFSAGNAYTYCSSRTLYGMALDGYA 414

Query: 383 PKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILIT 442
           PKIF K N  GVP +++AVS+ + L++ + ++S SA + N+ +N++    L++++++ I 
Sbjct: 415 PKIFKKCNKQGVPMFAVAVSLCWALISLLQLNSNSAVVLNWLINIIVSSQLINFVALCII 474

Query: 443 YLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFIS 502
           YL F +A + Q  +  G  + + +QPW+    +     + LI+ YTVF    +  + F+ 
Sbjct: 475 YLHFRRAYLLQQDNLPGLPFKSWWQPWTAIFGMSCSVAMILIQGYTVFFPKLWKARDFLF 534

Query: 503 GYIGIPVYAICYVGYKLVHRSKLIKPEDVDLYTF 536
            Y+ + +    Y+ YK V      K +D  L  F
Sbjct: 535 YYLMVFIDVGIYLFYKFVWTHGKDKVKDPTLIDF 568

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  208 bits (529), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 149/547 (27%), Positives = 244/547 (44%), Gaps = 26/547 (4%)

Query: 4   SLEKKNAGILYSNETLEEDVA--FDKLERXXXXXXXXXXXVDGKHEGI-------RLKKA 54
           S EK  +G    +E L   +A  F + E                 +GI       +LKK+
Sbjct: 35  SREKAYSGQPSKSEKLIHRLANSFKRAEGSITKTRQINENTSDLEDGIESITSDSKLKKS 94

Query: 55  LEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFI 114
           +++RHV M                       PA+++I Y  V  + Y ++   GEMA   
Sbjct: 95  MKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFVTYFMIQAAGEMAVTY 154

Query: 115 PL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVW 172
           P     F +Y+S ++    GFA  + Y F++  V P +L   +M +QYW   +K+NP V+
Sbjct: 155 PTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELITASMTIQYW--NDKLNPDVY 212

Query: 173 ITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYW 232
           I IF + ++ I+  GV+ +GE EF  +  K                    +    G  YW
Sbjct: 213 ILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVVINCGGAGDDGYIGGAYW 272

Query: 233 RDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKL 292
            +PGAF     A   S  +              + G EL  +   E  NPR+S P A K 
Sbjct: 273 HNPGAF-----AGDTSIARFKNVCYILVTGYFSFGGMELFALSVQEQSNPRKSTPVAAKR 327

Query: 293 TLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNA 352
           ++YRIV+ Y+++++L+G  V YND  L+            P+V+A    G+ ++PHI NA
Sbjct: 328 SIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKIVPHIINA 385

Query: 353 CVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMN 412
            +L+ V S  NS LY   R +  L+    APK     +  G P  +L V  +F ++A++ 
Sbjct: 386 VILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVCCIFGVIAFVA 445

Query: 413 VSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTW 472
            SS    +F +   +  +  L +W SI++++LRF +A+  Q        Y A    W + 
Sbjct: 446 ASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSV 505

Query: 473 VSLFFCCLIGLIKNYTVF--LGHT--FDYKTFISGYIGIPVYAICYVGYKLVHRS-KLIK 527
              FF  L+ + + +     LG+      ++F   Y+  P++   + GY + +R   L+ 
Sbjct: 506 YGFFFNILVFIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGYMIYNRDFTLLN 565

Query: 528 PED-VDL 533
           P D +DL
Sbjct: 566 PLDKIDL 572

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  208 bits (530), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 135/490 (27%), Positives = 228/490 (46%), Gaps = 15/490 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            LKK++++RHV M                       PA ++++Y  V  + Y ++   GE
Sbjct: 100 HLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQAAGE 159

Query: 110 MAAFIPL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA   P     F SY S +V    GFA  + +L ++  V P +L   ++ ++YW   +K+
Sbjct: 160 MAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYW--NDKI 217

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           N  V++ IF V ++ I+  GV+ +GE EF  +S K                    +    
Sbjct: 218 NSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDGYI 277

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YW DPGAF  ++       G+              Y GTEL  +   E +NPR+S P
Sbjct: 278 GGKYWHDPGAFTSHTNI-----GRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKSTP 332

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
           +A K ++YRIV+ Y+++++L+G  V +++  L+            P+V+A    G+ ++P
Sbjct: 333 QAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHAS--PYVLAASIHGVRIVP 390

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           H  NA +L+ V S  NS LY + R L  LA    APK     +  G P  +LA   LF +
Sbjct: 391 HFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGV 450

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           + +   S+   Q+F +   +  +  L +W  I+++++RF +A+  Q  D +   Y A   
Sbjct: 451 IGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYKAVSG 510

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFL--GHTFDYKTFISGYIGIPVYAICYVGYKLVHR--S 523
            W +   +FF  L+   + +      G      +F   Y+  P++   Y GY L ++  +
Sbjct: 511 VWGSVYGVFFNILVFFAQFWVALAPPGSKPTALSFFESYLAFPIFFTFYFGYMLWNKDFT 570

Query: 524 KLIKPEDVDL 533
            LI  E +DL
Sbjct: 571 FLIPLESIDL 580

>Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W
           (REAL)
          Length = 583

 Score =  207 bits (527), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 158/545 (28%), Positives = 242/545 (44%), Gaps = 47/545 (8%)

Query: 3   ESLEKKNA-----GILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEA 57
            S ++K+A     G+LYS  + EE V +D   +                     KK L+ 
Sbjct: 35  NSFKRKDASVIQEGLLYSELSEEEKVQWDLANQPY-------------------KKVLDQ 75

Query: 58  RHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLD 117
           RH++M                       PAS+LI +  VG  +  V+ C  E++   P+ 
Sbjct: 76  RHLTMIAIGGTLGTGLFIGLGESLASG-PASLLIGFLLVGASMLCVVQCGAELSCQYPVS 134

Query: 118 G-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIF 176
           G +  +ASR++DP+ GF+VG  YL  + I  P++L   ++ M YW     VNP VW+ I 
Sbjct: 135 GSYALHASRFIDPSAGFSVGINYLLMWLISFPSELVGCSLTMTYWA--PSVNPAVWVAIA 192

Query: 177 LVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR-TGFRYWRDP 235
             L +L+N  G R F E EF++S  K                   P      G +YW DP
Sbjct: 193 FTLSMLLNLFGARGFAESEFYMSIFKIVALFIFIIIGIILIAGGGPESTGYIGTKYWYDP 252

Query: 236 GAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLY 295
           G+F P +                       ++GTE+  + +AEA++   SV RA K T +
Sbjct: 253 GSFAPPA---------FKNFCNTFVSAAYSFSGTEMVVLTSAEARDVS-SVSRAAKGTFW 302

Query: 296 RIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGI--PVLPHIFNAC 353
           RI +FY+++++++G  V YNDP LI            PFV+A+ N G     +    NA 
Sbjct: 303 RIAVFYIVTVIIIGCLVPYNDPRLINGSSSEDITAS-PFVIALSNTGAMGTRVSQFMNAV 361

Query: 354 VLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNV 413
           +L+ VFS CNS +Y +SR + GLA   + PKI    +  G P   +A+   F LL ++ V
Sbjct: 362 ILIAVFSVCNSCVYASSRLIQGLATAGQLPKICGYMDRNGRPLVGMAICGAFGLLGFLVV 421

Query: 414 SSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWV 473
           S     +F +   + SI    +W  I    +RF  A+ AQ        Y +P   +   V
Sbjct: 422 SKDQGTVFTWLFALCSISFFTTWFCICFCQIRFRMAMKAQGKPDDDIIYKSPLGIYGGVV 481

Query: 474 --SLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKL---IKP 528
             +L    +IG I      +G       F    + IP+    Y+G+++  R      IK 
Sbjct: 482 GCTLNVLLVIGEIYVSAAPVGMPSSAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKR 541

Query: 529 EDVDL 533
           ED+DL
Sbjct: 542 EDIDL 546

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  207 bits (528), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 141/491 (28%), Positives = 230/491 (46%), Gaps = 17/491 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            LKKA++ RHV M                       PA+++I Y  V ++ Y ++   GE
Sbjct: 90  HLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMIQAAGE 149

Query: 110 MAAFIPL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA   P     F +YAS +V    GFA  + +  ++  V P +L   +++++YW   EKV
Sbjct: 150 MAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYWT--EKV 207

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           N  V++ IF V ++ I+ +GV+ +GE EF  +  K                    +    
Sbjct: 208 NADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGHDGYI 267

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YW  PGAF     A + +  +              Y GTEL  +   E +NPR+S P
Sbjct: 268 GGKYWHSPGAF-----AGTNAAERFKGVCYVLVSGYFSYGGTELYVLSVNEQENPRKSTP 322

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K ++YRI++ Y+++++L+G TV +ND  L+            P+V+A    G+ V+P
Sbjct: 323 IAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHAS--PYVLAASIHGVRVVP 380

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           HI NA +L+ V S  NS LY A R L  LA    APK     +  G P Y+L    +F +
Sbjct: 381 HIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACAVFGV 440

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           +A+   S    Q+F +   +  +  L +W SI+++++RF +A+  Q  D +   Y A   
Sbjct: 441 IAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYIANTG 500

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFLG---HTFDYKTFISGYIGIPVYAICYVGYKLVHRS- 523
            W +   + F  L+  I  + V L         ++F   Y+  P++   Y GY + ++  
Sbjct: 501 YWGSVYGVVFNILV-FIAQFWVALAPPKSPITAQSFFESYLAFPIWIAFYFGYMIWNKDY 559

Query: 524 KLIKPED-VDL 533
             + P D +DL
Sbjct: 560 TFLNPLDKIDL 570

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  207 bits (526), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 139/500 (27%), Positives = 232/500 (46%), Gaps = 27/500 (5%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           ++KK ++ RH+ M                       PA +++ Y     ++Y ++   GE
Sbjct: 64  KMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAGE 123

Query: 110 MA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           +   +  + G +T+Y+S  VDPA+GF+V + Y  ++  V P QL   AM++QYW     +
Sbjct: 124 LGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTD---I 180

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           NP +++ I   +IV IN  G + + E EF+ +  K                         
Sbjct: 181 NPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYI 240

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YW +P  F      ++G KG               Y G E+  + A+E +NPR+S+ 
Sbjct: 241 GDKYWHEPRPF------MNGFKG----LCFVFCYAAFAYGGIEVMVLSASEQENPRKSIS 290

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K  +YRIVL Y+++ +++   V  + P L             P V+A+   G+ ++P
Sbjct: 291 SACKKVIYRIVLIYLLTTVIVCFLVPADHPSL-----ASEGSRASPLVIAVSFHGVKIVP 345

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           HI NA +L+ V S  NS LY A R L  LA    APKIF   +  G P  +  V+++F L
Sbjct: 346 HIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGL 405

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           LA++  S     +F + + +  +  +  W+SI I+++RF  A+ AQ        Y A   
Sbjct: 406 LAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTG 465

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFLG----HTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
            W +W+++    LI LI  + V +        D ++F   Y+  P+  + Y GYK+ H+ 
Sbjct: 466 YWGSWIAVVTAFLI-LIAQFWVAISPVETKGVDARSFFQSYLAFPILLLAYFGYKIYHKD 524

Query: 524 --KLIKPEDVDLYTFKAAID 541
               I   +VDL + +   D
Sbjct: 525 WRICIPASEVDLISHRQVFD 544

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  208 bits (530), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 137/501 (27%), Positives = 231/501 (46%), Gaps = 19/501 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            LKK ++ RH+ M                       PA ++I Y+ +G  +Y ++   GE
Sbjct: 142 NLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQACGE 201

Query: 110 MAAFIP--LDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           +A      + GF +Y S  VDPALGF+V + Y  ++  V P +L   +M ++YW    KV
Sbjct: 202 LAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTV--KV 259

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           +P V++ IF VLI++IN  G + + E +F+ +  K                         
Sbjct: 260 DPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYI 319

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G RYW +PGAF+  +  I   KG               +  +E   + A+E  NPR+++P
Sbjct: 320 GSRYWHNPGAFRGNT-GIQRFKG----VVATFVTAAFAFGMSEQLAMTASEQSNPRKAIP 374

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K  +YRI+  ++ S++L+G  V Y    L+            P+V+A+ + G+ V+P
Sbjct: 375 SAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKAS--PYVIAVASHGVRVVP 432

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           H  NA +LL V S  N   Y +SR L  LA    APK F   +  G P  ++ VS +F +
Sbjct: 433 HFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGI 492

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           +A+   S     +F + + +  +  L +WI+I ++++RF +A+  Q        Y +   
Sbjct: 493 IAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVG 552

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFL-----GHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            W +  ++    L  LI  + V +     G     ++F   Y+ +P+    YV YK+  +
Sbjct: 553 IWGSMYAIVMMVL-ALIAQFWVAISPIGGGGKLSAQSFFENYLAMPILIALYVFYKVWKK 611

Query: 523 --SKLIKPEDVDLYTFKAAID 541
             +  I  + +DL T +   D
Sbjct: 612 DWTLFIPADKIDLVTDRQIFD 632

>Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)
          Length = 583

 Score =  207 bits (526), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 155/534 (29%), Positives = 236/534 (44%), Gaps = 46/534 (8%)

Query: 11  GILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSMXXXXXXXX 70
           G+LYS  T EE + +D   +                     KK L  RH++M        
Sbjct: 48  GLLYSELTEEEKIQWDLANQPY-------------------KKVLSQRHLTMIAIGGTLG 88

Query: 71  XXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDG-FTSYASRYVDP 129
                          PAS+LI +  VG  +  V+ C  E++   P+ G +  +ASR++DP
Sbjct: 89  TGLFIGLGESLASG-PASLLIGFLLVGASMLCVVQCGAELSCQYPVSGSYALHASRFIDP 147

Query: 130 ALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVR 189
           ++GF++G  YL  + I  P++L   ++ + YW     VNP  W+ I  VL +L+N  G R
Sbjct: 148 SVGFSIGINYLLMWLISYPSELVGCSLTISYWA--PSVNPAAWVAIAFVLSMLLNMFGAR 205

Query: 190 FFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF---RYWRDPGAFKPYSEAIS 246
            F E EF++S  K                   P  D TG+   +YW DPG+F P      
Sbjct: 206 GFAESEFYMSIFKIVALFIFIIIGIILIAGGGP--DSTGYIGTKYWHDPGSFAP------ 257

Query: 247 GSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISIL 306
                              ++GTE+  + + EA+N   SV RA K T +RIV+FY+++++
Sbjct: 258 ---PVFKNLCNTFVSAAYSFSGTEMVVLTSTEARNVS-SVSRAAKGTFWRIVIFYIVTVI 313

