Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F24926g8.773ON45145122150.0
YMR238W (DFG5)8.773ON45845116050.0
Suva_13.4228.773ON45845315940.0
SAKL0B05412g8.773ON45145015930.0
NCAS0C008108.773ON45144315850.0
Skud_13.4078.773ON45843015850.0
NDAI0K008408.773ON45942715840.0
Smik_13.4468.773ON45843015670.0
Kwal_55.202668.773ON45745415390.0
KLTH0E04048g8.773ON45444415240.0
CAGL0M05049g8.773ON45343415210.0
KAFR0B034908.773ON45145414930.0
ZYRO0F12210g8.773ON45344514930.0
KNAG0J007008.773ON46344114930.0
Kpol_1030.208.773ON45145114900.0
TDEL0B033608.773ON43643714820.0
TBLA0B033208.773ON45045214670.0
TPHA0J016008.773ON46145814610.0
Ecym_14748.773ON45445114540.0
AFR530W8.773ON45944913610.0
NCAS0A08730singletonON63138613331e-179
NCAS0A08740singletonON43438313081e-179
ACL201WsingletonON44842412921e-176
ACL200WsingletonON46343012731e-173
ACL202WsingletonON45040812531e-170
TBLA0C03850singletonON56737712591e-169
TPHA0I024702.570ON45244911821e-159
SAKL0D13574g2.570ON45143411811e-159
Suva_11.1802.570ON45044911671e-157
Smik_11.2022.570ON44945011631e-156
YKL046C (DCW1)2.570ON44945011591e-156
NDAI0C006802.570ON45244311561e-155
KLTH0D08008g2.570ON44843711521e-155
Skud_11.1832.570ON44944911501e-154
KLLA0E07723g2.570ON45043311451e-154
KAFR0I017402.570ON44843311391e-153
Kwal_26.82252.570ON44945211341e-152
NCAS0A127502.570ON44744711321e-152
NCAS0H029002.570ON45344811291e-151
CAGL0L01727g2.570ON44638111211e-150
KAFR0A021702.570ON44942910991e-147
TBLA0H02580singletonON44941510991e-147
NDAI0B015102.570ON44743410971e-146
TBLA0H02590singletonON45042610921e-146
TBLA0H026002.570ON44942610871e-145
KNAG0A071802.570ON46339510721e-142
Kpol_1056.42.570ON45042610641e-141
TDEL0B065802.570ON44744610541e-140
ABR060W2.570ON45141510381e-137
Ecym_45772.570ON45042910141e-134
ZYRO0E06380g2.570ON45344010011e-132
SAKL0C02024gsingletonON89880697.0
Suva_10.2068.308ON86266697.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F24926g
         (451 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]...   857   0.0  
YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putat...   622   0.0  
Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238...   618   0.0  
SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly...   618   0.0  
NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {O...   615   0.0  
Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238...   615   0.0  
NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {...   614   0.0  
Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238...   608   0.0  
Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {...   597   0.0  
KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {...   591   0.0  
CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} simil...   590   0.0  
KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.7...   579   0.0  
ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} simila...   579   0.0  
KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {...   579   0.0  
Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 b...   578   0.0  
TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {O...   575   0.0  
TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {O...   569   0.0  
TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {...   567   0.0  
Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar t...   564   0.0  
AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic ...   528   0.0  
NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON}            518   e-179
NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON}            508   e-179
ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic ...   502   e-176
ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic ...   494   e-173
ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic ho...   487   e-170
TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON}              489   e-169
TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.5...   459   e-159
SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} high...   459   e-159
Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {...   454   e-157
Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {...   452   e-156
YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON} ...   451   e-156
NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {O...   449   e-155
KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly...   448   e-155
Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {...   447   e-154
KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {...   445   e-154
KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {O...   443   e-153
Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C...   441   e-152
NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON} Anc_2...   440   e-152
NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570    439   e-151
CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa] ...   436   e-150
KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.5...   427   e-147
TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {O...   427   e-147
NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {O...   427   e-146
TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {O...   425   e-146
TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {O...   423   e-145
KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON}            417   e-142
Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON} ...   414   e-141
TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON} Anc_2...   410   e-140
ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic ho...   404   e-137
Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {O...   395   e-134
ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} simila...   390   e-132
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    31   7.0  
Suva_10.206 Chr10 (385842..388430) [2589 bp, 862 aa] {ON} YLR115...    31   7.6  

>KLLA0F24926g Chr6 complement(2321928..2323283) [1356 bp, 451 aa]
           {ON} similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  857 bits (2215), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/451 (92%), Positives = 419/451 (92%)

Query: 1   MKISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPY 60
           MKISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPY
Sbjct: 1   MKISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPY 60

Query: 61  YWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWA 120
           YWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWA
Sbjct: 61  YWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWA 120

Query: 121 LTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYK 180
           LTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYK
Sbjct: 121 LTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYK 180

Query: 181 NTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCT 240
           NTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCT
Sbjct: 181 NTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCT 240

Query: 241 SIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQAS 300
           SIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQAS
Sbjct: 241 SIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQAS 300

Query: 301 NKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNW 360
           NKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTS     KSCSGGTDGHTCGLNW
Sbjct: 301 NKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSAAAAAKSCSGGTDGHTCGLNW 360

Query: 361 FTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKN 420
           FTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTEST           LNVSTTNVLQKN
Sbjct: 361 FTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTGGSSSGDASAGLNVSTTNVLQKN 420

Query: 421 INITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
           INITAGDKAGA                WMVL
Sbjct: 421 INITAGDKAGAGIITTIVLGVLVLGTVWMVL 451

>YMR238W Chr13 (746353..747729) [1377 bp, 458 aa] {ON}  DFG5Putative
           mannosidase, essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis in bud formation, involved in filamentous
           growth, homologous to Dcw1p
          Length = 458

 Score =  622 bits (1605), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/451 (65%), Positives = 342/451 (75%), Gaps = 1/451 (0%)

Query: 1   MKISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPY 60
           M +S  ++      +  A+DLDT+SK+SIC ATALIQ G+ DYYEG  YGGTVGMF SPY
Sbjct: 9   MILSICFTFLSFFKATHAMDLDTTSKTSICDATALIQGGMLDYYEGTRYGGTVGMFQSPY 68

Query: 61  YWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWA 120
           YWW AG  FGGM+ENW+LC+N +Y+++LYDAL+AQTGS+YDY+PSNQTMVEGNDDQG+W 
Sbjct: 69  YWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPSNQTMVEGNDDQGIWG 128

Query: 121 LTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYK 180
           +TVM AVERNFT+P  DG PGWLAMVQAVFN MYSRWDS+HC GGLRWQIFTWNSGYNYK
Sbjct: 129 ITVMGAVERNFTDPG-DGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYNYK 187

Query: 181 NTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCT 240
           NT+SN CLFQ+AARLGRYTGNTTYLEVAE+VFDWLVD+ +VV+ + ANVFDGA ID NCT
Sbjct: 188 NTVSNACLFQIAARLGRYTGNTTYLEVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTNCT 247

Query: 241 SIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQAS 300
            I K EW+YNHG+VLGG AYMYNATNG+  W+T   +IL GA S+FF+D IMYES CQ  
Sbjct: 248 DITKIEWTYNHGIVLGGLAYMYNATNGTGEWETSLTKILNGAKSYFFKDSIMYESACQDY 307

Query: 301 NKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNW 360
             CNTDQR FK+IFSRMLG TSV+APFT DTI  LI TS     KSC+GGTDGHTCGLNW
Sbjct: 308 GTCNTDQRTFKSIFSRMLGLTSVMAPFTRDTIDDLIKTSAEAAAKSCNGGTDGHTCGLNW 367

Query: 361 FTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKN 420
                DG YGLGEQ  ALE+I  LL+HD PAP  E             +N STTNVLQ N
Sbjct: 368 QKQTNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTNVLQNN 427

Query: 421 INITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
           +NI  GD+AGA                WM+ 
Sbjct: 428 LNIKKGDRAGAAIITAVILSVLTGGAVWMLF 458

>Suva_13.422 Chr13 (727776..729152) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/453 (65%), Positives = 347/453 (76%), Gaps = 3/453 (0%)

Query: 1   MKIS-PL-YSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVS 58
           MKI+ PL ++L     +  A+DLDT+S +SIC ATALIQ G+ DYYEG  YGGTVGMF S
Sbjct: 7   MKIALPLCFTLLSFFKATDAMDLDTTSATSICDATALIQDGMLDYYEGTRYGGTVGMFQS 66

Query: 59  PYYWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGV 118
           PYYWW AG  FGGM+ENWYLCQN +Y+ +LYDAL+AQTG+DYDY+P+NQTMVEGNDDQG+
Sbjct: 67  PYYWWHAGEAFGGMVENWYLCQNDTYQVLLYDALLAQTGADYDYIPANQTMVEGNDDQGI 126

Query: 119 WALTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYN 178
           W +TVM AVERNFTNP ++G PGWLAMVQAVFN MYSRWDS++C GGLRWQIFTWNSGYN
Sbjct: 127 WGITVMGAVERNFTNP-DNGAPGWLAMVQAVFNTMYSRWDSENCGGGLRWQIFTWNSGYN 185

Query: 179 YKNTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDN 238
           YKNTISN CLFQ+AARLGRYTGNTTYL+VAE+VFDWLVD+ +VV+ + ANV+DGA ID N
Sbjct: 186 YKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVYDGAEIDTN 245

Query: 239 CTSIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQ 298
           CT I K EW+YNHG+VLGG AYMYNATNG+  W+T  +Q+L GA S+FF+D IMYES CQ
Sbjct: 246 CTDITKIEWTYNHGIVLGGMAYMYNATNGTSEWKTSLQQVLNGAASYFFKDGIMYESACQ 305

Query: 299 ASNKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGL 358
               CNTDQR FK+IFSRMLG TSV+APFT+DTI  LI TS     KSC GGTDGHTCGL
Sbjct: 306 DYGTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDALIKTSAEAAAKSCDGGTDGHTCGL 365

Query: 359 NWFTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQ 418
           +W     DG YGLGEQ  ALE+I  LL+HD PAP  E             +N STT+VLQ
Sbjct: 366 DWEKETNDGYYGLGEQMSALEVIQNLLIHDRPAPYKEDNGGTSKGDANAGMNSSTTSVLQ 425

Query: 419 KNINITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
            N+NIT GD+AGA                WM+ 
Sbjct: 426 NNLNITKGDRAGAAIITAVILSVLIGGAVWMLF 458

>SAKL0B05412g Chr2 (466158..467513) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 451

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/450 (64%), Positives = 344/450 (76%), Gaps = 1/450 (0%)

Query: 3   ISPLYSL-FLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYY 61
           IS L SL ++++  V AIDLDTSSK SIC AT+LIQ+G+ DYYEG  YGGTVGMF  PYY
Sbjct: 2   ISLLISLIYMSLNIVHAIDLDTSSKDSICYATSLIQKGMLDYYEGTKYGGTVGMFQPPYY 61

Query: 62  WWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWAL 121
           WW+AG  FGGM++N YLC N +Y+D++YDA++AQTG +YDY+P+NQ+MVEGNDDQGVW +
Sbjct: 62  WWQAGEAFGGMLDNIYLCDNETYKDLIYDAMIAQTGENYDYIPANQSMVEGNDDQGVWGI 121

Query: 122 TVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKN 181
           T+M AVERNFTNP ++G PGWLAMVQAVFN MY+RWDS HC GGLRWQIFTWNSGYNYKN
Sbjct: 122 TIMGAVERNFTNPTKEGVPGWLAMVQAVFNTMYARWDSQHCGGGLRWQIFTWNSGYNYKN 181

Query: 182 TISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTS 241
           TI+NGCLFQ+AARLGRYTGN TYLEVA KV+DWL D+ FVV++++ANVFDGA I++NC+S
Sbjct: 182 TIANGCLFQIAARLGRYTGNDTYLEVASKVWDWLEDVGFVVLQDKANVFDGANIENNCSS 241

Query: 242 IVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASN 301
           IVK EW+YNHGVVLGG AYMYNATNGSD+WQTR  Q+L GA  FFF + IMYE  CQ S 
Sbjct: 242 IVKIEWTYNHGVVLGGAAYMYNATNGSDIWQTRLTQVLDGAVEFFFNNSIMYERACQGSG 301

Query: 302 KCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWF 361
            CN DQR FK+IFSRMLG TSVLAPFT DTI PLI  S     +SC+GGTDGHTCGL+W 
Sbjct: 302 TCNNDQRSFKSIFSRMLGLTSVLAPFTRDTIDPLIKASAEGAARSCTGGTDGHTCGLDWT 361

Query: 362 TGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNI 421
            G  DG YGLGEQ  ALEI+  LL+ D+P P T              LN S+ NVL+ N+
Sbjct: 362 LGHHDGYYGLGEQMSALEIMQNLLIDDIPGPFTADNGGSSVGDPNAGLNSSSANVLENNL 421

Query: 422 NITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
           +IT  D+ GA                WMV 
Sbjct: 422 SITHKDRVGAAIITAIVLGVMIGGSVWMVF 451

>NCAS0C00810 Chr3 complement(144534..145889) [1356 bp, 451 aa] {ON}
           Anc_8.773
          Length = 451

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/443 (64%), Positives = 337/443 (76%)

Query: 9   LFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLV 68
           + L  + V +IDLD +SK SIC ATALIQ+G+ DYYEG+ YGG VGMF  PYYWW  G+ 
Sbjct: 9   VLLLPLLVQSIDLDVTSKDSICAATALIQKGMLDYYEGERYGGAVGMFQPPYYWWNGGVA 68

Query: 69  FGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVE 128
           FGGM+EN YLC+N ++E +L DAL+AQTG +YDY+PSNQ+MVEGNDDQGVW LT+M AVE
Sbjct: 69  FGGMLENMYLCENNTFESLLMDALVAQTGDNYDYIPSNQSMVEGNDDQGVWGLTIMDAVE 128

Query: 129 RNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCL 188
           RNFT P + G PGWLAM QAVFN MY+RWD DHC GGLRWQIFTWNSGYNYKNTI+N CL
Sbjct: 129 RNFTAPNKSGVPGWLAMAQAVFNTMYARWDPDHCGGGLRWQIFTWNSGYNYKNTIANACL 188

Query: 189 FQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKYEWS 248
           FQ+AARLGRYTGN TYL+VAEKVFDW+VDI+++V+ ++ANVFDGA ID+NCT I   EW+
Sbjct: 189 FQMAARLGRYTGNQTYLDVAEKVFDWMVDINYIVLNDKANVFDGADIDENCTDITTLEWT 248

Query: 249 YNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTDQR 308
           YNHGVVLGGCAYMYNATNGS  W+TR  +IL GA  +FF+D++M ES CQ+ N CN DQR
Sbjct: 249 YNHGVVLGGCAYMYNATNGSSTWETRVNKILAGAQEYFFQDNVMLESACQSYNTCNNDQR 308

Query: 309 VFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWDGQ 368
            FK+IFSRMLG+TSVLAPFT +TI PLI  S      SC+GG DGHTCGL+W  G  DG 
Sbjct: 309 CFKSIFSRMLGFTSVLAPFTAETIDPLIKASAEAAATSCTGGKDGHTCGLDWTKGSNDGY 368

Query: 369 YGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITAGDK 428
           YGLGEQ  ALEI++ LL+HD PAPLT +T           LN +TTNVL+  + IT GD+
Sbjct: 369 YGLGEQMNALEIMSNLLIHDRPAPLTANTGGTSEGDASAGLNSTTTNVLENKLKITQGDR 428

Query: 429 AGAXXXXXXXXXXXXXXXXWMVL 451
           AGA                WM+ 
Sbjct: 429 AGAAIVTAVILGIFVGGAVWMLF 451

>Skud_13.407 Chr13 (720539..721915) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/430 (67%), Positives = 342/430 (79%), Gaps = 3/430 (0%)

Query: 1   MKISPLYSL-FLTVVSV-LAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVS 58
           M++ P     FL+ V +  A+DLDT+SK+SIC ATALIQ G+ DYY+G  YGG VGMF S
Sbjct: 7   MRMIPFICFTFLSFVGISHAMDLDTTSKTSICDATALIQDGMLDYYDGTRYGGAVGMFQS 66

Query: 59  PYYWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGV 118
           PYYWW AG  FGGM+ENW+LC+N +Y+++LYDAL+AQTGS+YDY+P+NQTMVEGNDDQG+
Sbjct: 67  PYYWWHAGEAFGGMLENWFLCENETYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126

Query: 119 WALTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYN 178
           W +TVM AVERNFT+P E G PGWLAMVQAVFN MYSRWDS+HC GGLRWQIFTWNSGYN
Sbjct: 127 WGITVMGAVERNFTDPDE-GKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYN 185

Query: 179 YKNTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDN 238
           YKNT+SN CLFQ+AARLGRYTGN+TYL+VAE+VFDWLVD+ +VV+ + ANVFDGA ID N
Sbjct: 186 YKNTVSNACLFQIAARLGRYTGNSTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTN 245

Query: 239 CTSIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQ 298
           CT I K EW+YNHG+VLGG AYMYNATNG+  W+TR  QIL GA ++FF+D IMYES CQ
Sbjct: 246 CTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETRLTQILNGAKAYFFKDTIMYESACQ 305

Query: 299 ASNKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGL 358
             + CNTDQR FK+IFSRMLG TSV+APFT+DTI  LI TS     KSC+GGTDGHTCGL
Sbjct: 306 DYSTCNTDQRTFKSIFSRMLGLTSVMAPFTSDTIDDLIKTSAEAAAKSCNGGTDGHTCGL 365

Query: 359 NWFTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQ 418
           +W     DG YGLGEQ  ALE+I  LL+HD PAP  ES            +N STTNVLQ
Sbjct: 366 DWGKQTHDGYYGLGEQMSALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQ 425

Query: 419 KNINITAGDK 428
            N+NIT G +
Sbjct: 426 NNLNITKGGR 435

>NDAI0K00840 Chr11 complement(190148..191527) [1380 bp, 459 aa] {ON}
           Anc_8.773
          Length = 459

 Score =  614 bits (1584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/427 (68%), Positives = 339/427 (79%), Gaps = 2/427 (0%)

Query: 6   LYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEA 65
            + L LTV +  AIDLD +SK SIC AT+LIQ G+ DYY G  YGGTVGMF  PYYWWEA
Sbjct: 14  FFQLLLTVHNTQAIDLDITSKESICDATSLIQGGMMDYYWGTQYGGTVGMFQPPYYWWEA 73

Query: 66  GLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMT 125
           G  FGGMIENWYLCQN +YEDML  AL+AQTGS+YDY+P+NQ+MVEGNDDQGVW LT+M 
Sbjct: 74  GEAFGGMIENWYLCQNDTYEDMLKSALLAQTGSNYDYIPANQSMVEGNDDQGVWGLTLMG 133

Query: 126 AVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISN 185
           A ERNFT+P +DGTPGWLAM QAVFN M +RWDS HC GGLRWQIFTWNSGYNYKNTISN
Sbjct: 134 AAERNFTDP-DDGTPGWLAMTQAVFNTMNARWDSAHCGGGLRWQIFTWNSGYNYKNTISN 192

Query: 186 GCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKY 245
            CLFQLAARLGRYTGNTTYLEVAEKVF WLVD+ +V++ + ANVFDGA ID NCT + + 
Sbjct: 193 ACLFQLAARLGRYTGNTTYLEVAEKVFTWLVDVGYVLLDDTANVFDGAEIDSNCTDMTQI 252

Query: 246 EWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDD-IMYESTCQASNKCN 304
           EW+YNHGVVLGG AYMYNATNGS  W++R  ++L GAT++FF+ + IM+E+ CQ  N CN
Sbjct: 253 EWTYNHGVVLGGAAYMYNATNGSSDWESRVTKLLKGATTYFFDSNGIMFENACQEYNTCN 312

Query: 305 TDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGD 364
            DQR FK+IFSRMLG TSVLAPFT+DT+ PLI TS     KSC+GGTDGHTCGLNW  G 
Sbjct: 313 NDQRSFKSIFSRMLGLTSVLAPFTSDTVDPLIKTSAAAAAKSCTGGTDGHTCGLNWAKGS 372

Query: 365 WDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINIT 424
            DG YGLGEQ CALE++  LL+HD PAPLT +T           LN +TTNVL+  + IT
Sbjct: 373 HDGYYGLGEQMCALEVMQNLLIHDRPAPLTGNTGGSSKGDALAGLNSTTTNVLENKMTIT 432

Query: 425 AGDKAGA 431
            GD+AGA
Sbjct: 433 NGDRAGA 439

>Smik_13.446 Chr13 (730295..731671) [1377 bp, 458 aa] {ON} YMR238W
           (REAL)
          Length = 458

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/430 (67%), Positives = 338/430 (78%), Gaps = 3/430 (0%)

Query: 1   MKISPL--YSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVS 58
           M++ PL  ++L        A++LD++SK+SIC ATALIQ G+ DYYEG  YGG VGMF S
Sbjct: 7   MEMIPLICFTLLSFFRICHAMELDSTSKTSICDATALIQDGMLDYYEGTRYGGAVGMFQS 66

Query: 59  PYYWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGV 118
           PYYWW AG  FGGM+ENW+LC+N +Y+++LYDAL+AQTGS+YDY+P+NQTMVEGNDDQG+
Sbjct: 67  PYYWWHAGEAFGGMLENWFLCENDTYQELLYDALLAQTGSNYDYIPANQTMVEGNDDQGI 126

Query: 119 WALTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYN 178
           W +TVM AVERNFT+P  DG PGWLAMVQAVFN MYSRWDS+HC GGLRWQIFTWNSGYN
Sbjct: 127 WGITVMGAVERNFTDPS-DGKPGWLAMVQAVFNTMYSRWDSEHCGGGLRWQIFTWNSGYN 185

Query: 179 YKNTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDN 238
           YKNTISN CLFQ+AARLGRYTGNTTYL+VAE+VFDWLVD+ +VV+ + ANVFDGA ID N
Sbjct: 186 YKNTISNACLFQIAARLGRYTGNTTYLDVAEQVFDWLVDVGYVVLNDTANVFDGAEIDTN 245

Query: 239 CTSIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQ 298
           CT I K EW+YNHG+VLGG AYMYNATNG+  W+T   +IL GA S+FF+D IMYES CQ
Sbjct: 246 CTDITKIEWTYNHGIVLGGLAYMYNATNGTSEWETSLTKILNGAKSYFFKDSIMYESACQ 305

Query: 299 ASNKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGL 358
             + CNTDQR FK+IFSRMLG TSV+AP+T+DTI  LI TS     KSC GG DGHTCGL
Sbjct: 306 DYSTCNTDQRTFKSIFSRMLGLTSVMAPYTSDTIDDLIKTSAEAAAKSCDGGRDGHTCGL 365

Query: 359 NWFTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQ 418
           NW     DG YGLGEQ  ALE+I  LL+HD PAP  ES            +N STTNVLQ
Sbjct: 366 NWGKQTNDGYYGLGEQMNALEVIQNLLIHDRPAPYKESNGGTSKGDANAGMNSSTTNVLQ 425

Query: 419 KNINITAGDK 428
            N+NI  GD+
Sbjct: 426 NNLNIKNGDR 435

>Kwal_55.20266 s55 complement(327537..328910) [1374 bp, 457 aa] {ON}
           YMR238W (DFG5) - involved in pseudohyphal growth [contig
           152] FULL
          Length = 457

 Score =  597 bits (1539), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/454 (64%), Positives = 333/454 (73%), Gaps = 5/454 (1%)

Query: 1   MKISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPY 60
           M +  L ++F + VS  AIDLDTSSK SIC AT+LIQ+G+ DYYEG+ +GGTVGMF  PY
Sbjct: 6   MALGALGAVFTSQVS--AIDLDTSSKDSICDATSLIQKGVMDYYEGNRFGGTVGMFQQPY 63