Query: 307 LLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGI--PVLPHIFNACVLLFVFSACNS 364
           ++G  V YND  LI            PFV+A+ N G     + H  NA +L+ VFS CNS
Sbjct: 314 IIGCLVPYNDSRLINGSSSEDITAS-PFVIALSNTGTMGKRVSHFMNAVILIAVFSVCNS 372

Query: 365 DLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYF 424
            +Y +SR + GLA   + P+I A  +  G P   +A+   F LL ++ VS     +F + 
Sbjct: 373 CVYASSRLIQGLATAGQLPRICAYMDRNGRPLVGMAICGAFGLLGFLVVSKNQGTVFTWL 432

Query: 425 VNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCL--IG 482
             + SI    +W  I    +RF  A+ AQ   K    Y +    +   V      L  IG
Sbjct: 433 FALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSSLGIYGGIVGCILNVLLVIG 492

Query: 483 LIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH---RSKLIKPEDVDL 533
            I      +G       F    + IP+    Y+G+++     R   IK  D+DL
Sbjct: 493 EIYVSAAPVGSPSSAANFFEYCMSIPIMIAVYIGHRIYRKDWRHWYIKRRDIDL 546

>TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {ON}
           Anc_3.397 YBR132C
          Length = 575

 Score =  206 bits (524), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 137/489 (28%), Positives = 230/489 (47%), Gaps = 12/489 (2%)

Query: 53  KALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAA 112
           + L+ RHV +                       PA +LI+++   + +  +     EM  
Sbjct: 64  RRLKNRHVQLIAISGVIGTALFVAIGKALYKGGPAFLLIAFALWCVPILCITVSTAEMVC 123

Query: 113 FIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGV 171
           F+P+   F   A+R  D +L     + + F   +  P ++ +   ++ YW  R+  +  +
Sbjct: 124 FLPVSSPFLRLAARCADDSLAVMASWNFWFLQCVQIPFEIVSVNTIIHYW--RDDYSAAI 181

Query: 172 WITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRY 231
            + + +VL  LI+   V+++GE EFWL+S K                   P HDR GFRY
Sbjct: 182 PLVVQIVLYFLISICAVKYYGETEFWLASFKIILALGLFLFTFITMLGGNPKHDRYGFRY 241

Query: 232 WRDPGAFKPY----SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           + +   FK Y     +    S G                 G E   ++A E K PR+ +P
Sbjct: 242 YGET-PFKKYYPNGDKDAGASVGYFQGFLACLIQASFTIAGGEYISMLAGEVKLPRKVLP 300

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXX-XXXXXPFVVAIKNAGIPVL 346
           RA K   YR+   ++ S L +G+  + NDP L              P+V+A+ N GI VL
Sbjct: 301 RAFKQVFYRLTFLFLGSCLCVGIICSANDPALTAAIDESRPGAGSSPYVIAMNNLGIKVL 360

Query: 347 PHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC 406
           P I NA ++   FSA N+  Y +SRTLYG+A+D  AP+IF + N  GVP YS+ +S+L+ 
Sbjct: 361 PDIVNAALITAAFSAGNAYTYCSSRTLYGMALDGYAPRIFTRCNKHGVPIYSVLISLLWG 420

Query: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF 466
           L++ + ++  SA + N+ +N+++   L+++  + I YL F +A +          + +  
Sbjct: 421 LISLLQLNDNSAVVLNWLINLITASQLINFTVLCIIYLFFRRAYLLHKDILPKLPFKSWG 480

Query: 467 QPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLV---HRS 523
           QP++  V L     + LI+ YTVF    +  + F+  Y+ + +    Y+GYK +    R 
Sbjct: 481 QPYTAIVGLVSATAMILIQGYTVFFPSLWTVRDFLFCYLMVFIDIGIYIGYKFIWRRGRD 540

Query: 524 KLIKPEDVD 532
           K   P+ VD
Sbjct: 541 KFKDPKTVD 549

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  206 bits (525), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 135/501 (26%), Positives = 238/501 (47%), Gaps = 14/501 (2%)

Query: 47  EGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMAC 106
           E  R  K L  RH+                         P S++I +  +   ++T++  
Sbjct: 66  EDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNA 125

Query: 107 LGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSRE 165
           LGE+++  P+  GF  Y SR+V+P+ GFAV   YL ++ ++ P +L A ++ ++YW S  
Sbjct: 126 LGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNS-- 183

Query: 166 KVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHD 225
            +N   W+ IF  +I L N + V+ FGE EF LS VK                   P   
Sbjct: 184 TINSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGG 243

Query: 226 RTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRS 285
             G +YW +PGAF   +     S  +              Y+GTEL  + AAE+ NPR +
Sbjct: 244 YIGGKYWSNPGAFVGNT-----SSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRIT 298

Query: 286 VPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPV 345
           +P+A K T + I + Y++ + L+G  V  +DP L+            P V+AI+N GI  
Sbjct: 299 LPKACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAAS-PLVIAIENGGIKG 357

Query: 346 LPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLF 405
           LP + NA +L+ V S  NS +Y  SR +  +A     PK F+  +  G P Y++  +++F
Sbjct: 358 LPSLMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIF 417

Query: 406 CLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAP 465
            LL+++  S+    +F +   +  +  L  W +I ++++RF   +  +        + + 
Sbjct: 418 GLLSFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSM 477

Query: 466 FQPWSTWVSLFFCCLIGLIKNYTVFLGHT---FDYKTFISGYIGIPVYAICYVGYKLVHR 522
              W ++       ++ ++  +T     T      ++F   Y+  P+  +CY+G+KL  +
Sbjct: 478 TGVWGSYYGCVIIFVVLVVCFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTK 537

Query: 523 S-KLIKP-EDVDLYTFKAAID 541
           S +L+ P  ++D+ + + A+D
Sbjct: 538 SWRLLTPTTEIDIDSGRRAVD 558

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  206 bits (525), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 143/514 (27%), Positives = 235/514 (45%), Gaps = 32/514 (6%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           + KHE  +LK+ +  RHV M                       P  + + +  +G  VY 
Sbjct: 83  NNKHE--KLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYC 140

Query: 103 VMACLGEMAAFIPL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQY 160
           V+   GEMA   P    GF +Y S  VDP  GFA  + Y  ++  V P +L   ++ ++Y
Sbjct: 141 VIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITIKY 200

Query: 161 WVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXX 220
           W +   +NP +++ +F +LI++IN  G R + E EF+ ++ K                  
Sbjct: 201 WTT--AINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGA 258

Query: 221 XPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAK 280
             N    G +YWR+PG+F  ++ AI   KG                  +E   + AAE  
Sbjct: 259 AGNDGYIGAKYWREPGSFGGHT-AIDHFKG----VVSTLVNAAFSLGCSEFVALTAAEQA 313

Query: 281 NPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKN 340
           NPR+SVP A K  LY++ + ++ S+ L+G  V  N   L+            P+V+A+ +
Sbjct: 314 NPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVS--PYVIAVAS 371

Query: 341 AGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLA 400
            G+ V+PH  NA +LL V S  NS  Y +SR L  LA    AP +F   +  G P  ++ 
Sbjct: 372 HGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMM 431

Query: 401 VSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGF 460
           VS+    L ++  S     +F + + +  +  L +W SI I+++RF KA++ Q     G 
Sbjct: 432 VSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGL 491

Query: 461 SYTAPFQPWS----------TWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVY 510
            + A    W           T+++ F+ CLI +  +         + ++F  GY+  P++
Sbjct: 492 GFKAQTGVWGSYYSAVIMILTFIAQFWTCLIPMGSSKP-------NAESFFEGYLAFPIF 544

Query: 511 AICYVGYKLVHRS--KLIKPEDVDLYTFKAAIDA 542
              Y GYK+ +++    I  E +DL   +   DA
Sbjct: 545 VALYFGYKIYNKNWQLFIPAEKIDLDLHRKIFDA 578

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  206 bits (523), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 151/554 (27%), Positives = 256/554 (46%), Gaps = 36/554 (6%)

Query: 3   ESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSM 62
           + + KK + +L  +  LEE    +K              VDG  +   LK+ L++RH+ M
Sbjct: 21  QRVLKKRSSVLEESRLLEESRT-NKRGLVRRCIDSFKPPVDGSFDPDNLKRTLKSRHLIM 79

Query: 63  XXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDG-FTS 121
                                  P ++LI ++  G  +   +  LGE+    P+ G F +
Sbjct: 80  IAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHGLGEVTVRFPVVGAFAN 139

Query: 122 YASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIV 181
           Y++R++DP++ F V   Y+ ++F V P ++ A A+ M++W +   V+P VW+ +F  LI+
Sbjct: 140 YSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTT--SVDPVVWVAVFYTLII 197

Query: 182 LINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPY 241
            IN  GVR+FG+ +F  S +K                   P H+  G RYW DPGA    
Sbjct: 198 SINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEFIGARYWHDPGALA-- 255

Query: 242 SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFY 301
               +G KG                 G+E+  + + E  +P+  +P AIK   +RI+ F+
Sbjct: 256 ----NGFKG----VAAVMVTASYSLGGSEMTCLASGET-DPKE-IPHAIKQIFWRIIFFF 305

Query: 302 VISILLLGMTVAY-NDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFS 360
           ++S+ L+G  V Y ND LL             PFV+AIK   I VLPHI N  +L+ + S
Sbjct: 306 LVSLTLVGFLVPYTNDQLL-----GGSNVNNSPFVIAIKMHNIRVLPHIINGVILVSILS 360

Query: 361 ACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQI 420
             NS ++ +SRTL  +A     P+IF   +  G P   +  + LF LLA++  SS +  +
Sbjct: 361 VGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLAFLVKSSSTGTV 420

Query: 421 FNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCL 480
           F + + V  +   + W+SI ++++RF  A+ AQ        + +    W +  S     +
Sbjct: 421 FTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGMWGSVYSGVMNVV 480

Query: 481 IGLIKNYTVFLGHTFDYK-------TFISGYIGIPVYAICYVGYKLVHRS------KLIK 527
           + L+  + V L     +K        F   Y+   +    +V +K+ +RS      K++ 
Sbjct: 481 V-LVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYYRSTTGQWWKILP 539

Query: 528 PEDVDLYTFKAAID 541
             ++DL + +  ID
Sbjct: 540 LAEIDLESGRKNID 553

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  207 bits (527), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 137/501 (27%), Positives = 228/501 (45%), Gaps = 19/501 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            LKK+++ RH  M                       P  ++I Y+ +G  VY ++   GE
Sbjct: 144 NLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGE 203

Query: 110 MAAFIP--LDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           +A      + GF +Y S  VDPA+GF+V + +  ++  V P +L   +M ++YW    KV
Sbjct: 204 LAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTV--KV 261

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           N  V++ IF VLI++IN  G + + E +F+ +  K                         
Sbjct: 262 NADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYI 321

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G RYWRDPGAF+    +I   KG               +  +E   + A+E  NPR+++P
Sbjct: 322 GSRYWRDPGAFRG-DTSIQRFKG----VVATFVTAAFAFGMSEQLAMTASEQSNPRKAIP 376

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K  +YRI+  ++ S+ L+G  V Y    L+            P+V+A+ + G+ V+P
Sbjct: 377 SAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKAS--PYVIAVSSHGVRVVP 434

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           H  NA +LL V S  NS  Y +SR L  LA    APK F   +  G P  ++ VS +F +
Sbjct: 435 HFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGV 494

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           +A+   S     +F + + +  +  L +WI+I ++++RF K +  Q        Y +   
Sbjct: 495 IAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVG 554

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFLG-----HTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            W +  ++    L  LI  + V +           ++F   Y+ +P+    Y+ YK+  R
Sbjct: 555 VWGSAYAVVLMVL-ALIGQFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKVWKR 613

Query: 523 --SKLIKPEDVDLYTFKAAID 541
             S  I  + +DL + +   D
Sbjct: 614 DWSLFIPADKIDLVSHRNIFD 634

>KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} similar
           to uniprot|Q03770 Saccharomyces cerevisiae YDR160W SSY1
           Component of the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p) which senses external amino
           acid concentration and transmits intracellular signals
           that result in regulation of expression of amino acid
           permease genes
          Length = 832

 Score =  209 bits (533), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 151/559 (27%), Positives = 249/559 (44%), Gaps = 61/559 (10%)

Query: 42  VDGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVY 101
           + G H  ++ K  LEARH+ M                       P   L+ Y   G +V 
Sbjct: 250 LKGSHHSVQRK--LEARHIQMIASGSSLGVGLFLTSGKAFTIAGPFGALLGYVLCGSIVM 307

Query: 102 TVMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQY 160
                  E+ A IPL  GF+  ASR+V+ A GFA+G+ Y F + I  P+Q+ A  M++ Y
Sbjct: 308 ASTLSFTELCALIPLTSGFSGLASRFVEDAFGFALGWLYWFSFIIAVPSQVVASTMLLNY 367

Query: 161 WVSREKVNPGV--WITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXX 218
           + S    +  +  ++T+FLV  + IN   VR FG F ++++ +K                
Sbjct: 368 YQSLNLSSGKIAGFVTLFLVFAIFINLCDVRIFGNFVYFVTIIKIIFTIVMIFVMIVLNS 427

Query: 219 XXXP-NHDRTGFRYWRDP--------GAFKPY-------SE---AISGSKGKXXXXXXXX 259
                 HDR GFR+W           G F+P        SE    ISG+KG+        
Sbjct: 428 GGAALGHDRVGFRFWDAGKSAPGLFYGLFRPTFNLKDEGSEIISGISGAKGRLLAIFLSM 487

Query: 260 XXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLL 319
                 Y+G E+  + + E +NP++++P A+K TLY ++L Y ISI ++G+ +   DP L
Sbjct: 488 LIAAFTYSGIEMTFVASCEVRNPKKALPSAMKKTLYIMLLIYTISIFVVGLNIYSGDPRL 547

Query: 320 ---------------------------------IXXXXXXXXXXXXPFVVAIKNAGIPVL 346
                                            +             +V+A+++ G    
Sbjct: 548 PRFYTYSQDSSNYNIMHNIGMNWQVSTHCQSTLLSSGSLLSDGNRSAWVIALRSFGRCTF 607

Query: 347 PHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC 406
             + N  ++ +  ++  S LY AS TLY +AI  KAP+I      +GVP+ ++ VS +F 
Sbjct: 608 ASVLNGILIFYGATSGCSSLYGASHTLYSMAIQGKAPRICKACTSYGVPWIAVLVSGIFG 667