Query: 61  YWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWA 120
           YWWEAG VFGGM+ENW+LCQN +YE  LYDA++AQ G DYD+MPSNQ+MVEGNDDQGVW 
Sbjct: 64  YWWEAGEVFGGMMENWFLCQNDTYEKTLYDAMIAQAGPDYDFMPSNQSMVEGNDDQGVWG 123

Query: 121 LTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYK 180
           LT+M+AVERNFTNP E G PGWLAMVQ VFN M+SRWDSDHC GGLRWQIFTWNSGYNYK
Sbjct: 124 LTLMSAVERNFTNPTEKGVPGWLAMVQGVFNTMWSRWDSDHCGGGLRWQIFTWNSGYNYK 183

Query: 181 NTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEE--ANVFDGATIDDN 238
           NT+SN CLFQLAARLGRYTGN TYL  AE V++WLVDI FV   E   ANV+DGATID N
Sbjct: 184 NTVSNACLFQLAARLGRYTGNETYLTKAETVWNWLVDIGFVRFNESGNANVYDGATIDKN 243

Query: 239 CTSIVKYEWSYNHGVVLGGCAYMYNAT-NGSDVWQTRTEQILGGATSFFFEDDIMYESTC 297
           CT IV+ EWSYN G+VLGG AYMYNAT NG+  W++R  QI+GG+T  FF + IMYE+TC
Sbjct: 244 CTDIVEIEWSYNQGIVLGGAAYMYNATHNGTSDWESRLNQIVGGSTDIFFRNKIMYEATC 303

Query: 298 QASNKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCG 357
           Q S KCN DQR FK+IFSRML  T  LAP+T D I PL+  S     KSC+GGTDGHTCG
Sbjct: 304 QDSGKCNQDQRSFKSIFSRMLSLTRTLAPYTADKIDPLMKASAEGAAKSCTGGTDGHTCG 363

Query: 358 LNWFTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVL 417
           LNW  G+ DG YGLGEQACALE I   L    PAP T              LN ++TNVL
Sbjct: 364 LNWEKGEHDGWYGLGEQACALEGIQSQLYSMRPAPYTADNGGTSVGDTEAGLNKTSTNVL 423

Query: 418 QKNINITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
             ++NIT  DK GA                WM+ 
Sbjct: 424 HSDLNITQKDKVGASIITAVLLAVLVGGSIWMIF 457

>KLTH0E04048g Chr5 complement(369100..370464) [1365 bp, 454 aa] {ON}
           similar to uniprot|Q05031 Saccharomyces cerevisiae
           YMR238W DFG5 Mannosidase essential
           glycosylphosphatidylinositol (GPI)-anchored membrane
           protein required for cell wall biogenesis involved in
           filamentous growth homologous to Dcw1p
          Length = 454

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/444 (63%), Positives = 326/444 (73%), Gaps = 3/444 (0%)

Query: 11  LTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFG 70
           L +  +L IDLDTS  SSIC AT+LIQ GI DYY G   GGTVGMF  PYYWWEAG VFG
Sbjct: 11  LLLQPILGIDLDTSDSSSICDATSLIQGGIMDYYAGTRIGGTVGMFQQPYYWWEAGEVFG 70

Query: 71  GMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERN 130
           GM+ENW+LCQN +Y D++YDA++ Q G DYD+MPSNQ+MVEGNDDQGVW LTVM+A ERN
Sbjct: 71  GMLENWFLCQNDTYHDIIYDAMIHQAGPDYDFMPSNQSMVEGNDDQGVWGLTVMSAAERN 130

Query: 131 FTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQ 190
           FTNP EDG PGWLAM Q VFN M+ RWDS+HC GG+RWQIFTWNSGYNYKNT+SN C+FQ
Sbjct: 131 FTNPTEDGVPGWLAMAQGVFNTMWMRWDSEHCGGGVRWQIFTWNSGYNYKNTVSNACMFQ 190

Query: 191 LAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKE--EANVFDGATIDDNCTSIVKYEWS 248
           LAARLGRYTGN TYL  AE V+DWLVD+ FVV+ E   ANV+DGA IDDNCT IVK EWS
Sbjct: 191 LAARLGRYTGNDTYLTKAETVWDWLVDVGFVVLNENGNANVYDGANIDDNCTDIVKNEWS 250

Query: 249 YNHGVVLGGCAYMYNAT-NGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTDQ 307
           YN G+VLGG AYMYNAT N + VW++R +QI+GG+T FFF+D +MYESTCQ S  CN DQ
Sbjct: 251 YNQGIVLGGAAYMYNATQNDTSVWKSRLDQIVGGSTEFFFKDKVMYESTCQDSKTCNQDQ 310

Query: 308 RVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWDG 367
           R FK+IFSRML  T  LAP+T +TI PL++ S     KSC+GGTDGHTCGLNW  G  DG
Sbjct: 311 RSFKSIFSRMLSLTRSLAPYTAETIDPLMEASAEGAAKSCTGGTDGHTCGLNWQLGYHDG 370

Query: 368 QYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITAGD 427
            YGLGEQACALE I  L+    PAP T              LN ++TNVLQ +I IT  D
Sbjct: 371 YYGLGEQACALEGIQSLMYSKRPAPYTSDNGGSSVGDTEAALNSTSTNVLQSDIKITHKD 430

Query: 428 KAGAXXXXXXXXXXXXXXXXWMVL 451
           K GA                WM+ 
Sbjct: 431 KVGASIITAVILAVLVGGSIWMIF 454

>CAGL0M05049g Chr13 (547489..548850) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046c or
           uniprot|Q05031 Saccharomyces cerevisiae YMR238w DFG5
          Length = 453

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/434 (63%), Positives = 327/434 (75%), Gaps = 2/434 (0%)

Query: 18  AIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFGGMIENWY 77
           AI+L   +K SIC ATALIQ G+ DYYEG  YGGTVGMF  PYYWW+AG+ FGGM+ENW+
Sbjct: 22  AINLQ-DNKDSICAATALIQGGMLDYYEGTRYGGTVGMFQPPYYWWQAGVAFGGMLENWF 80

Query: 78  LCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERNFTNPKED 137
           LCQN +Y+D+L +AL+AQTG +YDY+P+NQT VEGNDDQGVW LT++ AVERNF+ P  D
Sbjct: 81  LCQNDTYKDLLMNALVAQTGPNYDYIPANQTTVEGNDDQGVWGLTILDAVERNFSAPI-D 139

Query: 138 GTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQLAARLGR 197
           G PGWLAM Q +FN MY+RWD   CNGGLRWQIFTWNSGYNYKNTISN CLFQ+AARLGR
Sbjct: 140 GKPGWLAMSQGIFNTMYARWDMQSCNGGLRWQIFTWNSGYNYKNTISNACLFQIAARLGR 199

Query: 198 YTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKYEWSYNHGVVLGG 257
           YTGNTTYL+VAE+VFDWLV + ++V+ E+ NV+DGA ++DNCT I   EW+YNHGVVLGG
Sbjct: 200 YTGNTTYLDVAERVFDWLVGVGYIVLSEKGNVYDGAKVEDNCTDITAIEWTYNHGVVLGG 259

Query: 258 CAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTDQRVFKAIFSRM 317
            AYMYNATNGS VWQ+R   +LGGAT++FF+DDIMYES CQ    CN DQR FK+IFSRM
Sbjct: 260 LAYMYNATNGSSVWQSRLTSVLGGATAYFFQDDIMYESACQPYKTCNNDQRCFKSIFSRM 319

Query: 318 LGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWDGQYGLGEQACA 377
           LG+TSVLAPFT+DTI PL+  S      SC GGTDGHTCGL+W     DG YGLGEQ  A
Sbjct: 320 LGFTSVLAPFTSDTIDPLLKASAMAAAGSCDGGTDGHTCGLDWQLKTNDGYYGLGEQMSA 379

Query: 378 LEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITAGDKAGAXXXXXX 437
           LE+I QLL+H+ PAP                LN +TTNVL+ N+ IT GD+AGA      
Sbjct: 380 LEVIQQLLIHERPAPYRADNGGTSVGDAAAGLNSTTTNVLKNNLKITGGDRAGAAIVTTI 439

Query: 438 XXXXXXXXXXWMVL 451
                     WM+ 
Sbjct: 440 VLGIIIGGAAWMMF 453

>KAFR0B03490 Chr2 (723671..725026) [1356 bp, 451 aa] {ON} Anc_8.773
           YMR238W
          Length = 451

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/454 (62%), Positives = 336/454 (74%), Gaps = 6/454 (1%)

Query: 1   MKISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPY 60
           M I+ L+ L LTV    AIDLDTSSK+SIC ATALIQ G+ DYYEG  YGGTVGMF SPY
Sbjct: 1   MMITLLFPLLLTVAK--AIDLDTSSKTSICDATALIQDGMLDYYEGIRYGGTVGMFQSPY 58

Query: 61  YWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWA 120
           YWWEAG  FGGM+ENW+LC+N ++++++YDA++AQTGSDYD+MP NQTMVEGNDDQ VW 
Sbjct: 59  YWWEAGEAFGGMLENWFLCENDTFKEIIYDAILAQTGSDYDFMPENQTMVEGNDDQCVWG 118

Query: 121 LTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYK 180
           LT+M AVERNFT+P  DG+PGWL M QA+FN+M+SRWDS +C GGLRWQIFTWNSGY+YK
Sbjct: 119 LTIMDAVERNFTDPT-DGSPGWLYMTQAIFNEMWSRWDSANCGGGLRWQIFTWNSGYDYK 177

Query: 181 NTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFV-VMKEEANVFDGATIDDNC 239
           +TISN CLFQLA+RLGRYTGN TYL+VAE V+DWLVD+ F+ V    A V+DGA I +NC
Sbjct: 178 STISNVCLFQLASRLGRYTGNDTYLDVAESVYDWLVDVGFINVANGTAYVYDGADISENC 237

Query: 240 TSIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQA 299
           T I   +WSYNHG++LGG AY YNATNGS VW++R   I+ GA S FF D IMYES CQ 
Sbjct: 238 TDITTIDWSYNHGILLGGAAYAYNATNGSSVWESRVTDIVEGAKSIFFSDGIMYESACQD 297

Query: 300 SNKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLN 359
            + CN DQR FK+IFSRMLG+TSVLAPFT  TI PLI +S      SC GGTDGHTCGLN
Sbjct: 298 YDTCNNDQRSFKSIFSRMLGFTSVLAPFTASTIDPLIKSSAAACALSCDGGTDGHTCGLN 357

Query: 360 WFTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTT--NVL 417
           W     DG YGLGEQ  ALE+I  LL+HD PAP T ST           LN +T+  +VL
Sbjct: 358 WQDKTCDGNYGLGEQMSALEVIQNLLIHDRPAPYTASTGGSSVGDASAGLNTTTSSADVL 417

Query: 418 QKNINITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
           + N+ IT+ D+AGA                WM+ 
Sbjct: 418 ENNLTITSKDRAGAAIITAVILGCMAGGAIWMLF 451

>ZYRO0F12210g Chr6 (992529..993890) [1362 bp, 453 aa] {ON} similar
           to uniprot|Q05031 Saccharomyces cerevisiae YMR238W DFG5
           Mannosidase essential glycosylphosphatidylinositol
           (GPI)-anchored membrane protein required for cell wall
           biogenesis involved in filamentous growth homologous to
           Dcw1p
          Length = 453

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/445 (60%), Positives = 321/445 (72%), Gaps = 3/445 (0%)

Query: 9   LFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLV 68
           L  ++  + A+DL    K S+C+ATALIQQG+ DYY GD YGG +GMF  PYYWW+AG  
Sbjct: 10  LVFSLSPIWAVDLQVGDKDSVCSATALIQQGMLDYYAGDKYGGAIGMFQPPYYWWQAGEA 69

Query: 69  FGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVE 128
           FGGMI+NW+ C+N ++E+++ +A++ Q G  YDYMP NQTMVEGNDDQGVW LTVM AVE
Sbjct: 70  FGGMIDNWHFCKNNTFEELIREAMLTQAGPHYDYMPQNQTMVEGNDDQGVWGLTVMEAVE 129

Query: 129 RNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCL 188
           RNFT+P  DG PGWLAM QAVFN++  RWD   C GG+RWQIFTWNSGYNYKNTISNGC 
Sbjct: 130 RNFTDPG-DGKPGWLAMAQAVFNEINERWDDKSCAGGVRWQIFTWNSGYNYKNTISNGCY 188

Query: 189 FQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKYEWS 248
           FQLAARLGRYT N TYLEVAEKVFDWL D+ FVV+K++ NVFDGA  DDNCT + + EW+
Sbjct: 189 FQLAARLGRYTNNQTYLEVAEKVFDWLTDVGFVVLKDKGNVFDGAVTDDNCTQVTELEWT 248

Query: 249 YNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQA--SNKCNTD 306
           YNHG++LGG AYMYNATNGS  W+ R  QIL GA+ +FF+D++MYES CQ   S+ CN D
Sbjct: 249 YNHGIILGGSAYMYNATNGSSKWEERVNQILNGASDYFFQDNVMYESGCQHGDSSNCNND 308

Query: 307 QRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWD 366
           QR FK+IFSRMLG TSVL P  +D +  L++ S     KSCSGG DGHTCGLNWF G WD
Sbjct: 309 QRSFKSIFSRMLGLTSVLVPSVSDKVDQLLNASAEGAAKSCSGGIDGHTCGLNWFKGSWD 368

Query: 367 GQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITAG 426
            QYGLGEQ  ALE+I   L+H+   P  EST           LN +TTNVLQK + I + 
Sbjct: 369 NQYGLGEQMSALEVIQNTLIHNSDPPYRESTGGSSKGDSAAGLNTTTTNVLQKKLKIQSK 428

Query: 427 DKAGAXXXXXXXXXXXXXXXXWMVL 451
           D+AGA                WM+ 
Sbjct: 429 DRAGAAIITGVVLMVVVGGSVWMLF 453

>KNAG0J00700 Chr10 complement(121298..122689) [1392 bp, 463 aa] {ON}
           Anc_8.773 YMR238W
          Length = 463

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/441 (61%), Positives = 323/441 (73%), Gaps = 7/441 (1%)

Query: 11  LTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFG 70
            T  S L++D        +C+ATAL+  G+ DYY G  YGGTVGMF  PYYWW AG  FG
Sbjct: 30  FTGASALSLD-------PVCSATALVTDGLLDYYSGTRYGGTVGMFQPPYYWWHAGEAFG 82

Query: 71  GMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERN 130
           GMIENW+LCQN++YE +L DA +AQTG++YDY+P NQTMVEGNDDQG+W LT+M AVERN
Sbjct: 83  GMIENWFLCQNSTYETLLMDAFIAQTGNNYDYIPENQTMVEGNDDQGIWGLTIMDAVERN 142

Query: 131 FTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQ 190
           FT P +DG PGWLAM QAVFN M++RWD+ HC GGLRWQIFTWNSGYNYKNTISN CLF 
Sbjct: 143 FTKPTKDGVPGWLAMSQAVFNTMWARWDTQHCGGGLRWQIFTWNSGYNYKNTISNACLFN 202

Query: 191 LAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKYEWSYN 250
           LAARLGRYTGN+TYL+VA++VFDW+V + +VV+ + ANVFDGA I+DNCT+I  +EWSYN
Sbjct: 203 LAARLGRYTGNSTYLDVADQVFDWMVSVGYVVLGDTANVFDGANIEDNCTTITTFEWSYN 262

Query: 251 HGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTDQRVF 310
           HGVVLGG A+MYNATNGS VW+ R  +IL GAT++FF D IM+ES CQ + KCN DQR F
Sbjct: 263 HGVVLGGTAFMYNATNGSSVWEDRVNRILKGATTYFFRDSIMFESACQDTGKCNNDQRTF 322

Query: 311 KAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWDGQYG 370
           KAIFSRML +T+VL P T  TI PL+ +S     +SCSGGTDGHTCGLNW    WDG YG
Sbjct: 323 KAIFSRMLSFTAVLVPSTASTIDPLMQSSAQAAAQSCSGGTDGHTCGLNWQHSGWDGMYG 382

Query: 371 LGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITAGDKAG 430
           LGEQ  ALE++N LLVHD PAP T +            LN + TNV   ++NI   DKAG
Sbjct: 383 LGEQMSALEVMNYLLVHDRPAPYTAAAGGSSVGDASAGLNSTATNVFANSLNIRGKDKAG 442

Query: 431 AXXXXXXXXXXXXXXXXWMVL 451
           A                WM+ 
Sbjct: 443 AAIVTTVILGTLAGGSIWMLF 463

>Kpol_1030.20 s1030 complement(37060..38049,38052..38417) [1356 bp,
           451 aa] {ON} complement(37060..38049,38052..38417) [1356
           nt, 452 aa]
          Length = 451

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/451 (61%), Positives = 333/451 (73%), Gaps = 2/451 (0%)

Query: 1   MKISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPY 60
           + ++ L   F  + +V AIDLD +SK SIC AT+LIQ G+ DYYEG  YGGTVGMF  PY
Sbjct: 3   LLLTVLLQAFNFITTVTAIDLDVNSKDSICAATSLIQGGMLDYYEGTRYGGTVGMFQPPY 62

Query: 61  YWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWA 120
           YWWEAG  FGGMIENW+LCQN +Y D++YDAL+AQTGS+YDY+P+NQT VE    + V+ 
Sbjct: 63  YWWEAGEAFGGMIENWFLCQNDTYHDIIYDALLAQTGSNYDYVPANQTFVEVMMIK-VFG 121

Query: 121 LTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYK 180
            TVM A ERNFT P  DG P WLAM QAVFN MY+RWDS +C GGLRWQI+TWNSGYNYK
Sbjct: 122 GTVMDAAERNFTAP-SDGKPDWLAMAQAVFNTMYARWDSANCGGGLRWQIYTWNSGYNYK 180

Query: 181 NTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCT 240
           NT+SN CLFQ+AARLGRYTGN TYLEVAEKVFDWLVD++FVV+ +EANVFDGA I  NC+
Sbjct: 181 NTVSNACLFQIAARLGRYTGNDTYLEVAEKVFDWLVDVNFVVLNDEANVFDGANITSNCS 240

Query: 241 SIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQAS 300
           ++VK EWSYNHG+VLGG AYMYNATNG+  W++   ++L GA S FF+++IMYE  CQ  
Sbjct: 241 AVVKLEWSYNHGIVLGGLAYMYNATNGTSKWESGLTKVLNGAKSIFFKNNIMYEQACQDH 300

Query: 301 NKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNW 360
           N CNTDQR FK+IFSRMLG TSVLAP+T+DTITPLI  S     KSC GGTDGHTCGLNW
Sbjct: 301 NTCNTDQRSFKSIFSRMLGLTSVLAPYTSDTITPLIQASAEGAAKSCDGGTDGHTCGLNW 360

Query: 361 FTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKN 420
             G  DG+YGLGEQ CALEI++ LL+ + PAP T              LN ++T+VL  N
Sbjct: 361 NLGTNDGKYGLGEQMCALEIMSNLLILNRPAPYTMHNGGTSVGDPSAGLNATSTSVLSNN 420

Query: 421 INITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
           ++I   D+AGA                WM+ 
Sbjct: 421 LDIKQKDRAGAAIVTAVILFVLLGGSVWMLF 451

>TDEL0B03360 Chr2 complement(601081..602391) [1311 bp, 436 aa] {ON}
           Anc_8.773 YMR238W
          Length = 436

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/437 (64%), Positives = 323/437 (73%), Gaps = 3/437 (0%)

Query: 17  LAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFGGMIENW 76
           + +DLD SSK SIC ATALIQ+G+ DYYEG   GGTVGMF SPYYWW+AG  FGGMI+NW
Sbjct: 1   MGLDLDPSSKDSICYATALIQKGMLDYYEGTRIGGTVGMFQSPYYWWQAGEAFGGMIDNW 60

Query: 77  YLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERNFTNPKE 136
           Y C+NT++E ++YD ++AQTG  YDYMP NQTMVEGNDDQGVW LT+M AVERNFTNP  
Sbjct: 61  YFCENTTFESLIYDGMLAQTGPHYDYMPENQTMVEGNDDQGVWGLTLMGAVERNFTNPT- 119

Query: 137 DGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQLAARLG 196
           +G PGWLAM QA+FNQ+ SRWD+ +C GGLRWQIFTWN GYNYKNTISN CLFQ+AARLG
Sbjct: 120 NGAPGWLAMAQAIFNQLNSRWDTANCGGGLRWQIFTWNGGYNYKNTISNACLFQIAARLG 179

Query: 197 RYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKYEWSYNHGVVLG 256
           RYTGN TYLEVAE VFDWLVD+ +VV+K+  NVFDGA ID+NCTSI K EWSYNHGVVLG
Sbjct: 180 RYTGNDTYLEVAENVFDWLVDVGYVVLKDVGNVFDGAEIDNNCTSINKLEWSYNHGVVLG 239

Query: 257 GCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQ--ASNKCNTDQRVFKAIF 314
           G A+MYNATNGS  W+TR  QILGGA S+FF+D IMYES CQ   ++ CN+DQR FKAIF
Sbjct: 240 GLAFMYNATNGSSEWETRVTQILGGAESYFFKDSIMYESLCQGDGTSTCNSDQRSFKAIF 299

Query: 315 SRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWDGQYGLGEQ 374
           SRMLG TSVL P T   +  L+  S      SCSGGTDGHTCGLNW     DG YGLGEQ
Sbjct: 300 SRMLGLTSVLVPSTQSKVDDLLKQSALAAAASCSGGTDGHTCGLNWNKQANDGYYGLGEQ 359

Query: 375 ACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITAGDKAGAXXX 434
             ALE++ QLL+H   AP TE T           LN S+ NVLQ  ++I   D+AGA   
Sbjct: 360 MSALEVMQQLLIHQKAAPFTEQTGGSSAGDANAGLNTSSANVLQNQLDIQTKDRAGAAII 419

Query: 435 XXXXXXXXXXXXXWMVL 451
                        WM+ 
Sbjct: 420 TAVILMVLVGGSIWMLF 436

>TBLA0B03320 Chr2 complement(774913..776265) [1353 bp, 450 aa] {ON}
           Anc_8.773 YMR238W
          Length = 450

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/452 (61%), Positives = 323/452 (71%), Gaps = 3/452 (0%)

Query: 1   MKISPLYSLFLTVVS-VLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSP 59
           M ++ L    L+ VS   A+DLDTSSK SIC AT+LI +G+ DYY G  YGGTVGMF  P
Sbjct: 1   MILNELILSALSFVSFTFAMDLDTSSKESICGATSLIIKGMLDYYWGTQYGGTVGMFQPP 60

Query: 60  YYWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVW 119
           YYWWEAG  FGGM+ENWYLCQN +Y D+L+DAL AQTG DYDY+P NQTMVEGNDDQ +W
Sbjct: 61  YYWWEAGEAFGGMLENWYLCQNDTYADLLFDALTAQTGPDYDYIPQNQTMVEGNDDQCIW 120

Query: 120 ALTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNY 179
            LTVM AVERNFTNP E   PGWLAM QAVFN M+SRWD+  C GGLRWQIFTWNSGY+Y
Sbjct: 121 GLTVMDAVERNFTNPTEG--PGWLAMGQAVFNTMWSRWDAADCGGGLRWQIFTWNSGYDY 178

Query: 180 KNTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNC 239
           KNTISN CLFQ+AARLGRYTGN TYL+VA  VFDWL  + +V M   A V+DGA I +NC
Sbjct: 179 KNTISNACLFQMAARLGRYTGNNTYLDVANDVFDWLTGVGYVNMDNAAEVYDGADISENC 238

Query: 240 TSIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQA 299
           T I KY+WSYN+G +LGG AYMYNATNGS +W+TR  Q+L GA ++FF+DDIMYES CQ 
Sbjct: 239 TDITKYQWSYNNGCMLGGAAYMYNATNGSSIWETRVTQLLNGAKAYFFQDDIMYESACQT 298