Query: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQ----FGDKSGFSY 462
           +++YM V   S   F    N+ S    + W  + +++LRF  A+  +      D   F Y
Sbjct: 668 VISYMAVDQSSLNNFQILANISSATICIIWAGMNVSFLRFFYALKIRPDIMSRDDPMFPY 727

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            +PFQP+ ++  LF   ++     +T F    ++ K F S Y G+  + + Y+GYKL   
Sbjct: 728 RSPFQPYLSYYGLFGSLVMIFFAGFTSFFHGFWNIKIFFSCYGGLVFFIVLYIGYKLFGT 787

Query: 523 SKLIKPEDVDLYTFKAAID 541
           SKL + + +D+   +  +D
Sbjct: 788 SKLQRLDQIDMDIGRIELD 806

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  206 bits (523), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 145/499 (29%), Positives = 231/499 (46%), Gaps = 16/499 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           +LK+ + +RH+ M                       PA + I Y+ +G  +Y ++   GE
Sbjct: 78  KLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQAAGE 137

Query: 110 MA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA ++  L G F +Y S  +DPALGF+V + Y  ++  V P +L    + ++YW +   V
Sbjct: 138 MAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYWTT--AV 195

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           NP V++ IF VL VL+N  G R + E EF+ ++ K                    N    
Sbjct: 196 NPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYL 255

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YW DPGA    ++ I   KG               +  TE   + AAE  NPRR++P
Sbjct: 256 GGKYWHDPGALYG-TKPIHHFKG----IIATMVTAAFAFGATEFIALTAAEQANPRRAIP 310

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K  +YR++L ++  I+LLG  V YN   L+            P+V+AI + G+ V+P
Sbjct: 311 SAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHAS--PYVIAIASHGVKVVP 368

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           H  NA +LL V S  NS  Y +SR L  L+    AP      +  G P  ++ VS +F L
Sbjct: 369 HFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCIFGL 428

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           +A++  S     +F + + +  +  L +WI I ++++RF KA++ Q        Y +   
Sbjct: 429 IAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGYKSQTG 488

Query: 468 PWSTWVS--LFFCCLIGLIKNYTVFLG-HTFDYKTFISGYIGIPVYAICYVGYKLVHRS- 523
              ++ +  +  C L G        +G    D   F   Y+ +P+    Y GY++  R  
Sbjct: 489 VVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYRVWKRDW 548

Query: 524 KLIKP-EDVDLYTFKAAID 541
           KL  P E +DL + +   D
Sbjct: 549 KLYIPLEQIDLVSHRKVFD 567

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  204 bits (520), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 151/490 (30%), Positives = 222/490 (45%), Gaps = 29/490 (5%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           +K+AL+ RH+S+                       P S+L+ +  +G++ + VM  +GEM
Sbjct: 44  VKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEM 103

Query: 111 AAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
               P   GF++ + R+   AL    GY Y+  +F V  N+    + ++Q+W       P
Sbjct: 104 ITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFW------GP 157

Query: 170 GV----WITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHD 225
            V    +I IF V   +   +GV  FGEFE+WL+  K                    N  
Sbjct: 158 QVPLYGYILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRP 217

Query: 226 RTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRS 285
             GF YW +PGA         G KG               Y+GTE   + A E++NP ++
Sbjct: 218 AFGFHYWNNPGALA------DGFKG----IAVVFVFCSSFYSGTESVALAATESRNPGKA 267

Query: 286 VPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPV 345
           VP AIK T +RI++ Y+   +  G TV YND  L             P  +AI  AG   
Sbjct: 268 VPIAIKQTFWRIIIVYLGIAVFYGATVPYNDTSL----GAHTKALKSPIAIAITRAGWEG 323

Query: 346 LPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLF 405
             H+ NA +L+   SA N  LY+ SRTL  LA +  APK    T+  GVP  ++ +    
Sbjct: 324 GVHLVNAFILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNAL 383

Query: 406 CLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAP 465
            L++ MNVS G++  ++Y VN+  +   + W  I +T+LRF KA   Q    S   Y + 
Sbjct: 384 GLVSLMNVSVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYKSL 443

Query: 466 FQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS-- 523
             PW    SL     +GLI+ +T F+   F  K F+  YI +P   I Y+   LV     
Sbjct: 444 LFPWGPIFSLAANIFLGLIQGWTTFV--PFSAKDFVDAYILLPAAVILYIVISLVKIGGF 501

Query: 524 KLIKPEDVDL 533
           KL+    VDL
Sbjct: 502 KLVDLRTVDL 511

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  207 bits (526), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 136/508 (26%), Positives = 231/508 (45%), Gaps = 19/508 (3%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           + + +   LKK+++ RH  M                       P  ++I Y+ +G  VY 
Sbjct: 137 EQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYC 196

Query: 103 VMACLGEMAAFIP--LDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQY 160
           ++   GE+A      + GF +Y    VDPALGF+V + +  ++  V P +L   +M ++Y
Sbjct: 197 IIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKY 256

Query: 161 WVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXX 220
           W    KV+P V++ IF VLI++IN  G + + E +F+ +  K                  
Sbjct: 257 WTV--KVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGG 314

Query: 221 XPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAK 280
                  G +YWRDPGAF+     I   KG               +  +E   + A+E  
Sbjct: 315 AGTDGYIGSKYWRDPGAFRG-DTPIQRFKG----IVATFVTAAFAFGMSEQLAMTASEQS 369

Query: 281 NPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKN 340
           NPR+++P A K  +YRI+  ++ S+ L+G  V Y    L+            P+V+A+ +
Sbjct: 370 NPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKAS--PYVIAVSS 427

Query: 341 AGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLA 400
            G+ V+PH  NA +LL V S  NS  Y +SR L  LA    APK F   +  G P  ++ 
Sbjct: 428 HGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAML 487

Query: 401 VSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGF 460
           VS LF ++A+   S     +F + + +  +  L +WI+I ++++RF +A+  Q       
Sbjct: 488 VSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEV 547

Query: 461 SYTAPFQPWSTWVSLFFCCLIGLIKNYTVFL-----GHTFDYKTFISGYIGIPVYAICYV 515
            Y +    W +  ++    ++ LI  + V +     G     ++F   Y+ +P+    Y+
Sbjct: 548 GYKSQVGVWGSAYAVLM-MMLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPILIALYI 606

Query: 516 GYKLVHR--SKLIKPEDVDLYTFKAAID 541
            +K+     S  I    VDL + +   D
Sbjct: 607 FFKVWKNDWSLFIPANKVDLVSHRNIFD 634

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  204 bits (520), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 145/486 (29%), Positives = 224/486 (46%), Gaps = 21/486 (4%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           +K+AL+ RH+S+                       P ++L+ +S +G++ + VM  +GE+
Sbjct: 49  VKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGVIAFAVMESIGEI 108

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
               P  G FT+ A R+   AL    GY Y+  +F V  N+    + ++Q+W    +V  
Sbjct: 109 ITLYPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVLANEYNTLSSILQFW--GPQVPL 166

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
             +I IF     +   +GV  FGE E+WLS  K                    +    GF
Sbjct: 167 YGYILIFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFSIIYISGGIKDRPAFGF 226

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
            YW  PG+         G KG               Y+GTE   + A E+KNP ++VP A
Sbjct: 227 HYWNSPGSLS------HGFKG----IAVVFVFCSTFYSGTECVALAATESKNPGKAVPLA 276

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
           ++ TL+R+++ Y+   +  G TV ++DP L             P  +AI  AG     H+
Sbjct: 277 VRQTLWRVLIVYIGIAVFYGATVPFDDPNL----SATTKVLKSPISIAISRAGWAGGAHL 332

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            NA +L+   SA N  LY+ SRTL  LA +  APKI A T+  GVP  ++ V     L++
Sbjct: 333 VNAFILVTCISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPIPAITVFNALGLIS 392

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
            MNVS G++  ++Y VN+  +   + W  I  T+LR  KA + Q        Y A   PW
Sbjct: 393 LMNVSVGASDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRSLEELPYKALLYPW 452

Query: 470 STWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLV--HRSKLIK 527
           +   SL     + LI+ +T F+   FD   F+  YI +PV  + YV   +   H  +++ 
Sbjct: 453 TPIFSLIANVFLALIQGWTSFV--PFDAGNFVDAYILLPVAIVLYVAICVFKNHHFRIVD 510

Query: 528 PEDVDL 533
            + VDL
Sbjct: 511 LKSVDL 516

>YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}
           MMP1High-affinity S-methylmethionine permease, required
           for utilization of S-methylmethionine as a sulfur
           source; has similarity to S-adenosylmethionine permease
           Sam3p
          Length = 583

 Score =  205 bits (521), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 155/540 (28%), Positives = 243/540 (45%), Gaps = 54/540 (10%)

Query: 9   NAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVSMXXXXXX 68
             G+LYS  + EE + +D   +                     KK L+ RH++M      
Sbjct: 46  QEGLLYSELSEEEKIQWDLANQPY-------------------KKVLDQRHLTMIAIGGT 86

Query: 69  XXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDG-FTSYASRYV 127
                            PAS+LI +  VG  +  V+ C  E++   P+ G +  +ASR++
Sbjct: 87  LGTGLFIGLGESLASG-PASLLIGFLLVGASMLCVVQCGAELSCQYPVSGSYALHASRFI 145

Query: 128 DPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVG 187
           DP++GF++G  YL  + I  P++L   ++ + YW     VNP  W+ I  VL +L+N  G
Sbjct: 146 DPSVGFSIGINYLLMWLISYPSELVGCSLTISYWA--PSVNPAAWVAIAFVLSMLLNLFG 203

Query: 188 VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF---RYWRDPGAFK-PYSE 243
            R F E EF++S  K                   P  D TG+   +YW DPG+F  P  +
Sbjct: 204 ARGFAESEFYMSIFKIVALFIFIIIGIVLIAGGGP--DSTGYIGTKYWHDPGSFAVPVFK 261

Query: 244 AISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVI 303
            +  +                 ++GTE+  + + EA++   SV RA K T +RI++FY++
Sbjct: 262 NLCNT----------FVSAAYSFSGTEMVVLTSTEARSVS-SVSRAAKGTFWRIIIFYIV 310

Query: 304 SILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGI--PVLPHIFNACVLLFVFSA 361
           +++++G  V YNDP LI            PFV+A+ N G     + H  NA +L+ VFS 
Sbjct: 311 TVIIIGCLVPYNDPRLISGSSSEDITAS-PFVIALSNTGAMGTRVSHFMNAVILIAVFSV 369

Query: 362 CNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIF 421
           CNS +Y +SR + GLA   + PKI A  +  G P   +A+   F LL ++ VS     +F
Sbjct: 370 CNSCVYASSRLIQGLATAGQLPKICAYMDRNGRPLVGMAICGAFGLLGFLVVSKNQGTVF 429

Query: 422 NYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCL- 480
            +   + SI    +W  I    +RF  A+ AQ   K    Y +       +  +F C L 
Sbjct: 430 TWLFALCSISFFTTWFCICFCQVRFRMAMKAQGRSKDDIIYRSTL---GIYGGIFGCILN 486

Query: 481 ----IGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKL---IKPEDVDL 533
               IG I      +G       F    + IP+    Y+G+++  R      IK  D+DL
Sbjct: 487 VLLVIGEIYVSAAPVGSPSSAANFFEYCMSIPIMIAVYIGHRIYRRDWRHWYIKRMDIDL 546

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  205 bits (522), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 134/501 (26%), Positives = 237/501 (47%), Gaps = 18/501 (3%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           L + L+ RH+ M                       PA +LI +     ++  +   LGE+
Sbjct: 83  LSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGEL 142

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           A   P+ G + +YA+R++D + GFA  + Y+ +  +V P ++ A ++ + YW +  K   
Sbjct: 143 AVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKL 202

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
             ++ +F V+IV IN  GVR FGE E   S +K                   P+H+  G 
Sbjct: 203 A-FVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGG 261

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
           +YW DPG F       +    K              + G+EL G+ AAE + PR+S+P+A
Sbjct: 262 KYWNDPGPF-----VGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPKA 316

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
            K   +RI LFY++S+L++G+ V  N+  L+            PFV+A+    I VLP I
Sbjct: 317 AKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHS--PFVIAMDMHRIRVLPSI 374

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            N  +L  V S  NS +Y +SRT+  LA     PKIF   +  G P +++  + LF LL 
Sbjct: 375 INVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLC 434

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
           ++  +    +IF++ + +  +    +W++I + ++RF  A+ AQ    +  S+T+P    
Sbjct: 435 FVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTSPTGFI 494

Query: 470 STWVSLFFCCLIGLIKNYTVFLGHTFDYKT-------FISGYIGIPVYAICYVGYKLVHR 522
            +  ++   C++ + + +      + D  +       F   Y+   V  + Y+ +K+  R
Sbjct: 495 GSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQYLSFAVAIVMYLAHKIWSR 554

Query: 523 SK--LIKPEDVDLYTFKAAID 541
           +    IK +++D+ T +  +D
Sbjct: 555 NWKFFIKAKEMDIDTGRRELD 575

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  205 bits (522), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 151/506 (29%), Positives = 242/506 (47%), Gaps = 20/506 (3%)

Query: 45  KHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVM 104
           KH+   LK+ ++ RHV M                       PAS+LI Y+ V  ++Y V+
Sbjct: 83  KHK--TLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVI 140

Query: 105 ACLGEMAA-FIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
               E+A  +  L G F +Y +  VD A  F+V + Y  ++  + P +L   +M ++YW 
Sbjct: 141 QSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYW- 199

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
             + +NP  ++ IF V++++IN +G   + E EF+ ++ K                    
Sbjct: 200 -NDSINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAG 258

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
           N    G  YW DPGAF+  +  I+  KG               Y G E   + AAE +NP
Sbjct: 259 NDGYLGSVYWHDPGAFRG-NNGINRFKG----LVAVLVNAAFAYGGAEFSVLTAAEQQNP 313

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           ++S+  A K  +YRI+  Y+++  LLG  V YN P L+            PFV+AI + G
Sbjct: 314 QKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHAS--PFVIAIASHG 371

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
           + V+PHI NA +LL V S  NS LY +SR L  L+    APK+F   +  G P   L VS
Sbjct: 372 VKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVS 431

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
            +F LL ++  S     +F + + +  +  L +W SI ++++RF +++I Q        Y
Sbjct: 432 CVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGY 491

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFL----GHTFDYKTFISGYIGIPVYAICYVGYK 518
            +    W  + ++    LI LI  + V +     +  D   F   Y+ +P+    Y+GYK
Sbjct: 492 QSWTGVWGAYYAMIMILLI-LIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYK 550

Query: 519 LVHRS-KLIKP-EDVDLYTFKAAIDA 542
           L +R  ++I P  +VDL + +   DA
Sbjct: 551 LWYRDWRVIIPANEVDLVSHRKIFDA 576

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  206 bits (524), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 135/462 (29%), Positives = 229/462 (49%), Gaps = 14/462 (3%)

Query: 86  PASILISYSFVGLLVYTVMACLGEMAAFIPL-DGFTSYASRYVDPALGFAVGYCYLFKYF 144
           PAS++I +  V   ++TV+  LGE+AA  P+  GF+ Y  ++VDP+  FAV   YL ++ 
Sbjct: 176 PASLVIGWVIVSTALFTVINSLGELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWL 235

Query: 145 IVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXX 204
           ++ P +L A ++ ++YW S   +N   W++IF V I L N + V+ FGE EF LS VK  
Sbjct: 236 VLLPLELVAASITIRYWNS--SINSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKIL 293

Query: 205 XXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXX 264
                            P+H+  G +YW DPGAF   +   SGSK K             
Sbjct: 294 AIIGFFILGIVLDCGGGPSHEYIGGKYWHDPGAFVGTT---SGSKFKGLCSVFVTAAFS- 349

Query: 265 XYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXX 324
            ++G E+  + AAE++NPR ++P+A K T + I   YV  + L+G  V YNDP L+    
Sbjct: 350 -FSGIEMTAVSAAESRNPRETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSS 408

Query: 325 XXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPK 384
                   P V+AI+N  I  LP + NA +L+ + S  NS +Y  SR +  ++     PK
Sbjct: 409 SVDAASS-PLVIAIENGHIHGLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPK 467

Query: 385 IFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYL 444
           +FAK +  G P  ++   + F LL+++  S   A++F +   +  +  +  W+ I + ++
Sbjct: 468 VFAKVDRRGRPIPAICFVLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHI 527

Query: 445 RFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFL---GHTFDYKTFI 501
           RF + +  Q        + +    W +   +    L+ +   +T          +  +F 
Sbjct: 528 RFRQGMHVQQISLDELPFLSQTGIWGSIYGIVILFLVLVASFWTSLFPVGSSKANATSFF 587

Query: 502 SGYIGIPVYAICYVGYKLVHRSKL--IKPEDVDLYTFKAAID 541
            GY+  P+   CY+ +K+  ++    I    +DL++ +  +D
Sbjct: 588 EGYLSFPILLGCYIAHKVYFKNWRWYIPASKMDLHSGRKQVD 629

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  205 bits (521), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 141/507 (27%), Positives = 234/507 (46%), Gaps = 23/507 (4%)

Query: 46  HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMA 105
            +G  LK+ ++ RHV M                       PA + I Y+ +G  +Y+++ 
Sbjct: 97  EKGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQ 156

Query: 106 CLGEMAAFIP-LDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVS 163
             GE+A   P L G F +Y S  VDPA+ FA    Y  ++  V P ++ + A+ ++YW  
Sbjct: 157 AAGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYW-- 214

Query: 164 REKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPN 223
              +NP VW  IF V+I+ IN  G   + E +F+ ++ K                    +
Sbjct: 215 NTSINPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGD 274

Query: 224 HDRTGFRYWRDPGAFKPYSEAISGSKG--KXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
               G +YW DPGAF       +G  G  +              +  +E   + A+E  N
Sbjct: 275 SVYIGGKYWNDPGAF-------NGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQAN 327

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           PR+++P A K  LYRI+  Y+ SI+L+G  V YN P L+            P+V+A+ + 
Sbjct: 328 PRKAIPSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSS--PYVIAVASH 385

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
           G+ V+P   NA +L+ V S  N   Y +SR L  L+    APK F   +  G P Y++ V
Sbjct: 386 GVKVVPSFINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIV 445

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
             L   + +++ SS    +F + + V  +  L +W +I I+++RF KA+  Q        
Sbjct: 446 GALVGCICFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELG 505

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFL---GHT--FDYKTFISGYIGIPVYAICYVG 516
           + +    W ++  +F   L+  I  + V L   G T   D + F + Y+ +PV+   Y G
Sbjct: 506 FRSQVGVWGSYYGIFMMILV-FIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFG 564

Query: 517 YKLVHRS-KLIKP-EDVDLYTFKAAID 541
           +K+  +  +L  P  ++DL + +   D
Sbjct: 565 FKIWKKDWRLYIPASEIDLISHRKIFD 591

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  205 bits (521), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 139/499 (27%), Positives = 230/499 (46%), Gaps = 16/499 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           +LKK +++RHV M                       PA ++I Y+ +G  +Y ++   GE
Sbjct: 95  KLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAAGE 154

Query: 110 MA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           +A  +  L G F +Y S  +DPALGF+V + Y  ++  V P +L   ++ ++YW +   V
Sbjct: 155 LAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTT--SV 212

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           NP +++ IF VL + IN  G R + E EF+ ++ K                    N    
Sbjct: 213 NPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYI 272

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YW DPG+F    + I   KG               +  TE   + AAE  NPR+S+P
Sbjct: 273 GGKYWNDPGSFSG-DKPIDHFKG----VVSTLVTAAFAFGATEFIALTAAEQANPRKSIP 327

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K  LYRI++ ++ SI L+G  V +N   L+            P+V+AI + G+ V+P
Sbjct: 328 SAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHAS--PYVIAIASHGVKVVP 385

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           H  NA +LL V S  NS  Y +SR L  LA    AP      +  G P  ++ +S +F L
Sbjct: 386 HFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIISAVFGL 445

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           ++++  S     +F + + +  +  L +W +I ++++RF +A+  Q        + +   
Sbjct: 446 ISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVG 505

Query: 468 PWSTW--VSLFFCCLIGLIKNYTVFLGH-TFDYKTFISGYIGIPVYAICYVGYKLVHR-- 522
            W ++    +    LIG        +G    D + F   Y+ +P+    Y GYK+  R  
Sbjct: 506 VWGSYYATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDW 565

Query: 523 SKLIKPEDVDLYTFKAAID 541
           +  I    +DL + +   D
Sbjct: 566 TLYIPASKIDLISNRRIFD 584

>SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]
           {ON} similar to uniprot|Q03770 Saccharomyces cerevisiae
           YDR160W SSY1 Component of the SPS plasma membrane amino
           acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
           external amino acid concentration and transmits
           intracellular signals that result in regulation of
           expression of amino acid permease genes
          Length = 850

 Score =  208 bits (530), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 150/561 (26%), Positives = 250/561 (44%), Gaps = 70/561 (12%)

Query: 44  GKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTV 103
           G ++   +++ L  RH+ M                       P   L+ +     +V   
Sbjct: 271 GHNDVYHVQRKLHVRHLQMIAIGASLGVGLFLTSGKAFTVAGPFGTLLGFLLCASIVLAT 330

Query: 104 MACLGEMAAFIPLD-GFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
           M    E++  IP+  GF+  ASR+V+ A GFA+G+ Y F + I  PNQ+ A   ++ Y+ 
Sbjct: 331 MLSFTEISTLIPISSGFSGLASRFVEDAFGFALGWSYWFSFVIALPNQIVASTFMLSYY- 389

Query: 163 SREKVN-----PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXX 217
             E +N        ++T+FL+  + IN + VR  GE  +  +  K               
Sbjct: 390 --EHLNVPSGSTAGFVTLFLLFAIFINLLDVRILGEILYGSTFFKILITVMMMIAMIALN 447

Query: 218 XXXXPN-HDRTGFRYW---RDP-----GAFKPY----------SEAISGSKGKXXXXXXX 258
                + H R GFRYW   + P     G F+P            + I GSKG+       
Sbjct: 448 AGAGAHRHSRVGFRYWDSSKSPEGLTYGLFRPTFDLGDKGSGSLDGIGGSKGRFLAVLVV 507

Query: 259 XXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPL 318
                  ++G EL  + + EA NPR+++P A K T   I++ Y+ SI L+G+ +   DP 
Sbjct: 508 MLISSFAFSGVELAFVASGEAVNPRKTLPSATKRTFIIIIILYLFSIFLVGLNIYSGDPR 567

Query: 319 L------------------------------IXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           L                              +            P+V+A+++ G+     
Sbjct: 568 LLRYYASPGKDVTIDDYGTKWQIETSCNKNLVVNLDGAINGSQSPWVLALQSFGLCTFSS 627

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC-- 406
           + N  ++ F  SA  S LY +SRTLY ++I  KAP++F + +  G+PY    VSVLFC  
Sbjct: 628 VLNGILIFFGPSAGCSSLYASSRTLYSMSIQGKAPELFRRCSKKGIPY----VSVLFCGA 683

Query: 407 --LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQ----FGDKSGF 460
             + +Y++VS  S + F    N+ S    + W+ + I++LRF+ A+  +      D   F
Sbjct: 684 FGVTSYLSVSKESVENFQALANISSASICIIWMGLNISFLRFYYALKKRPDIISRDDPSF 743

Query: 461 SYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLV 520
            Y +PFQP+  +  L    ++ L   +T FL   ++ K F S Y G+  + +CY+GYK  
Sbjct: 744 PYRSPFQPYLAFYGLLGSTILVLFMGFTTFLPGLWNTKVFFSAYGGLMFFTVCYLGYKTF 803

Query: 521 HRSKLIKPEDVDLYTFKAAID 541
             SK+ + + +D+ + +  ID
Sbjct: 804 GTSKIQRLDQLDMDSGRREID 824

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  204 bits (518), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 140/501 (27%), Positives = 231/501 (46%), Gaps = 19/501 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
           +L+K ++ RHV M                       PA +LI Y  +   +Y ++   GE
Sbjct: 79  QLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACGE 138

Query: 110 MAA--FIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA      + GF +Y S  VD A  FAV + Y  ++  V P +L   +M ++YW   EKV
Sbjct: 139 MAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEKV 196

Query: 168 NPGVWITIFLVLIVLINTVG-VRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR 226
           +P V++TIF +LI+ IN  G  R + E EF+ +  K                        
Sbjct: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGY 256

Query: 227 TGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSV 286
            G  YW +PGAF+ ++    G++ K              +  TE   I A+E  NPR+++
Sbjct: 257 IGVSYWNNPGAFRGHTP---GTRFKGIVSTLVTAAFS--FGQTEFLAITASEQSNPRKAI 311

Query: 287 PRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVL 346
           P A K  +YR +  YV SI+++G  V YN P L+            P+V+A+ + GI + 
Sbjct: 312 PSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKAS--PYVIAVASHGIRIA 369

Query: 347 PHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC 406
           PH  NA +L+ V S  NS  Y +SR L  LA    APKIF   +  G P + +  + L  
Sbjct: 370 PHFINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLA 429

Query: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF 466
            +A+   S    ++F++ + +  +  + +W +I ++++RF +A+  Q    +   Y +  
Sbjct: 430 TIAFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQV 489

Query: 467 QPWSTWVSLFFCCLIGLIKNYTVFL----GHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
             W +  +     LI LI  + V L     +  +   F   Y+ +P+  + Y GYK   +
Sbjct: 490 GVWGSIYAATVMFLI-LIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKK 548

Query: 523 --SKLIKPEDVDLYTFKAAID 541
             +  I+ +D+DL + +   D
Sbjct: 549 DWNLFIRAKDIDLISHRHIYD 569

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  203 bits (516), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 140/493 (28%), Positives = 223/493 (45%), Gaps = 19/493 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            +KKA+++RHV M                       PA +++ Y  V  + Y ++   GE
Sbjct: 77  HMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAAGE 136

Query: 110 MAAFIPL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA   P     F +YAS +V    GFA  + +  ++  V P +L   +M ++YW   + +
Sbjct: 137 MAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYW--NDTI 194

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           NP V+I IF V ++ I+  GV+ +GE EF  +S K                         
Sbjct: 195 NPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGYI 254

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YW +PGAF   S A      +              Y GTEL  +   E KNPR+S P
Sbjct: 255 GNKYWINPGAFASESPA-----ARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTP 309

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K ++YRI++ Y+++++L+G  V ++   L+            P+V+A    G+ V+P
Sbjct: 310 AAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHAS--PYVLAASLHGVKVVP 367

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           H  NA +L+ V S  NS LY + R +  LA    APK F   +  G P  +L +  LF +
Sbjct: 368 HFINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFGV 427

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           + ++  S    Q F +   +  +  L +W SI I+++RF  A+  Q        Y A   
Sbjct: 428 IGFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRATTG 487

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFL-----GHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
            W +  S+FF  L+  I  + V L        +D + F   Y+  P++ + Y GY +  R
Sbjct: 488 IWGSVYSVFFNMLV-FIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGYMIYSR 546

Query: 523 S-KLIKPED-VDL 533
               + P D +DL
Sbjct: 547 DFTFLTPLDKIDL 559

>KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {ON}
           Anc_8.342 YDR160W
          Length = 834

 Score =  207 bits (526), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 143/558 (25%), Positives = 247/558 (44%), Gaps = 62/558 (11%)

Query: 45  KHEGI--RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +  G+   +++ L  RH+ M                       P   L+ +   G ++  
Sbjct: 251 RQNGVPYHIQRRLTVRHIQMLSVGPCLSVGLFLTSGRAFSIAGPFGTLLGFCLSGCVILA 310

Query: 103 VMACLGEMAAFIPLD-GFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
            +    E++  IP+  GF+  ASR+V+ A GFA+G+ Y F   I  P +  +    + Y+
Sbjct: 311 TLLSFTELSTLIPVSSGFSGLASRFVEDAFGFAIGWTYTFSCIIAFPAEAASSTFFLTYY 370

Query: 162 VSREKVNPGV---WITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXX 218
            S   +N  V   ++T+FL   ++ N + V + GE  F+  +VK                
Sbjct: 371 -SHPLLNKSVISGFVTLFLSFPIVSNLLQVNYLGEVVFFFGAVKLIVSILIILVMIILNA 429

Query: 219 XX-XPNHDRTGFRYWRDP--------GAFKPY----------SEAISGSKGKXXXXXXXX 259
                +H R GFR+W           G F+P              I GS G+        
Sbjct: 430 GHGHRDHHRVGFRFWDSSKSFDNLTYGLFRPTYDLRDEGTGSRNGIGGSTGRFLSVVSVM 489

Query: 260 XXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLL 319
                 Y+G E+  + + EA NPR+++P +IK T   I+L YV++IL +G+ +   DP L
Sbjct: 490 LISTFAYSGVEMTFLASGEAVNPRKTIPSSIKRTFSSILLIYVLAILTVGINIYSGDPRL 549