Query: 300 SNKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLN 359
           +  CN DQR FK++FSRMLG+TSVL P T D I PLI  S     ++C+GGTDGHTCGLN
Sbjct: 299 AKTCNNDQRSFKSLFSRMLGFTSVLVPSTRDIIDPLILASAQGAARTCNGGTDGHTCGLN 358

Query: 360 WFTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQK 419
           W     DG YGLGEQ  ALE+I  LL+HD PAP T              LN ++ NVL  
Sbjct: 359 WQASTHDGYYGLGEQMSALEVIQNLLIHDRPAPYTSIDGGSSEGDANAGLNKTSKNVLSN 418

Query: 420 NINITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
           +++I  GDK GA                WM+ 
Sbjct: 419 DLDIKTGDKVGAAILTAGVLAILVGGAIWMLF 450

>TPHA0J01600 Chr10 complement(371534..372919) [1386 bp, 461 aa] {ON}
           Anc_8.773 YMR238W
          Length = 461

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/458 (60%), Positives = 331/458 (72%), Gaps = 14/458 (3%)

Query: 6   LYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEA 65
           L  L   ++   AI LD  SK S+C ATALIQ+G+ DYY+G  YGGTVGMF  PYYWWEA
Sbjct: 6   LLGLISQILYASAITLDVDSKDSVCEATALIQKGMLDYYQGTRYGGTVGMFQPPYYWWEA 65

Query: 66  GLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMT 125
           G  FGGM+ENWYLCQN ++E ++ DAL+ Q GS+YDY+PSNQT+VEGNDDQGVW LTV+ 
Sbjct: 66  GEAFGGMLENWYLCQNDTFESLISDALIYQAGSNYDYIPSNQTLVEGNDDQGVWGLTVLG 125

Query: 126 AVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISN 185
           AVERN   P  DG PGWLA+ QAVFN MY+RWD+ +C GGLRWQI+TWNSGYNYKNTISN
Sbjct: 126 AVERNL--PDRDGVPGWLAISQAVFNTMYARWDTAYCGGGLRWQIYTWNSGYNYKNTISN 183

Query: 186 GCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKY 245
            CLFQ+AARLGRYTGN TYLEVAEKVFDW+VD++++V+K+ ANV+DGAT + NC+ IV+Y
Sbjct: 184 ACLFQIAARLGRYTGNNTYLEVAEKVFDWMVDVEYIVLKDVANVYDGATTNYNCSDIVQY 243

Query: 246 EWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNT 305
           EWSYNHGVVLGG AYMYNATNG+  W+T   Q+L GAT++FF+++IMYES CQ +  CNT
Sbjct: 244 EWSYNHGVVLGGLAYMYNATNGTSKWETALTQVLSGATTYFFKNNIMYESACQEAKTCNT 303

Query: 306 DQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDW 365
           DQR FK+IFSRMLGYT VLAP+T  T+  LI+TS      SC GGTDG TCGL+WF    
Sbjct: 304 DQRSFKSIFSRMLGYTRVLAPYTAATLDTLIETSAKAAAGSCDGGTDGVTCGLSWFDSTN 363

Query: 366 DGQYGLGEQACALEIINQLLVHDLPAPLTESTXXX------------XXXXXXXXLNVST 413
           DG YGLGEQ  ALEIINQLLV    A    ++                       LN ++
Sbjct: 364 DGYYGLGEQMSALEIINQLLVSSSGAAAEAASSGSASSPYTSSSGGNSTGDASAGLNTTS 423

Query: 414 TNVLQKNINITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
           TNVLQ N++I + DKAGA                WM+ 
Sbjct: 424 TNVLQNNLDIESKDKAGAAVATAVILAVLVGGSVWMLF 461

>Ecym_1474 Chr1 (976393..977757) [1365 bp, 454 aa] {ON} similar to
           Ashbya gossypii AFR530W
          Length = 454

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/451 (59%), Positives = 317/451 (70%), Gaps = 2/451 (0%)

Query: 3   ISPLYSLFLTVVSVL--AIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPY 60
           I  LYSL L +   +   + LD  SK SIC AT  IQ+GI DYY G   GG VGMF+ PY
Sbjct: 4   IVQLYSLLLLICVPVCGGLQLDVKSKDSICAATQKIQRGIMDYYWGSTPGGIVGMFIQPY 63

Query: 61  YWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWA 120
           YWWEAGLVF GM+ENWYLC N  Y   LY++++AQTG++YDY+PSNQ+M EGNDDQG+W 
Sbjct: 64  YWWEAGLVFAGMLENWYLCDNMEYNSTLYESMIAQTGANYDYIPSNQSMTEGNDDQGIWG 123

Query: 121 LTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYK 180
           L +M AVERNF + +    PGWL M QAVFN MY+RWDS HC GGLRWQIFTWN GY+YK
Sbjct: 124 LFIMGAVERNFPDAQMGNVPGWLTMAQAVFNTMYARWDSQHCGGGLRWQIFTWNLGYDYK 183

Query: 181 NTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCT 240
           NTI+NGCLFQLAARLGRYTGN+TYL++A + F WLVD+ FVV+K+EANVFDGA I DNC 
Sbjct: 184 NTIANGCLFQLAARLGRYTGNSTYLDIANETFSWLVDVKFVVLKDEANVFDGAHIGDNCQ 243

Query: 241 SIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQAS 300
            I   EW+YNHGV+LGGCAYMYNATNG  VW+TR  QILGGA +FFF ++IMYE  CQ +
Sbjct: 244 DIKGIEWTYNHGVILGGCAYMYNATNGDPVWETRLRQILGGARAFFFRNNIMYERACQDN 303

Query: 301 NKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNW 360
             CN DQR FK+IFSRML  TSVLAPFT +TI PL++ S      SCSGG DG TCGL+W
Sbjct: 304 KICNNDQRSFKSIFSRMLAVTSVLAPFTRETIDPLLEASAAAAAASCSGGKDGETCGLDW 363

Query: 361 FTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKN 420
            TG WDG YGLGEQA ALE+I  LL+H    PLT++            L     NVL   
Sbjct: 364 TTGSWDGYYGLGEQASALEVIQNLLIHTKAPPLTKNAGGTSNGDPGAGLGTPMDNVLHSR 423

Query: 421 INITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
           +NI + D+  A                WMV+
Sbjct: 424 LNIGSKDRIKAALITAVCLGLLVGTALWMVI 454

>AFR530W Chr6 (1388049..1389428) [1380 bp, 459 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5)
          Length = 459

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/449 (56%), Positives = 309/449 (68%), Gaps = 3/449 (0%)

Query: 6   LYSLFLTVVSVL--AIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWW 63
           L  LFL +  +L  A+DLD SS+  +C  T  IQ+GI DYY G  YGG VGMF  PYYWW
Sbjct: 11  LVGLFLLMQGMLSRALDLDLSSREDVCHFTNEIQKGIMDYYWGSKYGGIVGMFQPPYYWW 70

Query: 64  EAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTV 123
           EAG VFGGM+ENWYLC N  YE +L ++++AQTG  +DY+P+NQ+  EGNDDQGVWAL +
Sbjct: 71  EAGEVFGGMLENWYLCDNQEYESVLRESMIAQTGDKFDYIPANQSTTEGNDDQGVWALFI 130

Query: 124 MTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTI 183
           M AVERNF +P+++G PGWL MVQ VFN+M +RWD+++C GGLRWQIF WN+GY YKNTI
Sbjct: 131 MGAVERNFKDPEKEGMPGWLTMVQTVFNKMEARWDAENCGGGLRWQIFQWNNGYTYKNTI 190

Query: 184 SNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIV 243
           +NGCLFQLAARLGRYTGN TYL+VA KVF WLVD+ ++V++++A VFDGA I +NC+ I 
Sbjct: 191 ANGCLFQLAARLGRYTGNQTYLDVASKVFQWLVDVKYIVLEDKARVFDGAHIHENCSDIK 250

Query: 244 KYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKC 303
             EWSYNHG++L G AYMYNAT GS  W++   +IL GA  F+F D IMYE  CQ  N C
Sbjct: 251 GIEWSYNHGIILAGAAYMYNATGGSPEWESHVTKILAGAADFYFRDKIMYERACQDYNTC 310

Query: 304 NTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTG 363
           + DQR FK+IFSRML  TSV+APFT  TI  LI  S     KSC  GT G+TCGLNW  G
Sbjct: 311 DNDQRSFKSIFSRMLAITSVVAPFTRGTIDELIYASATAASKSCEQGTHGYTCGLNWHKG 370

Query: 364 DWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNV-STTNVLQKNIN 422
            +DG YGLGEQA ALEII  +L+H    PLT  T           L+  S   +L+   N
Sbjct: 371 TYDGVYGLGEQASALEIIQNVLIHTKAPPLTADTGGQSEGNPDAGLDHDSQPAILRGMHN 430

Query: 423 ITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
           IT  D+ GA                WM+ 
Sbjct: 431 ITGKDRVGASLITAISLGLMLGCALWMIF 459

>NCAS0A08730 Chr1 (1724401..1726296) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  518 bits (1333), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 229/386 (59%), Positives = 292/386 (75%), Gaps = 5/386 (1%)

Query: 8   SLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGL 67
           SLF  +   L++ LD +S  SIC AT+L+Q+GI DYYEG  YGGTVGMF +PYYWW +G 
Sbjct: 20  SLF--IGKTLSLTLDQTSSKSICDATSLLQKGILDYYEGTTYGGTVGMFQAPYYWWHSGC 77

Query: 68  VFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAV 127
            FG MIENWYLCQ+ +YE ++ DA++AQ G +YD++P NQTMVEGNDDQGVW L +M A 
Sbjct: 78  AFGSMIENWYLCQDDTYESLITDAILAQAGDNYDFVPQNQTMVEGNDDQGVWGLALMDAA 137

Query: 128 ERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGC 187
           ER F  P+  G P WL M + +F  M++RWD+ +C GGLRWQI++WN+GY+YKNT+S  C
Sbjct: 138 EREF--PQVKGQPSWLTMAENIFESMFARWDNANCGGGLRWQIYSWNNGYDYKNTVSTTC 195

Query: 188 LFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKE-EANVFDGATIDDNCTSIVKYE 246
           LFQLAARLGRYTGN TY++ A + FDWL  + FV+ K  +  VFDGA I  NCT+I KYE
Sbjct: 196 LFQLAARLGRYTGNETYVKAANQAFDWLQGVGFVMFKNNDGYVFDGADISTNCTNIKKYE 255

Query: 247 WSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTD 306
           WSYNHG+VLGG AYMYN T+GS  W+TRT Q+L  A+S+FF++ IM+E+ CQ SN CN D
Sbjct: 256 WSYNHGIVLGGAAYMYNLTDGSSTWETRTSQLLNLASSYFFQNGIMFEAECQTSNICNND 315

Query: 307 QRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWD 366
           QR F++IF+RMLG TS++APFT +TI PL+ T+      +CSGG DGHTCGLNW   ++D
Sbjct: 316 QRSFRSIFARMLGKTSIMAPFTAETIDPLLKTTSKAAANACSGGKDGHTCGLNWLNSNFD 375

Query: 367 GQYGLGEQACALEIINQLLVHDLPAP 392
           G YGLGE+  A+E+I  LL+H  PAP
Sbjct: 376 GNYGLGEEMSAMEVIQNLLIHQRPAP 401

>NCAS0A08740 Chr1 (1727048..1728352) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  508 bits (1308), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 235/383 (61%), Positives = 284/383 (74%), Gaps = 4/383 (1%)

Query: 18  AIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFGGMIENWY 77
           +I L+ +S +SIC AT++I +GI DYYEG  + GTVGMF  PYYWW+AG  FGGM+ENWY
Sbjct: 26  SIKLNVTSNTSICDATSIITKGILDYYEGTRFNGTVGMFQQPYYWWKAGSAFGGMLENWY 85