Query: 320 IXXXXXXXXXXX--------------------------------XPFVVAIKNAGIPVLP 347
           +                                            P+V+A+++ G+    
Sbjct: 550 LAYLSKPTSNRSEAARNGVGTQWQLDVSCNPRSHISGPLENGYSSPWVLALQSFGMCAFA 609

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
             FN  +++F  ++  S LY +SRTLY ++I RKAP IF   N +GVPY ++ V+  F +
Sbjct: 610 SAFNGLLIVFTATSAISSLYNSSRTLYAMSIQRKAPYIFQLCNRYGVPYVAVLVASSFGV 669

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFG----DKSGFSYT 463
           +AY+ V+  S   F+   N+ S    + W  + +++LRF+ A+  +      D   + + 
Sbjct: 670 IAYIAVNEQSQNNFSILTNMSSASTSIIWFGMNLSFLRFYYALNRRTDSLSRDDEAYPFR 729

Query: 464 APFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
           +PFQP+  +  LF C +  L   Y  FL H +  + F S Y G+ +  +CY+GYK+   S
Sbjct: 730 SPFQPYLAFFGLFGCFIFVLFMGYPNFLTHFWSARGFFSAYGGLLICGVCYLGYKIFCTS 789

Query: 524 KLIKPEDVDLYTFKAAID 541
           K+ + + +D+ T +  +D
Sbjct: 790 KIQRLDQLDMDTGRRELD 807

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  203 bits (516), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 136/500 (27%), Positives = 224/500 (44%), Gaps = 22/500 (4%)

Query: 46  HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMA 105
            E   L+K++++RH+ M                       PA +++ Y    +++Y ++ 
Sbjct: 85  QEKNNLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQ 144

Query: 106 CLGEMA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVS 163
             GE+   +  L G +T Y+S  VDP+LGFAV   Y  ++  V P QL   AM ++YW +
Sbjct: 145 AAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTN 204

Query: 164 REKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPN 223
              VN  +++ +  + +++IN  G R + E EF  +  K                    +
Sbjct: 205 ---VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGD 261

Query: 224 HDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPR 283
               G  YW +PG F        G KG               Y G E+  + AAE +NP 
Sbjct: 262 RRYIGTEYWHNPGPFA------HGFKG----VCTVFCYAAFSYGGIEVLLLSAAEQENPT 311

Query: 284 RSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGI 343
            S+P A K  +YRI+L Y+++ +L+G  V YN   L+            PFV+A+ + G+
Sbjct: 312 ESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHAS-PFVIAVSSHGV 370

Query: 344 PVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSV 403
            V+PH  NA +L+ V S  NS LY   R L  LA     PK  A  +  G P     VS+
Sbjct: 371 KVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSL 430

Query: 404 LFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYT 463
            F  + ++  S+   Q+F + + + S+  L  W+S+ ++++RF  A+  Q        Y 
Sbjct: 431 AFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYK 490

Query: 464 APFQPWSTW----VSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKL 519
           A    W +W    +++FF      +    V      D K F   Y+ +P+  + Y G+K+
Sbjct: 491 AQTGYWGSWIAVLIAVFFLVCQFWVAIAPVSEHGKLDVKVFFQNYLAMPIVLLAYFGHKM 550

Query: 520 VHRSKL--IKPEDVDLYTFK 537
             +S    I  E +DL + +
Sbjct: 551 YFKSWRFWIPAEKIDLDSHR 570

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  203 bits (516), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 145/500 (29%), Positives = 229/500 (45%), Gaps = 18/500 (3%)

Query: 43  DGK-HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVY 101
           DG+  +GI LKK ++ RHV M                       PA ++I Y  V  + Y
Sbjct: 86  DGESKDGIHLKKQMKTRHVVMMSLGTGIGTGLLIANAKGLHFAGPAPLVIGYGMVSFVTY 145

Query: 102 TVMACLGEMAAFIPL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQ 159
            ++   GE+A   P     F SY    +    GFA  +    ++  V P +  A ++ ++
Sbjct: 146 FMIQAAGELAVAYPTLPGNFNSYFGILISKPFGFATVWLAAVQWLTVLPLEFIAASLTIK 205

Query: 160 YWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXX 219
           YW   ++++  V++ IF V ++ I+ VGVR +GE EF  +  K                 
Sbjct: 206 YW--NDRISGDVFVVIFYVFLLFIHFVGVRAYGETEFIFNLCKVLMIIGFIILSIVINAG 263

Query: 220 XXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEA 279
              N    G +YW DPGAF   +   +GS+ K              Y GTEL  +   E 
Sbjct: 264 GAGNDGYIGGKYWNDPGAF---AGETAGSRFKGVCYILVTGYFS--YGGTELFVLSVNEQ 318

Query: 280 KNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIK 339
           +NPR+S P+A K ++YRIV+ Y+++++L+G  V YNDP L+            P+V+A  
Sbjct: 319 ENPRKSTPQAAKHSIYRIVIIYLLTMILIGFNVPYNDPRLMGADDASGSHAS-PYVLAAS 377

Query: 340 NAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSL 399
             G+ ++PH  NA VL+ + S  NS LY A R +  LA    APKI A  +  G P  SL
Sbjct: 378 IHGVKIVPHFINAVVLIALISVGNSALYAAPRMMVSLAEQGFAPKIMAYVDREGRPLVSL 437

Query: 400 AVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSG 459
            +  LF L+ +   SS   Q+F +   +  +  L +W +  I+++RF  A+  Q  D   
Sbjct: 438 GICALFGLIGFAASSSKEEQVFTWLAAIAGLSELFTWSAFFISHIRFRWAMKLQGKDIKE 497

Query: 460 FSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYK----TFISGYIGIPVYAICYV 515
             + A    + ++  LFF  L+     + V L      K    +F   Y+  P++   Y 
Sbjct: 498 VGFLASTGLYGSFYGLFFNILV-FAAQFWVALSPIGSKKVGAESFFESYLAFPIWLFFYF 556

Query: 516 GYKLVHRS-KLIKP-EDVDL 533
           GY +  +    + P E +DL
Sbjct: 557 GYMVWAKDFTFLNPLESIDL 576

>SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {ON}
           similar to uniprot|P38090 Saccharomyces cerevisiae
           YBR132C AGP2 Plasma membrane carnitine transporter
           expression is down-regulated by osmotic stress also
           functions as a low-affinity amino acid permease
          Length = 558

 Score =  202 bits (513), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 137/493 (27%), Positives = 238/493 (48%), Gaps = 12/493 (2%)

Query: 52  KKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMA 111
            + L+ RHV +                       P  +L+ +S   + +  +     EM 
Sbjct: 45  HRKLQNRHVQLIGISGVIGTALFVSIGRALYHGGPVFLLLGFSLWCIPILCITVSTAEMV 104

Query: 112 AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPG 170
            ++P    F   ASR VD +L     + + F   +  P ++ A   ++ YW  R+  +  
Sbjct: 105 CYMPFSSPFLRIASRCVDNSLAIMASWNFWFLECVQIPFEIVAVNTMIHYW--RDDYSAA 162

Query: 171 VWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFR 230
           + + + +VL + I+   VR++GE EFWL+S K                   P HDR GFR
Sbjct: 163 IPLVVQVVLYLAISVFAVRYYGEMEFWLASFKIFLAIGLFFFTFITMLGGNPKHDRYGFR 222

Query: 231 YWRDPGAFKPY----SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSV 286
            ++D   FK Y     + +  S G                 G +   ++A E   PR+ +
Sbjct: 223 NFKDL-PFKEYFPNNDKTVGSSAGYFQGFLACLIQASFTIAGPDYVSMIAGETLLPRKVL 281

Query: 287 PRAIKLTLYRIVLFYVISILLLGMTVAYNDP-LLIXXXXXXXXXXXXPFVVAIKNAGIPV 345
           P A K    R+ + ++   L +G+  + NDP L              P+V+A+ N GI V
Sbjct: 282 PIAFKQVFVRLTVLFLGGCLCIGIVCSANDPNLTAAITEDRPGAGASPYVIAMNNLGIKV 341

Query: 346 LPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLF 405
           LP I NA ++   FSA N+  Y +SRTLYG+A+D  APK+F++ N  GVP +++AVS+L+
Sbjct: 342 LPDIVNAALITAAFSAGNAYTYCSSRTLYGMALDGYAPKVFSRCNRHGVPIFAVAVSLLW 401

Query: 406 CLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAP 465
            LL+ + +   SA + N+ VN+++   L+++  + + YL F +A +AQ  +     + + 
Sbjct: 402 ALLSLLQLGKNSAVVLNWLVNLITASQLINFGVLCVVYLFFRRAYMAQRDNLPELPFKSW 461

Query: 466 FQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLV---HR 522
           +QP+   + L    ++ +++ YTVF    ++Y++F+  Y+ I V    Y+G+K V    +
Sbjct: 462 WQPYPAIIGLVSVSVMTIVQGYTVFFKTLWNYESFLFSYLMIFVDIFIYLGHKFVINYGK 521

Query: 523 SKLIKPEDVDLYT 535
             + +P+DVDL T
Sbjct: 522 DPVKRPQDVDLIT 534

>AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL274W
           (SAM3)
          Length = 497

 Score =  199 bits (507), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 137/472 (29%), Positives = 219/472 (46%), Gaps = 43/472 (9%)

Query: 86  PASILISYSFVGLLVYTVMACLGEMAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYF 144
           P ++LI +  VG+ ++ V+    E++   P+ G F+S+ SR+++P+LGF V   Y   + 
Sbjct: 24  PGTLLIGFLIVGVSIFCVIQSAAELSCQYPVSGSFSSHVSRFIEPSLGFTVSCAYALSWL 83

Query: 145 IVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXX 204
           I  PN+L   AM + YW   E + P VW+ I  +L++ +N   VR F E EFWLS +K  
Sbjct: 84  ISFPNELVGLAMTIGYW--NEDIPPAVWVLIGYLLVIGLNLFAVRGFAESEFWLSIIKVL 141

Query: 205 XXXXXXXXXXXXXXXXXPNHDRT--GFRYWRDPGAFKP--YSEAISGSKGKXXXXXXXXX 260
                            PN+     G +YW DPGAF+P  +S                  
Sbjct: 142 AIIIFLIIGIVIICGGGPNNKEGYLGGKYWHDPGAFRPPFFSSLCQ-----------TFV 190

Query: 261 XXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLI 320
                + G EL  + A E++    S+ RA K T +RI +FY+ +++++G  V Y  P L 
Sbjct: 191 SAAFTFGGAELVLLTANESRKIE-SISRAAKGTFWRIAIFYISTVIVIGCLVPYTSPAL- 248

Query: 321 XXXXXXXXXXXXPFVVAIKNAGI--PVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAI 378
                       PFV+A+ N G     + H  NA ++  V S CNS +Y ASR +  L  
Sbjct: 249 ----DGESIRASPFVIALSNTGSFGTNVSHFMNAVIVAAVLSVCNSCVYAASRVIQSLGA 304

Query: 379 DRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWIS 438
             + P+IF   +  G P   + V  +F LLA++  ++    +FN+   + SI     W  
Sbjct: 305 CGQLPEIFGYIDKKGRPLVGIGVCAVFGLLAFLVETTKVKDVFNWLFALCSIAAFFVWFC 364

Query: 439 ILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTF--- 495
           I ++ LR+ +A+  Q       +Y +    WS         +IG + N+ +  G  +   
Sbjct: 365 ICVSQLRYRRALKVQGFPTEEIAYQSMLGKWSG--------VIGTLLNFLLICGEIYVSV 416

Query: 496 ---DYKTFISGYIGIPVYAICYVGYKLVHR---SKLIKPEDVDLYTFKAAID 541
              D +TF    + IP+  I Y  ++L  R   + LI   D+DL T +   D
Sbjct: 417 KDGDVETFFQNCMSIPLLIIFYFCHRLYRRDWKTWLIPARDLDLNTGRKPED 468

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  202 bits (515), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 144/508 (28%), Positives = 240/508 (47%), Gaps = 18/508 (3%)

Query: 42  VDGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVY 101
           ++GK +   LKK+++ RHV M                       PA + I Y+ +G  +Y
Sbjct: 116 LEGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIY 175

Query: 102 TVMACLGEMAAFIP--LDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQ 159
            ++   GEMA      + GF +Y S  V P LGFAV + Y  ++  V P +L   +M ++
Sbjct: 176 CIIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIK 235

Query: 160 YWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXX 219
           YW +  KVNP V++ IF  LI++IN  G R + E EF+ +  K                 
Sbjct: 236 YWTT--KVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCG 293

Query: 220 XXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEA 279
              N    G +YW DPGAF+   +AI   KG               + G+E   + A+E 
Sbjct: 294 GAGNDGYIGGKYWHDPGAFRG-DKAIDRFKG----VAATLVTAAFAFGGSEFIALTASEQ 348

Query: 280 KNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIK 339
            NPR+++P A K  LYRI++ ++ SI+++G  V +N   L+            P+V+AI 
Sbjct: 349 SNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKAS--PYVIAIS 406

Query: 340 NAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSL 399
           + G+ V+PH  NA +LL V S  NS  Y +SR L  L+    APK F   +  G P  ++
Sbjct: 407 SHGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAM 466

Query: 400 AVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSG 459
            +  LF ++A+   SS    +F + + +  +  + +W +I ++++RF +A+  Q      
Sbjct: 467 VIGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGE 526

Query: 460 FSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLG----HTFDYKTFISGYIGIPVYAICYV 515
             + +    W ++ +     L+ LI  + V L     +  D ++F   Y+ + +    YV
Sbjct: 527 IGFKSELGVWGSYYAAGMMFLV-LIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYV 585

Query: 516 GYKLVHR--SKLIKPEDVDLYTFKAAID 541
           GY    +  +  I+ +D+DL   +   D
Sbjct: 586 GYMFWKKDWTLFIRAKDIDLDHHRQIFD 613

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  200 bits (508), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 142/486 (29%), Positives = 223/486 (45%), Gaps = 21/486 (4%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           +K+AL+ RH+S+                       P ++L+ +S +G++ +T+M  +GEM
Sbjct: 51  VKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFTIMESIGEM 110

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
               P  G FT+ A R+   +L    GY Y+  +F V  N+    + + Q+W  +  +  
Sbjct: 111 ITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQFWGPQVPLYG 170

Query: 170 GVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGF 229
             +I IF          GV  FGE E+WLS  K                    +    GF
Sbjct: 171 --YILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKDRPAFGF 228