Query: 78  LCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERNFTNPKED 137
           LCQN ++E +L DA++ Q G DYDY+P NQTMVE NDDQGVW LT+M AVERNFT+P+  
Sbjct: 86  LCQNDTFESLLTDAMLHQAGKDYDYLPENQTMVEANDDQGVWGLTIMGAVERNFTDPQGK 145

Query: 138 GTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQLAARLGR 197
             PGWLAM Q++FNQMYSRWD+  C GGLRWQI+ WN GYNYKNTIS  CLFQ+AARLGR
Sbjct: 146 DVPGWLAMAQSIFNQMYSRWDTGSCGGGLRWQIYDWNKGYNYKNTISTACLFQMAARLGR 205

Query: 198 YTGNTTYLEVAEKVFDWLVDIDFVVMK-EEANVFDGATIDDNCTSIVKYEWSYNHGVVLG 256
           YTGN+TYL+VA+K F W+VDI ++ +      VFDGA I+ NC+ I K EWSYNHG+VLG
Sbjct: 206 YTGNSTYLKVADKTFQWMVDIGYIQLNTSSGRVFDGAHIESNCSDITKLEWSYNHGIVLG 265

Query: 257 GCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNK--CNTDQRVFKAIF 314
           GCAYMYNAT  S  W   T +IL GAT++FF++  M E+ CQ  ++  CN DQR FK+IF
Sbjct: 266 GCAYMYNATK-SPEWGMNTIKILNGATTYFFQNKTMLETACQRPDRVFCNNDQRTFKSIF 324

Query: 315 SRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWDGQYGLGEQ 374
           SRMLG TSV+APFT++ I PLI  S      SC+GG D  TCGLNW  G  DG YGLGEQ
Sbjct: 325 SRMLGLTSVMAPFTSERIDPLIVQSAEAAALSCTGGFDNETCGLNWLEGKNDGYYGLGEQ 384

Query: 375 ACALEIINQLLVHDLPAPLTEST 397
             ALE+I  LL+H  P P    T
Sbjct: 385 LSALEVIQNLLIHKRPPPYMAKT 407

>ACL201W Chr3 (10277..11623) [1347 bp, 448 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 448

 Score =  502 bits (1292), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 239/424 (56%), Positives = 287/424 (67%), Gaps = 2/424 (0%)

Query: 9   LFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLV 68
           + L +V   A+D+D +S  SIC AT LIQ GI DYYEG   GG  G  V PYYWW AG  
Sbjct: 6   VILNIVLSNALDVDFNSSESICDATKLIQVGILDYYEGAKPGGRAGFLVKPYYWWMAGEA 65

Query: 69  FGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVE 128
           FGGM+ENWYLC NT Y+D+L DA+++Q G + DYMPS+Q MVEGNDDQG+W L VM A E
Sbjct: 66  FGGMVENWYLCNNTEYQDLLTDAMVSQIGENKDYMPSHQKMVEGNDDQGIWGLLVMGAAE 125

Query: 129 RNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCL 188
           RNF +   +  PGWLA+ QAVFN M++RWD ++C GGLRWQIF WN GY+YKNTISN CL
Sbjct: 126 RNFPDAPPERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNGGYDYKNTISNACL 185

Query: 189 FQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKYEWS 248
           FQ+AARL R+TGN+TY +VAE VFDWLVD+  V ++ +A V DGA I + C    + EW+
Sbjct: 186 FQIAARLARFTGNSTYQDVAETVFDWLVDVKLVELENDARVLDGAHISERCEDHSQLEWT 245

Query: 249 YNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTDQR 308
           YNHGVVLGGCAYMYN TNGS VW  R  ++L G+   FFE+ I+YE  CQ  NKCN DQR
Sbjct: 246 YNHGVVLGGCAYMYNITNGSAVWGDRLNKVLNGSL-LFFENGILYERACQDVNKCNDDQR 304

Query: 309 VFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWDGQ 368
            F++IFSRML  TSVLAP T   I P I  S     KSCSGG DGHTCG+ W    WDG+
Sbjct: 305 SFRSIFSRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRNYTWDGK 364

Query: 369 YGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTN-VLQKNINITAGD 427
           YGLGEQ  ALEII   L+H  P P T +            L +S+ N +      I   D
Sbjct: 365 YGLGEQLSALEIIQNTLIHTKPPPTTANEGAKSQGDPGAGLQLSSPNSITLPTRQIRLKD 424

Query: 428 KAGA 431
           + GA
Sbjct: 425 RVGA 428

>ACL200W Chr3 (12145..13536) [1392 bp, 463 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 463

 Score =  494 bits (1273), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 238/430 (55%), Positives = 290/430 (67%), Gaps = 4/430 (0%)

Query: 5   PLYSLFLTVVSVL--AIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYW 62
           P+Y L + +  VL  A+D+D +S  SIC AT LIQ GI DYYEG   GG VG F  PYYW
Sbjct: 15  PMYVLLVILNIVLSNALDVDFNSSESICDATKLIQVGILDYYEGLRPGGRVGFFQKPYYW 74

Query: 63  WEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALT 122
           W AG  FGGM+ENWYLC NT Y+D+L DA+++Q G + DY+PS+Q M+EGNDDQG+W L 
Sbjct: 75  WMAGEAFGGMVENWYLCNNTEYQDLLTDAMVSQIGENKDYVPSHQKMIEGNDDQGIWGLL 134

Query: 123 VMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNT 182
           VM A ERNF +   +  PGWLA+ QAVFN M++RWD ++C GGLRWQIF WN+GY+YKNT
Sbjct: 135 VMGAAERNFPDAPPERAPGWLALAQAVFNTMWARWDPENCGGGLRWQIFPWNNGYDYKNT 194

Query: 183 ISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSI 242
           ISN CLFQ+AARL R+TGN+TY +VAE VFDWLVD   V ++ +A V DGA I + C   
Sbjct: 195 ISNACLFQIAARLARFTGNSTYQDVAETVFDWLVDSKLVQLENDAKVLDGAHISERCEDH 254

Query: 243 VKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNK 302
            K EW+YNHGVVL GCAYMYN TNGS VW  R  ++L G+   FF + I+YE  CQ   K
Sbjct: 255 SKLEWTYNHGVVLAGCAYMYNITNGSAVWGDRLNKVLNGSL-LFFPNGILYERACQDVQK 313

Query: 303 CNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFT 362
           CN DQR F++IFSRML  TSVLAP T   I P I  S     KSCSGG DGHTCG+ W  
Sbjct: 314 CNDDQRSFRSIFSRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCSGGRDGHTCGMVWRN 373

Query: 363 GDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNIN 422
             WDG+YGLGEQ  ALEII   L+H  P P T +            L  ++ N++  +  
Sbjct: 374 YTWDGKYGLGEQLSALEIIQNTLIHTKPPPTTANEGAKSKGDPSAGLYDNSPNIITLSTR 433

Query: 423 -ITAGDKAGA 431
            I   D+ GA
Sbjct: 434 QIGLKDRVGA 443

>ACL202W Chr3 (8390..9742) [1353 bp, 450 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR238W (DFG5);
           Tandem gene triplication in this genome
          Length = 450

 Score =  487 bits (1253), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 236/408 (57%), Positives = 283/408 (69%), Gaps = 2/408 (0%)

Query: 6   LYSLFL-TVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWE 64
           +Y+L +  +V   A+D++ +S +SIC AT LIQQGI DYYEG   GG VG F  PYYWW 
Sbjct: 1   MYALVIFNIVLCNALDVNFNSSASICNATKLIQQGILDYYEGLRPGGRVGFFQEPYYWWM 60

Query: 65  AGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVM 124
           AG VFGGM+ENWYLC NT Y+D+L +A+++Q G + DY+P +Q MVEGNDDQG+W L VM
Sbjct: 61  AGDVFGGMVENWYLCDNTEYKDLLTEAMVSQIGENKDYVPWHQRMVEGNDDQGIWGLLVM 120

Query: 125 TAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTIS 184
            A ER+F +   D  PGWLA+ QAVFN M++RWD D+C GGL WQI+ WN GY+YKNTIS
Sbjct: 121 DAAERDFPDAPPDQAPGWLALAQAVFNTMWARWDMDNCAGGLLWQIYPWNVGYDYKNTIS 180

Query: 185 NGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVK 244
           NG LFQ+AARL R+TGN+TY  VAE VFDWLVD   V +   A V DGA +  NCT   +
Sbjct: 181 NGYLFQIAARLARFTGNSTYGRVAETVFDWLVDSKLVQLDNVALVLDGAHVYTNCTDFTR 240

Query: 245 YEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCN 304
           YEW+YN+GVVLGGCAYMYN TNGS VW  R  ++L GA   FFE+ IMYE TCQ  ++CN
Sbjct: 241 YEWTYNYGVVLGGCAYMYNFTNGSPVWANRLNRVLNGAL-LFFENGIMYERTCQDVDRCN 299

Query: 305 TDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGD 364
            DQR FK+IF+RML  TSVLAP T   I P I  S     KSC+GG+DGHTCGL W    
Sbjct: 300 NDQRFFKSIFTRMLALTSVLAPHTKARIEPNIRKSAEAAAKSCNGGSDGHTCGLVWRNYT 359

Query: 365 WDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVS 412
           WDG+ GLGEQ CALEII   L+H    PLT              LN S
Sbjct: 360 WDGKAGLGEQLCALEIIQNTLIHTKRPPLTAKQGAKSKGDPAAGLNSS 407

>TBLA0C03850 Chr3 (921692..923395) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  489 bits (1259), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 219/377 (58%), Positives = 287/377 (76%), Gaps = 3/377 (0%)

Query: 19  IDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFGGMIENWYL 78
           I++DT SK SIC AT+LIQ G+ DYYEG+ YGGTVG+F  PYYWW++G  FG ++ NWYL
Sbjct: 17  IEIDTHSKESICNATSLIQDGLLDYYEGNRYGGTVGIFQPPYYWWQSGEAFGSLLNNWYL 76

Query: 79  CQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERNFTNPKEDG 138
           CQN +YE ++YDA++AQ G +YD++P NQTMVEGNDDQGV+ +T++ A+ERNFT P + G
Sbjct: 77  CQNDTYEKLIYDAILAQAGPNYDFVPKNQTMVEGNDDQGVFDMTILDAMERNFTAPPK-G 135

Query: 139 TPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQLAARLGRY 198
           +P WL M Q VFN MY RWD+  CNGG+RWQI++WN+GY+YKN +S G LF +AARL RY
Sbjct: 136 SPSWLDMNQRVFNSMYDRWDTTSCNGGIRWQIYSWNNGYDYKNAVSTGSLFHIAARLARY 195

Query: 199 TGNTTYLEVAEKVFDWLVDIDFVVMKEE-ANVFDGATIDDNCTSIVKYEWSYNHGVVLGG 257
           TGN +Y +VA+ +FDWL  +++V+  ++   V DGA+I+ NCT I + EW+YN G+++ G
Sbjct: 196 TGNASYFQVADTIFDWLTSVNYVMFDDKYGYVMDGASIEQNCTDITRIEWTYNFGIIMDG 255

Query: 258 CAYMYNATNGSDVWQTRTEQILGGATSFFFE-DDIMYESTCQASNKCNTDQRVFKAIFSR 316
           CAY+YNATNGS  W+  T ++L GA   FF+ +DIMYE+ CQ +NKCN DQR FKA+ +R
Sbjct: 256 CAYLYNATNGSAKWEQCTTKLLAGAKDDFFDKNDIMYEAACQTNNKCNNDQRSFKALLAR 315

Query: 317 MLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWDGQYGLGEQAC 376
            LG TSVLAP+T  TI P+I+ S     KSC+GG DGHTCGL+W  G  DG YG+GEQ  
Sbjct: 316 FLGTTSVLAPYTESTIKPMINASAIGAAKSCNGGYDGHTCGLSWQKGTNDGYYGMGEQMS 375

Query: 377 ALEIINQLLVHDLPAPL 393
           ALEII  LL++D P PL
Sbjct: 376 ALEIIQNLLINDYPPPL 392

>TPHA0I02470 Chr9 (550108..551466) [1359 bp, 452 aa] {ON} Anc_2.570
           YKL046C
          Length = 452

 Score =  459 bits (1182), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 227/449 (50%), Positives = 290/449 (64%), Gaps = 7/449 (1%)

Query: 3   ISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYW 62
           ++ + SL+ ++ S + +DLD  +  S+  ATAL+  G+ DYY G  YG T+GMF  PYYW
Sbjct: 11  VNCILSLYSSLTSAVYLDLD--NYESLQNATALVAYGLMDYYTGLQYGKTIGMFSDPYYW 68

Query: 63  WEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALT 122
           WEAG  +G M++ W+  +N +Y D++  AL+ Q G+  DY+P NQ+  EGNDDQ  W + 
Sbjct: 69  WEAGGAWGCMLDYWFFMENDTYNDIIKQALLYQVGTANDYVPLNQSTTEGNDDQAFWGIA 128

Query: 123 VMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNT 182
            M A ERNFTNP ED  P WL + QAVFN M  RWD+D C GGLRWQIF WNSGY+YKN+
Sbjct: 129 AMMAAERNFTNPAED-EPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFQWNSGYDYKNS 187

Query: 183 ISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSI 242
           +SNG LF +AARL RYTGN +Y E AEKV+DW+VD+D +   +   V+DG   +DNCT+I
Sbjct: 188 VSNGALFHIAARLARYTGNDSYAEWAEKVYDWMVDVDLITQDQYYFVYDGVDSNDNCTTI 247

Query: 243 VKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNK 302
            KY+W+YN G++L GCAY+YN T GS++W TRT+  L  ++S FF D I+YE+ CQ    
Sbjct: 248 TKYQWTYNQGLILSGCAYLYNYT-GSELWHTRTKNFL-SSSSVFFNDTILYEAACQNQET 305

Query: 303 CNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFT 362
           CNTDQR FKA FSR LG T+ L P T D I   ID S     +SCSGGTDGHTCG+NWF 
Sbjct: 306 CNTDQRSFKAYFSRFLGVTAQLVPETRDNIMKWIDASAYGAAESCSGGTDGHTCGINWFY 365

Query: 363 GDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNIN 422
           G WDG+YGLGEQ  ALEI+      D PAP T S               S TN+    +N
Sbjct: 366 GGWDGKYGLGEQMAALEILVNTRALDRPAPYTSSNGGSSTGDGAAGTETSATNL--SPLN 423

Query: 423 ITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
           ITAG +AGA                W+V+
Sbjct: 424 ITAGSRAGAGIITAVIGISIVACACWLVI 452

>SAKL0D13574g Chr4 (1125011..1126366) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 451

 Score =  459 bits (1181), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 223/434 (51%), Positives = 283/434 (65%), Gaps = 4/434 (0%)

Query: 18  AIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFGGMIENWY 77
           A+DLD    +S+  ATAL+  G+ DYY G  YG T+GMF +PYYWWEAG  +G M++ W+
Sbjct: 22  AMDLDVDDLNSLKNATALVAYGLMDYYTGLQYGQTIGMFSNPYYWWEAGGAWGSMLDYWW 81

Query: 78  LCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERNFTNPKED 137
             +N +Y D++  AL+ QTG D+DY+P NQ+  EGNDDQ  W L VM A ERNF+NP  D
Sbjct: 82  YMENDTYNDIVKQALLYQTGDDHDYVPLNQSTTEGNDDQAFWGLAVMAAAERNFSNPDPD 141

Query: 138 GTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQLAARLGR 197
             P WL + QAVFN M  RWD+D C GGLRWQIFTWNSGY+YKN++SNG LF +AARL R
Sbjct: 142 -QPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFTWNSGYDYKNSVSNGALFHIAARLAR 200

Query: 198 YTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKYEWSYNHGVVLGG 257
           YTGN +Y++ AEKVFDW+ D+  +   + A V DG +IDDNCTS+  Y+W+YNHG+++ G
Sbjct: 201 YTGNQSYVDWAEKVFDWMRDVGLITEGDWAFVHDGVSIDDNCTSVTPYQWTYNHGLIMAG 260

Query: 258 CAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTDQRVFKAIFSRM 317
            AY+YN T GS+VW  RT++ L  ++ FF    I++E+ CQASN CNTDQR FKA FSR 
Sbjct: 261 SAYLYNFT-GSEVWHNRTKEFLHSSSVFFKNGSILWEAACQASNTCNTDQRSFKAYFSRF 319

Query: 318 LGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWDGQYGLGEQACA 377
           LG T+ L P +   I   I +S     +SCSGG DGHTCG+NWF G WDG YGLGEQ  A
Sbjct: 320 LGLTAQLVPESRSQIMEWIRSSAKGAAESCSGGRDGHTCGINWFNGSWDGFYGLGEQMAA 379

Query: 378 LEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITAGDKAGAXXXXXX 437
           LEII  +   D PAP T +T                TN+    + ITAG +AGA      
Sbjct: 380 LEIIQNVRCLDRPAPYTSTTGGSSQGDSAAGTETHPTNLTP--LTITAGSRAGAGIITAV 437

Query: 438 XXXXXXXXXXWMVL 451
                     W+VL
Sbjct: 438 IGISIVACAVWLVL 451

>Suva_11.180 Chr11 complement(334319..335671) [1353 bp, 450 aa] {ON}
           YKL046C (REAL)
          Length = 450

 Score =  454 bits (1167), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 225/449 (50%), Positives = 280/449 (62%), Gaps = 5/449 (1%)

Query: 3   ISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYW 62
           I  L  LF T     A++LD  +  S+  AT+LI  G+ DYY GD YG TVGMF  PYYW
Sbjct: 7   IGLLSVLFATTRFTNAVELDLDNYQSLQNATSLIAYGLMDYYTGDQYGKTVGMFSDPYYW 66

Query: 63  WEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALT 122
           WEAG  +G M++ W+  +N +Y D +  A++ Q G D DY+P NQ+  EGNDDQ  W + 
Sbjct: 67  WEAGGAWGCMLDYWFFMENDTYNDEITAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGIA 126

Query: 123 VMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNT 182
            MTA ERNFTNP  D  P WL + QAVFN M  RWD+D C GGLRWQIF WNSGY+YKNT
Sbjct: 127 AMTAAERNFTNPPSD-EPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNT 185

Query: 183 ISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSI 242
           +SNG LF +AARL RYTGN TY++ AEKV++W+V ++ +       V+DG +IDDNCT +
Sbjct: 186 VSNGALFHIAARLARYTGNETYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTKV 245

Query: 243 VKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNK 302
             Y+W+YN G++L G AY+YN T GSD+W TRT++ L  A+  FF D I+YE+ CQ  N 
Sbjct: 246 TSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFL-NASQVFFHDGIVYEAACQGPNS 303

Query: 303 CNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFT 362
           CNTDQR FKA F+R LG T+ L P T   I   ++TS     KSCSGGTDGHTCGLNWF 
Sbjct: 304 CNTDQRSFKAYFARFLGVTAQLVPETRSQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWFN 363

Query: 363 GDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNIN 422
           G WDG YGLGEQ  ALE++      D P+P T                   TN+    +N
Sbjct: 364 GTWDGMYGLGEQMAALEVMVNTRALDRPSPYTADNGGSSVGDGAAGTQAQPTNL--SPLN 421

Query: 423 ITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
           IT G KAGA                W+V 
Sbjct: 422 ITKGSKAGAGIITAVIGISIVACALWLVF 450

>Smik_11.202 Chr11 complement(337711..339060) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  452 bits (1163), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 222/450 (49%), Positives = 279/450 (62%), Gaps = 5/450 (1%)

Query: 2   KISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYY 61
           K+    S+        A++LD  +  S+  AT+L+  G+ DYY G+ YG T+GMF  PYY
Sbjct: 5   KVIGFLSVLFATRFTNAVELDLDNYESLQNATSLVAYGLMDYYTGNQYGKTIGMFSDPYY 64

Query: 62  WWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWAL 121
           WWEAG  +G M++ W+   N +Y D +  A++ Q G D DY+P NQ+  EGNDDQ  W +
Sbjct: 65  WWEAGGAWGCMLDYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGI 124

Query: 122 TVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKN 181
             MTA ERNFTNP ED  P WL + QAVFN M  RWD+D C GGLRWQIF WNSGY+YKN
Sbjct: 125 AAMTAAERNFTNPPED-DPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKN 183

Query: 182 TISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTS 241
           T+SNG LF +AARL RYTGN TY++ AEKV++W+V +D +       V+DG +IDDNCT 
Sbjct: 184 TVSNGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVDLISNGTYKYVYDGVSIDDNCTK 243

Query: 242 IVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASN 301
           +  Y+W+YN G++L G AY+YN T GSD+W TRT++ L  A+  FF D I+YE+ CQ  N
Sbjct: 244 VTSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFL-NASQVFFHDGIVYEAACQGPN 301

Query: 302 KCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWF 361
            CNTDQR FKA F+R LG T+ L P T   I   ++TS     KSCSGGTDGHTCGLNWF
Sbjct: 302 SCNTDQRSFKAYFARFLGVTAQLVPETRHQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWF 361

Query: 362 TGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNI 421
            G WDG YGLGEQ  ALE++      D PAP T                   TN+    +
Sbjct: 362 NGTWDGMYGLGEQMSALEVLVNTRALDRPAPYTAENGGSSVGDGAAGTQARPTNLAP--L 419

Query: 422 NITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
           NIT G KAGA                W+V 
Sbjct: 420 NITKGSKAGAGIITAVIGISIVACALWLVF 449

>YKL046C Chr11 complement(351275..352624) [1350 bp, 449 aa] {ON}
           DCW1Putative mannosidase, GPI-anchored membrane protein
           required for cell wall biosynthesis in bud
           formation;homologous to Dfg5p
          Length = 449

 Score =  451 bits (1159), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 222/450 (49%), Positives = 280/450 (62%), Gaps = 5/450 (1%)

Query: 2   KISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYY 61
           K+  L  +        A++LD  +  S+  AT+LI  G+ DYY G+ YG TVGMF  PYY
Sbjct: 5   KVIGLLGVLFATRFTNAVELDLDNYESLQNATSLIAYGLMDYYTGNQYGKTVGMFSDPYY 64

Query: 62  WWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWAL 121
           WWEAG  +G M++ W+   N +Y D +  A++ Q G D DY+P NQ+  EGNDDQ  W +
Sbjct: 65  WWEAGGAWGCMLDYWFFMDNDTYNDEIIAAMIHQAGDDNDYIPLNQSTTEGNDDQAFWGI 124

Query: 122 TVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKN 181
             MTA ERNFTNP E+  P WL + QAVFN M  RWD+D C GGLRWQIF WNSGY+YKN
Sbjct: 125 AAMTAAERNFTNPPEN-EPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKN 183

Query: 182 TISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTS 241
           T+SNG LF +AARL RYTGN TY++ AEKV++W+V ++ +       V+DG +IDDNCT 
Sbjct: 184 TVSNGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIDDNCTK 243

Query: 242 IVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASN 301
           +  Y+W+YN G++L G AY+YN T GSD+W TRT++ L  A+  FF D I+YE+ CQ  N
Sbjct: 244 VTSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFL-NASQVFFHDGIVYEAACQGPN 301

Query: 302 KCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWF 361
            CNTDQR FKA F+R LG T+ L P T + I   ++TS     KSCSGGTDGHTCGLNWF
Sbjct: 302 SCNTDQRSFKAYFARFLGVTAQLVPETRNQIMSWLNTSAIAAAKSCSGGTDGHTCGLNWF 361

Query: 362 TGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNI 421
            G WDG YGLGEQ  ALE++      D PAP T                   TN+    +
Sbjct: 362 NGTWDGMYGLGEQMSALEVMVNTRALDKPAPYTAENGGSSVGDGAAGTQAQPTNLAP--L 419

Query: 422 NITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
           NIT G KAGA                W+V 
Sbjct: 420 NITKGSKAGAGIITAVIGISIVACALWLVF 449

>NDAI0C00680 Chr3 complement(132980..134338) [1359 bp, 452 aa] {ON}
           Anc_2.570
          Length = 452