Query: 230 RYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRA 289
            YW +PGA         G KG               Y+GTE     A+E+KNP R++P A
Sbjct: 229 HYWNNPGALS------HGFKG----IAEVFVFCSTFYSGTESVAYSASESKNPNRAIPLA 278

Query: 290 IKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHI 349
           I+ T +RI++ Y+      G+TV YND  L             P  +AI  AG     H+
Sbjct: 279 IRQTFWRILVVYIGIGFFYGVTVPYNDHNL----NAGTKALKSPISIAITRAGWEGGTHL 334

Query: 350 FNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLA 409
            NA +L+   SA N  L++ SRT+  LA +  APK  A T+  GVP  ++ +     L++
Sbjct: 335 VNAFILVTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNALGLVS 394

Query: 410 YMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPW 469
            MNVS G++  ++Y VN+  +   + W +I +T+LRF KA I Q        Y A F P+
Sbjct: 395 LMNVSVGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKALFYPY 454

Query: 470 STWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLV--HRSKLIK 527
           +  + +     + LI+ +T F+   F    F+  Y+ +P  A+ Y+G  L+  H  K + 
Sbjct: 455 TQIIGIAANIFLALIQGWTSFV--PFKAGDFVDAYVLLPAAAVLYIGISLLKTHSFKTVD 512

Query: 528 PEDVDL 533
              +DL
Sbjct: 513 LLTIDL 518

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  200 bits (508), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 140/490 (28%), Positives = 224/490 (45%), Gaps = 21/490 (4%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           LK+ L  RH++M                       PAS+ ++YS  G +VY  M CLGEM
Sbjct: 68  LKRDLSPRHINMISIAGVIGTGLYLSTSKSLHVGGPASLFMNYSIFGGVVYLTMMCLGEM 127

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           + ++P+ G F SYA ++   +   A+ + Y F   +   + LTA  +V+ YW +++   P
Sbjct: 128 STYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWKTKDHHFP 187

Query: 170 GVWIT--IFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
             W    +F V ++L+N + VR +GE E+WL+ +K                   P H   
Sbjct: 188 -YWAASLLFWVFVLLLNVISVRLYGEAEYWLALLKVIAIIIFFILSIVVNVGHNPEHKYI 246

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           GF  W    A  P+   ++G KG               Y GTE   +   EA NP R+ P
Sbjct: 247 GFHNWNHGDA--PF---VNGFKG----FASLFVSASFAYGGTESITLTNGEATNPVRNTP 297

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
           + IK   +RI++FYV S   + M V Y+ P L             PF +  + AG     
Sbjct: 298 KVIKTVFWRILIFYVFSAFFIAMNVPYDYPGL-----ATKSVMTSPFTIVFQMAGSKGAG 352

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
              NA ++  V SACN  L+  SR +Y +++D   PK   KTN +  PY ++A++     
Sbjct: 353 SFMNAVIMTSVISACNHALFAGSRVMYNMSLDGYLPKWVTKTNRYKAPYVAVAITWAVGG 412

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           L +     G+  ++ +  N+V +   ++W+ I IT +RF + +  Q G      +     
Sbjct: 413 LCFGASFIGAGTVWIWLQNIVGVSNQIAWLCIAITSIRFRRGLELQ-GKTHELKFKNWTY 471

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIK 527
           PW  +  + F   + LI+ ++ F    +    F S Y+ + V+  CY+ + L  R K IK
Sbjct: 472 PWGPYFLVVFVSFVILIQGWSAF--DPWSTSNFFSVYLELFVFPACYLIWWLYKRDKFIK 529

Query: 528 PEDVDLYTFK 537
            ED+D  T K
Sbjct: 530 YEDMDFVTDK 539

>Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}
           similar to Ashbya gossypii ADL272W
          Length = 569

 Score =  199 bits (506), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 137/504 (27%), Positives = 232/504 (46%), Gaps = 23/504 (4%)

Query: 42  VDGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVY 101
           V GK E   L++++  RHV M                           LI Y  +G+++ 
Sbjct: 34  VQGKKE--VLRQSIRPRHVFMISMATGIGTGLLVGNGKSIACAGIGGTLIGYGIIGVMLV 91

Query: 102 TVMACLGEMAAFIPL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQ 159
             M  +GE+    P    GF SY  R++DP+LGF+V + +  ++ IV P +L  G+M ++
Sbjct: 92  CCMQSVGELVVAFPSLSGGFNSYGKRFIDPSLGFSVSWLFCLQWMIVLPLELVTGSMTIK 151

Query: 160 YWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXX 219
           YW     ++P +++++F  LI ++N+ G   + E EF  +S+K                 
Sbjct: 152 YW--NASLSPSLFVSVFYALICVVNSFGSGGYAEAEFIFNSLKVVVIIGFIILGVLIDTG 209

Query: 220 XXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEA 279
                   GFRY  DPG F      I  + G                 G E   + AAE 
Sbjct: 210 CVGTSGTIGFRYLIDPGMFNKNYNIIKATAGTLVNAAFSCG-------GVEFLALSAAEQ 262

Query: 280 K--NPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVA 337
              N  +S+ RA      RI +FY++SI ++G+ V +N P+L+            P+V A
Sbjct: 263 NRDNMPKSIGRACNQVSIRIFVFYLLSISVVGLLVPHNSPILMGSGSNMIHSS--PYVAA 320

Query: 338 IKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYY 397
           +   GI V+PHI NA +L+ V S  NS +Y +SRTL+ LA    APK F K N  G P  
Sbjct: 321 VAMNGITVVPHIINAVILIAVISVANSAMYSSSRTLHSLAEQNFAPKYFTKLNKHGQPMR 380

Query: 398 SLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDK 457
            L +S LF L++++        IF + +++  +  + +W +I I ++RF  A+ ++    
Sbjct: 381 CLFISALFGLISFVAEYRDQEAIFIWLLSISGLSTIFTWTTICIAHIRFRDAIKSRGQSL 440

Query: 458 SGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYK----TFISGYIGIPVYAIC 513
               Y +      ++++     +I +++ +        + K     F   Y+ +PV  + 
Sbjct: 441 ETLGYKSITGVAGSYIATVINLVILVVQFWVSLFPLESNGKPNIVQFFQNYMAVPVALLF 500

Query: 514 YVGYKLVHR--SKLIKPEDVDLYT 535
           Y+G+K+  +  S LI+  +VD+ T
Sbjct: 501 YIGHKVYTKNWSLLIRASNVDITT 524

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  198 bits (504), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 135/489 (27%), Positives = 227/489 (46%), Gaps = 22/489 (4%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           L++AL+ RH++M                       PAS+ ++Y+ +G +VY  + CLGEM
Sbjct: 54  LQRALKPRHINMISIAGVIGTGLYLSTAKSLYQGGPASLFMNYTIMGGVVYLTLLCLGEM 113

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           + ++P+ G F SYA ++   +   A+ + Y F   +   + +TA  +VM YW +     P
Sbjct: 114 STYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDMTALQLVMDYWDTEASGFP 173

Query: 170 GVWIT--IFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
             W    +F  L+VL+N + VRF+GE E+WL+ +K                   P H+  
Sbjct: 174 -YWAASLLFWFLVVLLNVIHVRFYGEAEYWLAMLKVIAIIIFFILSIVVNVGHNPQHEYI 232

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           GF+ W    A  P+ +   G                  Y GTE   +   EA NP R+ P
Sbjct: 233 GFKNWNHGEA--PFVDGFKG-------FASLFVSASFAYGGTESITLTNGEAANPLRNTP 283

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
           + +K   +RI++FYV S   + M + Y+ P L             PF +  + AG     
Sbjct: 284 KIVKTVFWRILVFYVGSTFFIAMNIPYDYPGL-----DTKSVVTSPFTLVFQMAGTKAAG 338

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAP-KIFAKTNGWGVPYYSLAVSVLFC 406
              NA ++  V SACN  L+  SR +Y + ++   P KI ++TN + VPY S+ ++    
Sbjct: 339 SFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKKIVSRTNRYKVPYVSVLITSSIG 398

Query: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF 466
           LL +     G+  ++ +  N+V +   ++W+ I IT +RF K +  Q G      Y    
Sbjct: 399 LLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQ-GKTHELRYKNWT 457

Query: 467 QPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI 526
            P+  +  + F   I L++ ++ F    +D   F S Y+ + V+  C++ + L  R + +
Sbjct: 458 YPYGPYFLVIFVTFIILVQGWSAF--DPWDVTNFFSYYLDLFVFPFCFIIWWLYKRDRFV 515

Query: 527 KPEDVDLYT 535
           K ED+D  T
Sbjct: 516 KLEDMDFVT 524

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  199 bits (506), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 148/506 (29%), Positives = 233/506 (46%), Gaps = 20/506 (3%)

Query: 45  KHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVM 104
           KH+   LK+ +  RHV M                       PAS++I Y+ V  ++Y V+
Sbjct: 77  KHK--TLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVI 134

Query: 105 ACLGEMAAFIP--LDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162
               E+A        GF +Y S  VD A GF+V + Y  ++  V P +L   +M ++YW 
Sbjct: 135 QSASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYW- 193

Query: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
             + +NP  ++TIF V++V IN VG   + E EF+ +  K                    
Sbjct: 194 -NQTINPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAG 252

Query: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNP 282
           N    G RYW DPGAF+  S++I+  KG               Y G E   + AAE +NP
Sbjct: 253 NDGYLGARYWHDPGAFRG-SDSINRFKG----IVAVLVNAAFAYGGAEFSVLTAAEQQNP 307

Query: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAG 342
           ++S+  A K  +YRI+  Y+++ +LLG  V +N   L+            PFV+A+ + G
Sbjct: 308 QKSIRSASKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHAS--PFVIAVASHG 365

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
           + V+PH  NA +LL V S  NS LY +SR L  L+    AP+     +  G P   L VS
Sbjct: 366 VRVVPHFINAVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVS 425

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
            +F LL+++  S     +F + + +  +  L +W SI ++++R  +A+  Q        Y
Sbjct: 426 CVFGLLSFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGY 485

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFL----GHTFDYKTFISGYIGIPVYAICYVGYK 518
            A    W  + ++     I L+  + V +     +  D   F   Y+ +P+    Y+GYK
Sbjct: 486 VAWTGVWGAYYAMAMIVAI-LVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYK 544

Query: 519 LVHRS--KLIKPEDVDLYTFKAAIDA 542
           +  R    LI   +VDL   +   DA
Sbjct: 545 IWTRDWRLLIPSSEVDLVAHRKIFDA 570

>KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} similar
           to uniprot|P38090 Saccharomyces cerevisiae YBR132C AGP2
           Plasma membrane carnitine transporter expression is
           down-regulated by osmotic stress also functions as a
           low-affinity amino acid permease
          Length = 582

 Score =  198 bits (504), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 131/442 (29%), Positives = 221/442 (50%), Gaps = 11/442 (2%)

Query: 108 GEMAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREK 166
            EM  ++PLD  F   ASR VD +L    G+ + F   +  P ++ A   ++ YW  R+ 
Sbjct: 121 AEMVCYLPLDSPFLCLASRCVDDSLAIMAGWNFWFLECVQIPFEIVAVNTILHYW--RDD 178

Query: 167 VNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDR 226
            +  + + + ++L   I+ + VRF+GE EFWL+S K                   P  DR
Sbjct: 179 YSAAIPLVVQVILYFAISVLAVRFYGEMEFWLASFKIILAAGLFVFTLVAMLGGNPKKDR 238

Query: 227 TGFRYWRDPGAFK---PYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPR 283
            GFR + D   FK   P  +  S S G                 G +   ++A E + PR
Sbjct: 239 FGFRNFAD-APFKQYFPSGKPGSPSAGYFQGFLACLIQASFTIAGPDYVAMIAGETRLPR 297

Query: 284 RSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDP-LLIXXXXXXXXXXXXPFVVAIKNAG 342
           + +P A K    R+ + ++ S L +G+  + NDP L+             P+V+A+KN G
Sbjct: 298 KILPVAFKQVFNRLTILFLGSSLCVGILCSANDPSLMAAISEARPGAGASPYVLAMKNLG 357

Query: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402
           I  LP + NA ++   FSA N+  + +SRTL+G+A+   AP +F + N  GVP Y++AVS
Sbjct: 358 IKTLPDVVNAALVTAAFSAGNAYTFCSSRTLHGMALVGNAPAVFKRCNRHGVPIYAVAVS 417

Query: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462
           + + LL+ + ++  SA + N+ +N+++   L+++  + +TYL F +A  AQ G      +
Sbjct: 418 LTWALLSLLQLNKNSAVVLNWLINMITASQLINFAVLCVTYLYFRRAYHAQCGALPELPF 477

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYK-LVH 521
            +  QP++  V L    ++ L++ Y VF    +D + F+  Y+ I +    YV +K +V 
Sbjct: 478 KSWGQPYTALVGLVAVLIMVLVQGYAVFCSSLWDVQEFLFCYLMIFIDIAIYVVHKFVVQ 537

Query: 522 RSKL--IKPEDVDLYTFKAAID 541
           R +     P+ VDL T   A++
Sbjct: 538 RGRCWPRAPKAVDLVTGLLAVE 559

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  198 bits (504), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 145/500 (29%), Positives = 226/500 (45%), Gaps = 19/500 (3%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVY-TVMACLGE 109
           LK  ++ RH++M                       PA ++I Y     ++Y  V AC   
Sbjct: 68  LKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCEL 127

Query: 110 MAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
             A+  L G + +Y +  VD   GFAV   Y  ++  V P +L   +M ++YW S   VN
Sbjct: 128 GVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTS--SVN 185

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTG 228
           P V++ IF V ++ I+  G R + E EF  +S+K                         G
Sbjct: 186 PDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAGAS-EQGYIG 244

Query: 229 FRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPR 288
            +YW DPGAF     AI   KG               Y G+E   + AAE  NPR SVP+
Sbjct: 245 GQYWHDPGAFGG-DRAIDRFKG----ICSVWVQAAFAYGGSEFIALTAAEQANPRESVPK 299

Query: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPH 348
           A K  LYR+V+ +++ ++L+G  V +N   L+            PFV+A    G+ V+PH
Sbjct: 300 ATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRAS-PFVIAAALHGVRVVPH 358

Query: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408
           I N  +L  V S  NS +Y A R L  LA     PKIF   +  G P  +L    LF L+
Sbjct: 359 IINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLI 418

Query: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468
           A++  S+    +F +   +  +  L +W +I ++++RF +A+  Q        Y A    
Sbjct: 419 AFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYRANTGA 478

Query: 469 WSTWVSLFFCCLIGLIKNYTVFLG-----HTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
             ++ ++FF  ++ LI  + + +         D + F   Y+  PV  + Y+GYKL  R 
Sbjct: 479 LGSYYAIFFNVIV-LIAQFWIAIAPIPKHGELDVEFFFQNYLAFPVLVVFYLGYKLWKRD 537

Query: 524 -KLIKP-EDVDLYTFKAAID 541
            +L+ P  +VDL + +   D
Sbjct: 538 FRLVIPSSEVDLLSHRQIFD 557

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  198 bits (504), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 143/512 (27%), Positives = 240/512 (46%), Gaps = 31/512 (6%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           DG      LKK+L++RH+ M                       P +++I ++  G  +  
Sbjct: 70  DGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAGSQIVG 129

Query: 103 VMACLGEMAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
            +  LGE+    P+ G F SY +R++DP++ F V   Y+ ++F V P ++ A A+ +QYW
Sbjct: 130 TIHGLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAITVQYW 189

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
              + ++P V++ IF  +IV IN  G R FGE EF  S+VK                   
Sbjct: 190 --NDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVLIAGGG 247

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
           P+H+  G +YW +PG+         G KG                 GTE+  + + E  +
Sbjct: 248 PDHEYIGAKYWHNPGSLA------HGFKG----VLSVLVVASYSLGGTEMTCLASGET-D 296

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           P+  +P AIK   +RI+ F+++S+ L+G  V Y +P L+            PFV+AIK  
Sbjct: 297 PKE-LPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSSVDNS----PFVIAIKIH 351

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
            I VLP I NA +L+ + S  NS ++ +SRTL  +A     P  F   +  G P   + +
Sbjct: 352 NIKVLPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGIII 411

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461
           + LF LLA++  SS   ++F++ + +  +   + W+SI I ++RF  A+ AQ        
Sbjct: 412 NSLFGLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDELE 471

Query: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVF--LGHTFDY----KTFISGYIGIPVYAICYV 515
           + +    W +  S     LI + + Y     +G   D     K F   Y+   +  + ++
Sbjct: 472 FVSAVGIWGSVYSGIVNALILVAQFYIALWPIGGWTDSGTRAKKFFQNYLCALILIVLFI 531

Query: 516 GYKLVHRS------KLIKPEDVDLYTFKAAID 541
           G+K+ +R       + I  +D+DL T +  +D
Sbjct: 532 GHKIYYRVTTGHWWEYIALKDIDLDTDRKNVD 563

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  198 bits (504), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 130/492 (26%), Positives = 224/492 (45%), Gaps = 17/492 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            LKKA+++RHV M                       P S++I Y  V  + Y ++   GE
Sbjct: 74  HLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGE 133

Query: 110 MAAFIPL--DGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           MA   P     F SY S ++    GFA  + +  ++  V P +L   ++ ++YW   +K+
Sbjct: 134 MAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYW--NDKI 191

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           N  V+I IF V ++ I+  GV+ +GE EF  +S K                         
Sbjct: 192 NADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYI 251

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YWRDPG+F     A   S  K              Y G EL  +   E +NPR+S P
Sbjct: 252 GAKYWRDPGSF-----AEGDSVEKFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTP 306

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
           +A K ++YRI++ Y+++++L+G  V +N+  L+            P+V+A    G+ V+P
Sbjct: 307 QAAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHAS--PYVLAASIHGVKVVP 364

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           H  NA +L+ V S  NS LY + R +  LA    APK     +  G P  +L +  +F +
Sbjct: 365 HFINAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGV 424

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           + +++ SS   ++F +   +  +  L +W  I+++++RF + +      +    + A   
Sbjct: 425 IGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTG 484

Query: 468 PWSTWVSLFFCCLIGLIKNYTVF----LGHTFDYKTFISGYIGIPVYAICYVGYKLVHR- 522
            W +   + F  L+ + + +       L    D ++F   Y+  P++   Y GY L  R 
Sbjct: 485 IWGSMYGISFNMLVFIAQFWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGYMLYKRD 544

Query: 523 -SKLIKPEDVDL 533
            + L+  + +DL
Sbjct: 545 FTFLVPLDKIDL 556

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  198 bits (503), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 141/490 (28%), Positives = 223/490 (45%), Gaps = 25/490 (5%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           L KA+ +RH+ M                       P  ++I Y    L+V+ ++   GE+
Sbjct: 84  LNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIVSSLMVFLIIQAAGEL 143

Query: 111 AAFIP--LDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168
                  +  FT Y +  VDPA GFA+ + Y  ++ IV P QL   AM +Q+W     VN
Sbjct: 144 GIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVTAAMTIQFW--NVGVN 201

Query: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPN--HDR 226
             V++    V++VLIN  G R + E EF+ +  K                   PN     
Sbjct: 202 LDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGIIITAGGIPNGPDGY 261

Query: 227 TGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSV 286
            G +YWR+PG F       +G KG               Y G E   + AAE KNP +S+
Sbjct: 262 IGGKYWRNPGLFA------NGFKG----VCSVFCYAAFSYGGVETLVLSAAEQKNPLKSI 311

Query: 287 PRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVL 346
           P A K  +YRI+  Y++S++++   V Y  P L+            PFV+AI + G+ V+
Sbjct: 312 PSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSS--PFVIAIASHGVSVV 369

Query: 347 PHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC 406
           PH+ NA +L+ V S  NS LYVA R L  LA    APK     +  G P     V VLF 
Sbjct: 370 PHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRPTTCTLVVVLFG 429

Query: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF 466
           ++ ++  S     +F + +++  +  +  WISI ++++RF  A+  Q    +  +Y A  
Sbjct: 430 MIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGHPLTEIAYKAQT 489

Query: 467 QPWSTWVSLFFCCLIGLIKNYTVFLG-----HTFDYKTFISGYIGIPVYAICYVGYKLVH 521
             W ++V++     + L+  + V +         D   F   Y+  PV    Y+G+K+ +
Sbjct: 490 GYWGSYVAIALALFV-LVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVLCAYLGFKVYY 548

Query: 522 RS-KLIKPED 530
           +  +L+ P D
Sbjct: 549 KQWQLLIPAD 558

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  197 bits (501), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 137/458 (29%), Positives = 221/458 (48%), Gaps = 27/458 (5%)

Query: 2   SESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXX-----VDGKHEGIRLKKALE 56
           S  LE K +  + S ET   ++  DK E                 +DG +    LK+ L+
Sbjct: 19  SGDLEMKFSDGIMSKET---EIDLDKKEDKNKNIVRRMIDSFKPPLDGSYHSDNLKRKLK 75

Query: 57  ARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPL 116
           +RH+ M                       P +++I +S  G  +   +  LGE+    P+
Sbjct: 76  SRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGLGEITMRFPV 135

Query: 117 DG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITI 175
            G F +Y++R +DP++ F V   Y+ +++ V P +L A AM +Q+W +  KV+P VW+ I
Sbjct: 136 VGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTT--KVDPVVWVAI 193

Query: 176 FLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDP 235
           F V++V +N  GV+ FGE EF  S VK                   P+H   G  YW  P
Sbjct: 194 FYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFIGTEYWHHP 253

Query: 236 GAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLY 295
           GA        +G KG                 G+E+  + +AE  +P+  +P AIK   +
Sbjct: 254 GALA------NGFKG----VASVFVTASYSLGGSEMVCLCSAET-DPKE-LPHAIKQVFW 301

Query: 296 RIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVL 355
           RIV F+++S+ L+G  V Y +  L+            PFV+AIK +GI VLP I NA +L
Sbjct: 302 RIVFFFLVSLTLVGFLVPYTNENLLGGSSVNNS----PFVIAIKLSGIRVLPSIINAVIL 357

Query: 356 LFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSS 415
           + + S  NS ++ +SRTL  +A     P++F   +  G P   + V+ LF LLA++  S+
Sbjct: 358 ISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFLVKSA 417

Query: 416 GSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQ 453
               +F++ + +  +   + W+SI I+++RF  A+ AQ
Sbjct: 418 SMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQ 455

>Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar to
           Ashbya gossypii AAR038W
          Length = 559

 Score =  196 bits (498), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 131/499 (26%), Positives = 235/499 (47%), Gaps = 12/499 (2%)

Query: 52  KKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMA 111
           ++ LE RHV                         P S+L+ ++   + +  +     EM 
Sbjct: 48  QRKLENRHVQFVGISGVIGTALFVSIGKALHHGGPISLLLGFTLWCIPILCITVSTAEMV 107

Query: 112 AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPG 170
           +++PL+  F   ASR V+ +L F  G+ + F   +  P ++ A  +V+ YW   +  +  
Sbjct: 108 SYLPLNSPFLRLASRCVNDSLTFTAGWNFWFLECVQIPFEIVAVNVVIHYWT--DDYSAT 165

Query: 171 VWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFR 230
           + + + + L  LI+   VR++GE EFWL+S K                   P  +R GF+
Sbjct: 166 IPLCVQVALYFLISVFAVRYYGEIEFWLASFKIILAVGLFAFTFVTMVGGNPKRERYGFK 225

Query: 231 YWRDP--GAFKPYSEAISGSK-GKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           + R+     + P  ++  GS  G                 G +   ++A E K PR+ +P
Sbjct: 226 HIRELPFKTYFPGGDSDQGSALGYFQGFLACLIQASFTIAGPDYVSMIAGETKLPRKVLP 285

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXX-XXXXXPFVVAIKNAGIPVL 346
            A K    R+   ++   L +G+    NDP L              P+V+A+ + GI +L
Sbjct: 286 IAFKQVFVRLTFLFLGGCLCVGIVCGANDPQLTAAINDSRPGAASSPYVIAMNHLGIRIL 345

Query: 347 PHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFC 406
           P I NA ++   FSA N+  Y +SR+LYGLA+D  AP IF + N +GVP Y++ VS+ + 
Sbjct: 346 PDIVNAALITAAFSAGNAYTYCSSRSLYGLALDGYAPPIFKRCNRYGVPIYAVGVSLFWA 405

Query: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPF 466
           +L+ + ++  S+ + N+ +N+++   L+++  + I YL F +A IAQ  +     + + +
Sbjct: 406 VLSLLQLNENSSIVLNWLINLITASQLINFGILCIIYLYFRRAYIAQQDNLPALPFKSWW 465

Query: 467 QPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYI----GIPVYAICYVGYKLVHR 522
           QP++    L    ++ +++ YTVF    ++ + F+  Y      I +Y  CY  +K    
Sbjct: 466 QPYTAICGLVSVTIMVIVQGYTVFYSSLWNVQDFLFCYFMVFANIAIYLACYFVWKR-GN 524

Query: 523 SKLIKPEDVDLYTFKAAID 541
             ++ P  VDL T  A ++
Sbjct: 525 DNVLPPNQVDLITGLAEVE 543

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  197 bits (502), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 148/516 (28%), Positives = 231/516 (44%), Gaps = 50/516 (9%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            LK+ ++ RHV M                       PA ++  Y+ +G  VY ++   GE
Sbjct: 109 NLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSAGE 168

Query: 110 MAA-FIPLDG-FTSYASRYVDPA----------------LGFAVGYCYLFKYFIVTPNQL 151
           MA  +  L+G F +Y +  V+P                 L F +GYC+            
Sbjct: 169 MAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSFGIGYCF------------ 216

Query: 152 TAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXX 211
                  +YW +R  V+P V++ IF VLI++IN  G R + E EF+ +  K         
Sbjct: 217 ----DDYKYWTTR--VDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFI 270

Query: 212 XXXXXXXXXXPNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTEL 271
                      N    G  YWR+PGAF+   + I   KG               + GTE 
Sbjct: 271 LGIIINVGGAGNDGYLGNIYWRNPGAFRG-DKGIDHFKG----VVATLVTAAFAFGGTEF 325

Query: 272 CGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXX 331
             + AAE  NPR+++P A K  LYRIVL Y+ SI+L+G  V +  P L+           
Sbjct: 326 IALTAAEQSNPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAAS- 384

Query: 332 XPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNG 391
            P+V+A+ + G+ V+PH  NA +LL V S  NS  Y +SR L  L+    APK F   + 
Sbjct: 385 -PYVIAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDR 443

Query: 392 WGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVI 451
            G P  ++ VS LF ++A+   S    ++F + + +  +  + +WISI ++++RF  A+ 
Sbjct: 444 EGRPSRAMIVSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMK 503

Query: 452 AQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLG----HTFDYKTFISGYIGI 507
           AQ        + A    W ++ S+F   L  LI  + V +          + F   Y+ +
Sbjct: 504 AQGRSMGEVGFKAQTGIWGSYYSIFLMILT-LIGQFWVAIAPIGTAELSARNFFENYLAM 562

Query: 508 PVYAICYVGYKLVHR--SKLIKPEDVDLYTFKAAID 541
           P+    Y GYK+  +  +  IK ED+DL + +   D
Sbjct: 563 PILIGFYFGYKIWKKDWTLYIKAEDIDLISHRQIFD 598

>CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa]
           {ON} highly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease
          Length = 593

 Score =  197 bits (500), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 137/510 (26%), Positives = 240/510 (47%), Gaps = 19/510 (3%)

Query: 2   SESLEKKNAGILYSNETLEEDVAFDKLERXXXXXXXXXXXVDGKHEGIRLKKALEARHVS 61
            E +E++     + ++ +   ++FD+ ER               H      + L  RHV 
Sbjct: 39  EEGIEER----FFESDDVTRSISFDEDERSSNDSRTQLIESTSTH------RKLLNRHVQ 88

Query: 62  MXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEMAAFIPLDG-FT 120
                                   PA++L++++   + +  +     EM +F+P+   F 
Sbjct: 89  FIAISGVIGTALFVAIGKPLYRGGPANLLLAFALWCIPILCITVSTAEMVSFMPVSSPFL 148

Query: 121 SYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLI 180
             A + VD +LG    + + F   +  P ++ +   ++ YW  R+  +P + + I +VL 
Sbjct: 149 RLAKKCVDESLGVTASWNFWFLECVQIPYEIVSVNTIIHYW--RDDYSPAIPLVIQVVLY 206

Query: 181 VLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKP 240
           VLI+   V+++GE EFWL+S K                   P HDR GFRY+ +   FK 
Sbjct: 207 VLISVCAVKYYGEMEFWLASFKIILAVGLFCFTFITMLGGNPKHDRYGFRYYGE-SPFKK 265

Query: 241 Y----SEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYR 296
           Y    +E    S G                 G E   ++A E K PR+ +P+A K    R
Sbjct: 266 YFPDGNEGAGKSAGYFQGFLTCLIQAAFTIAGGEYISMLAGEVKLPRKVLPKAFKQVFVR 325

Query: 297 IVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXX-XXPFVVAIKNAGIPVLPHIFNACVL 355
           + + ++ S L +G+  + ND  L              P+V+A+ N  I VLP I N  ++
Sbjct: 326 LTVIFLGSCLCVGIVCSPNDSALTAAINEARPGAGSSPYVIAMNNLQIRVLPDIVNIALI 385

Query: 356 LFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSS 415
              FSA N+  Y +SRTLYG+A+D  APKIF K N +GVP Y++ VS+ + LL+ + ++S
Sbjct: 386 TAAFSAGNAYTYCSSRTLYGMALDGYAPKIFTKCNKYGVPIYAVGVSLCWALLSLLQLNS 445

Query: 416 GSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSL 475
            SA + N+ +N+++   L++++ + + YL F +A + Q        + + +QP++  V L
Sbjct: 446 NSAVVLNWLINLITASQLINFVFLCVIYLFFRRAYMTQKERLPELPFKSWWQPYTVIVGL 505

Query: 476 FFCCLIGLIKNYTVFLGHTFDYKTFISGYI 505
               ++ L++ YTVF    ++ + FI  Y+
Sbjct: 506 VSVLIMILLQGYTVFFPKLWNGRDFIFCYL 535

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  197 bits (500), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 134/492 (27%), Positives = 225/492 (45%), Gaps = 17/492 (3%)

Query: 50  RLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGE 109
            LKK++++RHV M                       P S++I Y  V  + Y ++   GE
Sbjct: 85  HLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQAAGE 144

Query: 110 MA-AFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKV 167
           M  A+  L G F +Y S ++  + GFA  + +  ++  V P +L   +M ++YW   + +
Sbjct: 145 MGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYW--NDSI 202

Query: 168 NPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
           N  V+I IF V ++ I+  GV+ +GE EF  +S K                         
Sbjct: 203 NADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYI 262

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           G +YWRDPG+F   S A      +              + G EL  +   E  N R+S P
Sbjct: 263 GGKYWRDPGSFADGSNAT-----RFKGICFILVTAYFSFGGIELFVLSINEQSNARKSTP 317

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
            A K ++YRI++ Y+++++L+G  V +N+  L+            P+V+A     + V+P
Sbjct: 318 LAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHAS--PYVLAASIHKVRVIP 375

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCL 407
           HI NA +L+ V S  NS LY A R +  LA    AP+     +  G P  +LAV  L  +
Sbjct: 376 HIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCALVGV 435

Query: 408 LAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQ 467
           + ++  S    Q F +   +  +  + +W  I+++++RF KA+  Q        Y A   
Sbjct: 436 VGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYKANTG 495

Query: 468 PWSTWVSLFFCCLIGLIKNYTVFL----GHTFDYKTFISGYIGIPVYAICYVGYKLVHRS 523
            W ++  +FF  L+ + + +        G   D + F  GY+  P++   Y+GY L ++ 
Sbjct: 496 IWGSYYGVFFNILVFMAQFWVALSPIGNGGKCDVQAFFEGYLAAPLWIFMYLGYMLYNKD 555

Query: 524 -KLIKPED-VDL 533
             L+ P D +DL
Sbjct: 556 FTLLNPLDKIDL 567

>KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {ON}
           similar to uniprot|Q03770 Saccharomyces cerevisiae
           YDR160W SSY1 Component of the SPS plasma membrane amino
           acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
           external amino acid concentration and transmits
           intracellular signals that result in regulation of
           expression of amino acid permease genes
          Length = 824

 Score =  200 bits (508), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 149/555 (26%), Positives = 246/555 (44%), Gaps = 59/555 (10%)

Query: 46  HEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMA 105
            E   +++ L  RH+ M                       P   ++ +S  G +    M 
Sbjct: 244 EEQYSVQRKLGIRHIQMIATGATMGVGLFLNSGKALSIAGPFGFVLGFSICGSVALATML 303

Query: 106 CLGEMAAFIPLD-GFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVS- 163
              E+AA IP+  GF+  ASR+V+ A GFA+G+ Y   Y I   NQ+ A   ++ Y+ + 
Sbjct: 304 SFTEIAALIPISSGFSGLASRFVEDAFGFALGWSYWLTYAITFANQIVASNFMLSYYENM 363

Query: 164 REKVNPGV-WITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXP 222
           R++    V ++T FL++ VL N + VR   E  +  +  K                    
Sbjct: 364 RDQRGATVGFVTFFLIIAVLGNLLDVRILAELTYGFTFFKILVAAMMIFAMIVLNAGAGR 423

Query: 223 NHD-RTGFRYW---RDP-----GAFKPY----------SEAISGSKGKXXXXXXXXXXXX 263
           +H    GFR+W   + P     G F+P            + ISG+KG+            
Sbjct: 424 HHHPAVGFRFWDASKSPENLTYGLFRPTFDLRDIGSGSKKGISGAKGRFLSVLVVIVVSS 483

Query: 264 XXYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLL---- 319
             ++G EL  +   EA NPR+S+P A K T   I+  Y++SI ++ + V   D  L    
Sbjct: 484 FSFSGIELGFVACGEAANPRKSLPSATKRTFTTIITLYLLSIFVVSLNVYSGDSRLLRYY 543

Query: 320 -----------------------------IXXXXXXXXXXXXPFVVAIKNAGIPVLPHIF 350
                                        I            P+V+A+++ G+     +F
Sbjct: 544 TAATQSPTTVLLHAFNTNWQIDETCNKNVIFSSTDFSNGSQSPWVLALESFGLCTFSSVF 603

Query: 351 NACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLLAY 410
           NA +++F  ++  S LY +SRTLY +A   KAP +F   +  GVPY ++  S LF  LAY
Sbjct: 604 NAILVVFGVTSEFSSLYASSRTLYSMATQEKAPAVFKLCSRNGVPYVAVLFSGLFGALAY 663

Query: 411 MNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFG----DKSGFSYTAPF 466
           + ++S S +IF    N+      + W+ + +++LRF+ A+  +      D   F Y +PF
Sbjct: 664 LTINSRSLEIFQALANISGATISIIWLGLNVSFLRFYYALRKRTDIISRDDPSFPYRSPF 723

Query: 467 QPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLI 526
           QP+     L    LI ++  ++ FL   ++ K F S Y G+  + ICY+GYK+   SKL 
Sbjct: 724 QPYVACYGLIGSFLIVVLMGFSNFLHGFWNTKMFFSSYGGLMFFTICYLGYKVFGTSKLQ 783

Query: 527 KPEDVDLYTFKAAID 541
           + + +DL + +  +D
Sbjct: 784 RLDQLDLDSGRREMD 798

>Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C
           (AGP2) - Amino acid permease [contig 255] FULL
          Length = 579

 Score =  196 bits (498), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 131/463 (28%), Positives = 233/463 (50%), Gaps = 16/463 (3%)

Query: 92  SYSFVGLLVYTV-MACL----GEMAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFI 145
           ++  +G+ V+ + M C+     EM  ++PLD  F    +R VD ++  A G+ + F   +
Sbjct: 99  AFLLLGMAVWCIPMLCITVSTAEMVCYLPLDSPFLRLTARCVDDSVAVAAGWNFWFLECV 158

Query: 146 VTPNQLTAGAMVMQYWVSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXX 205
             P ++ A   ++ YW  R+  +  + + + +VL   I+   VR++GE EFWL+S K   
Sbjct: 159 QIPFEIVAVNTIIHYW--RDDYSAAIPLVVQVVLYFGISVFAVRYYGEMEFWLASFKIIL 216

Query: 206 XXXXXXXXXXXXXXXXPNHDRTGFRYWRDPGAFKPY-SEAISGSKGKXXXXXXXXXXXXX 264
                           P+ DR GFR + D   FK Y    + G+                
Sbjct: 217 ALGLFTFTLVAMLGGNPHKDRFGFRNFGD-APFKQYFPSGVVGTPSAGYFQGFLACLIQA 275

Query: 265 XYT--GTELCGIVAAEAKNPRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDP-LLIX 321
            +T  G +   ++A E   PR+ +P A K    R+ + ++ S L +G+  + NDP L   
Sbjct: 276 SFTIAGPDYVSMIAGETHLPRKVLPVAFKHVFNRLTVLFLGSSLCVGILCSANDPDLTAA 335

Query: 322 XXXXXXXXXXXPFVVAIKNAGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRK 381
                      P+V+A+KN GI  LP + NA ++   FSA N+  + +SRTL+G+A+D  
Sbjct: 336 INEARPGAGSSPYVIAMKNLGIRALPDVVNAALITAAFSAGNAYTFCSSRTLHGMALDGN 395

Query: 382 APKIFAKTNGWGVPYYSLAVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILI 441
           AP+IF + N  GVP Y++AVS+ + LL+ + ++  SA + N+ +N+++   L+++  + +
Sbjct: 396 APRIFRRCNRHGVPIYAVAVSLTWALLSLLQLNKNSAVVLNWLINLITASQLINFACLCL 455

Query: 442 TYLRFHKAVIAQFGDKSGFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFI 501
           TYL F +A ++Q  +     + +  QP++  + LF   L+ L++ Y+VF    ++ K F+
Sbjct: 456 TYLYFRRAYLSQQHNLPSLPFKSWGQPYTALLGLFASLLMALVQGYSVFQNSLWNVKDFL 515

Query: 502 SGYIGIPVYAICYVGYKLV---HRSKLIKPEDVDLYTFKAAID 541
             Y+ + V    Y+ +K V    R     P  VDL +   A++
Sbjct: 516 FCYLMVFVDIAIYLFHKFVISRGRKGPADPPAVDLVSGLRAVE 558

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  195 bits (496), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 136/495 (27%), Positives = 230/495 (46%), Gaps = 30/495 (6%)

Query: 51  LKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYTVMACLGEM 110
           L +AL+ RH++M                       PAS+ I+YS +G +VY  + CL EM
Sbjct: 50  LTRALKPRHINMISIAGIIGTGLYLSTSTSLHKGGPASLFINYSLIGGIVYLTLLCLAEM 109

Query: 111 AAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVNP 169
           + ++P+ G F +YA ++   +   A+ + Y F   +   + LTA  +VM YW +     P
Sbjct: 110 STYMPISGSFCTYAKKFGSDSFAMALMWNYWFNDAVSVASDLTALQLVMDYWNTDSNHFP 169

Query: 170 GVWIT--IFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXXPNHDRT 227
             W    IF   ++ +N + VRF+GE E+WL+ +K                   P H+  
Sbjct: 170 -YWAASLIFWFFVLSLNVIHVRFYGEAEYWLAMLKVIAIIIFFIMSIIVNVGHNPQHEYI 228

Query: 228 GFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKNPRRSVP 287
           GF+ W    A  P+ +   G                  Y GTE   + + E+ NP R+ P
Sbjct: 229 GFKNWTVGEA--PFVDGFKG-------FASLFVSASFAYGGTESITLTSGESDNPLRNTP 279

Query: 288 RAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNAGIPVLP 347
           + +K   +RI+ FY+ +   + M V YN P L             PF +  K AG     
Sbjct: 280 KIVKTVFWRILFFYIGTTFFIAMNVPYNYPGL-----SSGSVVTSPFTIVFKMAGTAGAG 334

Query: 348 HIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPK-IFAKTNGWGVPYYSLAVSVLFC 406
              NA ++  V SACN  L+  SR +Y + ++   PK I ++TN + VPY ++ ++    
Sbjct: 335 SFMNAVIMTSVISACNHALFAGSRIMYNMGLEGYLPKSIVSRTNRYKVPYVAVLITWAVG 394

Query: 407 LLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGF----SY 462
            L +     G+  ++ +  N+V +   L+W+ I IT +RF + + AQ  +K+      ++
Sbjct: 395 GLCFGASFIGAGTLWTWLQNIVGVSNQLAWLCIAITSIRFRQGLEAQ--NKTHELKFKNW 452

Query: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522
           T PF P+   V++ F   I L++ ++ F    ++   F S YI + V+  C++ + L  R
Sbjct: 453 TYPFGPYFLVVAVTF---IILVQGWSSFA--PWNVSNFFSVYIELFVFPFCFIIWWLYKR 507

Query: 523 SKLIKPEDVDLYTFK 537
              +K +D+D  T K
Sbjct: 508 DPFVKCKDMDFVTDK 522

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  195 bits (495), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 127/417 (30%), Positives = 203/417 (48%), Gaps = 21/417 (5%)

Query: 43  DGKHEGIRLKKALEARHVSMXXXXXXXXXXXXXXXXXXXXXXXPASILISYSFVGLLVYT 102
           +G  +   LK++L++RH+ M                       P +++I +   G  +  
Sbjct: 69  NGSFDPDSLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVG 128

Query: 103 VMACLGEMAAFIPLDG-FTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161
            +  LGE+    P+ G F  Y +R++DP+L F V   Y+ ++F V P ++ A AM +Q+W
Sbjct: 129 TIHGLGEITVRFPVVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFW 188

Query: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKXXXXXXXXXXXXXXXXXXX 221
                ++P VW+ IF V IV IN  GVR FGE EF  SS+K                   
Sbjct: 189 --NTSIDPVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGG 246

Query: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKXXXXXXXXXXXXXXYTGTELCGIVAAEAKN 281
           P H+  G RYW DPGA         G KG                 G+E+  + + E  +
Sbjct: 247 PTHEYVGARYWHDPGALA------HGFKG----VASVFVTASYSLGGSEMACLASGET-D 295

Query: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIXXXXXXXXXXXXPFVVAIKNA 341
           P+  +P AIK   +RI+ F+++S+ L+G  V Y +  L+            PFV+A    
Sbjct: 296 PKE-LPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSSVNNS----PFVIACNLY 350

Query: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401
            I VLP I NA +L+ + S  NS ++ +SRTL  +A     P+IF   +  G P   +  
Sbjct: 351 HIKVLPSIINAVILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIIT 410

Query: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKS 458
           + LF LLA++  SS  +++FN+ + +  +   + W+SI ++++RF  A+ AQ  DK+
Sbjct: 411 NSLFGLLAFLVKSSSMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQ--DKT 465

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.142    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 48,395,753
Number of extensions: 1738220
Number of successful extensions: 6503
Number of sequences better than 10.0: 352
Number of HSP's gapped: 4758
Number of HSP's successfully gapped: 380
Length of query: 577
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 462
Effective length of database: 40,294,809
Effective search space: 18616201758
Effective search space used: 18616201758
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)