 Score =  449 bits (1156), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 222/443 (50%), Positives = 282/443 (63%), Gaps = 7/443 (1%)

Query: 10  FLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVF 69
            L   S  A+++D     S+  AT+L+  G+ DYY G+ YG T+GMF  PYYWWEAG  +
Sbjct: 16  LLLSHSTKALEIDLDDIDSLRNATSLVAYGLMDYYTGNQYGKTIGMFSDPYYWWEAGGAW 75

Query: 70  GGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVER 129
           G M++ WY   N +Y D +  AL+ QTG + DY+P NQ+  EGNDDQ  W + VMTA ER
Sbjct: 76  GSMLDYWYYMDNDTYNDEIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWGIAVMTAAER 135

Query: 130 NFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLF 189
           NFTNP ED +P WL + QAVFN M  RWD D C GGLRWQIF WNSGY+YKNT+SNG LF
Sbjct: 136 NFTNPPED-SPQWLYLAQAVFNTMALRWDGDTCGGGLRWQIFVWNSGYDYKNTVSNGALF 194

Query: 190 QLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKYEWSY 249
            +AARL RYTGN +Y++ AEKV+DW+ ++  V       V+DG  I +NC++I  Y+W+Y
Sbjct: 195 HMAARLARYTGNQSYVDWAEKVYDWMYEVGLVSNGSSMFVYDGVNIANNCSTITPYQWTY 254

Query: 250 NHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTDQRV 309
           NHG+V+ G AY+YN T  ++VW  RT+ ++  A++ FF + IMYE+ CQ  N CNTDQR 
Sbjct: 255 NHGLVMAGAAYLYNFTE-NEVWHNRTKMLV-DASTVFFNNSIMYEAACQGPNSCNTDQRS 312

Query: 310 FKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWDGQY 369
           FKA FSR LG T+ L P T   I PLI+ S     KSCSGGTDGHTCGLNWF GDWDG Y
Sbjct: 313 FKAYFSRFLGATAQLVPETRSKILPLINASAIAAGKSCSGGTDGHTCGLNWFIGDWDGMY 372

Query: 370 GLGEQACALEI-INQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITAGDK 428
           GLGEQ CALE+ +N   +H  PAP T +                 TN+    ++IT G +
Sbjct: 373 GLGEQMCALEVMVNTRCLHK-PAPYTSTNGGSSVGDGAAGTEHHPTNLAP--LHITKGSR 429

Query: 429 AGAXXXXXXXXXXXXXXXXWMVL 451
           AGA                W+V 
Sbjct: 430 AGAGIITAVIGISILACALWLVF 452

>KLTH0D08008g Chr4 (680735..682081) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 448

 Score =  448 bits (1152), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 222/437 (50%), Positives = 280/437 (64%), Gaps = 5/437 (1%)

Query: 15  SVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFGGMIE 74
           S  A+D D  ++ SI  ATAL+  G+ DYY G  YG T+GMF +PYYWWEAG  +G +++
Sbjct: 17  SSQALDFDVDNEGSIKNATALVAGGLLDYYTGQQYGQTIGMFSNPYYWWEAGGAWGSILD 76

Query: 75  NWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERNFTNP 134
            W+  QN +Y  ML +AL+ Q G ++DY+P NQ+  EGNDDQ  W L VM A ERNFTNP
Sbjct: 77  FWWYTQNDTYNAMLEEALLYQAGENHDYIPLNQSTTEGNDDQAFWGLVVMAAAERNFTNP 136

Query: 135 KEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQLAAR 194
            E   P WL + QAVFN M  RWD + C GGLRWQIFTWNSGY+YKNT+SNG LF LAAR
Sbjct: 137 PET-EPQWLYLAQAVFNTMALRWDDESCGGGLRWQIFTWNSGYDYKNTVSNGALFHLAAR 195

Query: 195 LGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKYEWSYNHGVV 254
           L RYTGN TY++ AEKVFDW+  I  +   + + V+DGA +D NC++I K  W+YN G++
Sbjct: 196 LARYTGNNTYVDWAEKVFDWMKGIGLLTENDNSYVYDGAKVDGNCSTITKLIWTYNQGLL 255

Query: 255 LGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTDQRVFKAIF 314
           + GCAY+YN T GS+ W TRT + L  ++  FF + I+YE TCQ +N CNTDQR FKA F
Sbjct: 256 MSGCAYLYNYT-GSETWHTRTFEFL-NSSDIFFNNSILYERTCQEANTCNTDQRSFKAYF 313

Query: 315 SRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWDGQYGLGEQ 374
           SR LG T+ L P   + I   I  S     +SCSGGTDGHTCGLNWF   WDG++GLGEQ
Sbjct: 314 SRFLGLTAQLVPAARNQIMDWIRASAKGAAQSCSGGTDGHTCGLNWFYDGWDGKWGLGEQ 373

Query: 375 ACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITAGDKAGAXXX 434
             ALEI+  +L  D PAP T +T              S TN+    ++IT G +A A   
Sbjct: 374 MAALEIMQNVLCLDRPAPYTAATGGSSVGNGAAGTETSATNL--SPLDITTGSRAAAGII 431

Query: 435 XXXXXXXXXXXXXWMVL 451
                        W+VL
Sbjct: 432 TAVIGLSIVACTVWLVL 448

>Skud_11.183 Chr11 complement(330975..332324) [1350 bp, 449 aa] {ON}
           YKL046C (REAL)
          Length = 449

 Score =  447 bits (1150), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 223/449 (49%), Positives = 282/449 (62%), Gaps = 6/449 (1%)

Query: 3   ISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYW 62
           I  L  LF T  S  A++LD  +  S+  AT+LI  G+ DYY G+ YG T+GMF  PYYW
Sbjct: 7   IGLLSVLFFTKFSN-AVELDLDNYESLENATSLIAYGLMDYYTGNQYGKTIGMFSDPYYW 65

Query: 63  WEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALT 122
           WEAG  +G M++ W+   N +Y D +  A++ Q+G D DY+P NQ+  EGNDDQ  W + 
Sbjct: 66  WEAGGAWGCMLDYWFFMDNDTYNDEIIAAMVHQSGDDNDYIPLNQSTTEGNDDQAFWGIA 125

Query: 123 VMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNT 182
            MTA ERNFTNP  D  P WL + QAVFN M  RWD+D C GGLRWQIF WNSGY+YKNT
Sbjct: 126 AMTAAERNFTNPPAD-EPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNT 184

Query: 183 ISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSI 242
           +SNG LF +AARL RYTGN TY++ AEKV++W+V ++ +       V+DG +I DNCT +
Sbjct: 185 VSNGALFHIAARLARYTGNQTYVDWAEKVYEWMVGVNLISNGTYKYVYDGVSIGDNCTKV 244

Query: 243 VKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNK 302
             Y+W+YN G++L G AY+YN T GSD+W TRT++ L  ++  FF+D I+YE+ CQ  N 
Sbjct: 245 TSYQWTYNQGLLLAGSAYLYNFT-GSDLWHTRTKEFL-NSSQVFFQDGIVYEAACQGPNS 302

Query: 303 CNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFT 362
           CNTDQR FKA F+R LG T+ L P T + I   ++TS     KSCSGGTDGHTCGLNWF 
Sbjct: 303 CNTDQRSFKAYFARFLGVTAQLVPETRNQIMTWLNTSAIAAAKSCSGGTDGHTCGLNWFN 362

Query: 363 GDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNIN 422
           G WDG YGLGEQ  ALE++      D PAP T                   TN+    +N
Sbjct: 363 GTWDGMYGLGEQMAALEVMVNTRALDKPAPYTADEGGSSAGDGAAGTQAQPTNLAP--LN 420

Query: 423 ITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
           IT G KAGA                W+V 
Sbjct: 421 ITKGSKAGAGIITAVIGISIVACALWLVF 449

>KLLA0E07723g Chr5 complement(691980..693332) [1353 bp, 450 aa] {ON}
           similar to uniprot|P36091 Saccharomyces cerevisiae
           YKL046C DCW1 Mannosidase GPI-anchored membrane protein
           required for cell wall biosynthesis homologous to Dfg5p
          Length = 450

 Score =  445 bits (1145), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 219/433 (50%), Positives = 285/433 (65%), Gaps = 12/433 (2%)

Query: 6   LYSLFLTVVSVLA-----IDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPY 60
           ++ L L++V++ +     +DLD +  +S+  AT+L+  G+ DYY G  YG T+GMF SP 
Sbjct: 3   VFKLVLSLVTLFSSVSFGLDLDVNDLNSLKNATSLVAYGLMDYYTGLQYGKTIGMFASPS 62

Query: 61  YWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWA 120
           YWW+AG  +G +++ W+  +N +Y D+L  AL+ QTG ++DYMP NQT+ EGNDDQ  W 
Sbjct: 63  YWWQAGGAWGSILDYWFYMENDTYNDILTQALLYQTGDNHDYMPLNQTVTEGNDDQAFWG 122

Query: 121 LTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYK 180
             VM A ERN+ NP +D  P WL + QAVFN M SRWD D C GGLRWQIFTWNSGY+YK
Sbjct: 123 FAVMAAAERNYPNPPDD-EPQWLYLAQAVFNTMSSRWDMDSCGGGLRWQIFTWNSGYDYK 181

Query: 181 NTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEAN--VFDGATIDDN 238
           N++SN  LF L+ARL RYTGN++Y E AEK++DW+ DI  +V +E     V+DGA+I++N
Sbjct: 182 NSVSNAALFHLSARLARYTGNSSYTEWAEKIYDWMQDIQLLVDEEPTQYYVYDGASIEEN 241

Query: 239 CTSIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQ 298
           CT  VKY+W+YN G++L G AY+YN T  S+ W  RT+  L  ++  FF + IMYE+ CQ
Sbjct: 242 CTDTVKYQWTYNQGLMLSGSAYLYNFTE-SETWHERTKNFLN-SSGIFFNNSIMYEAACQ 299

Query: 299 ASNKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGL 358
            S  CN DQR FKA FSR LG T+ L P T DT+  L+  S      SCSGGTDGHTCGL
Sbjct: 300 GSGYCNNDQRSFKAYFSRFLGLTAQLVPETRDTVLALLQASAQGAADSCSGGTDGHTCGL 359

Query: 359 NWFTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQ 418
           NWF G WDG+YGLGEQ  ALE++  L   D PAP T                 S TN+  
Sbjct: 360 NWFYGGWDGKYGLGEQMAALEVMQNLRCLDRPAPYTADDGGTSAGNPAAGTEQSPTNL-- 417

Query: 419 KNINITAGDKAGA 431
             + I  GD+AGA
Sbjct: 418 APLTIGKGDQAGA 430

>KAFR0I01740 Chr9 complement(352631..353977) [1347 bp, 448 aa] {ON}
           Anc_2.570 YKL046C
          Length = 448

 Score =  443 bits (1139), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 223/433 (51%), Positives = 280/433 (64%), Gaps = 7/433 (1%)

Query: 1   MKISPLYSLFLT--VVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVS 58
           M I+ L  L L+  +  V +++LD  S  S+  ATAL+  G+ DYY G+ YG TVGMF  
Sbjct: 1   MVINNLILLILSTFIGRVYSLELDLDSFESLQNATALVAYGLMDYYTGNQYGKTVGMFSD 60

Query: 59  PYYWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGV 118
           PYYWWEAG  +G MI+ WY   N +Y D +  AL+ QTG D+DY+P NQ+  EGNDDQ  
Sbjct: 61  PYYWWEAGGAWGSMIDFWYYMDNNTYNDDIMAALLHQTGDDWDYIPLNQSTTEGNDDQAF 120

Query: 119 WALTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYN 178
           W + VMTA ERNFTNP +D  P WL + QAVFN M  RWD   C GGLRWQIFTWNSGY+
Sbjct: 121 WGIAVMTAAERNFTNPPDD-QPQWLYLAQAVFNTMALRWDDATCGGGLRWQIFTWNSGYD 179

Query: 179 YKNTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDN 238
           YKNT+SNG LF LAARL RYTGNT+Y++ AEKV++W+ D   +    +  V+DGA++ DN
Sbjct: 180 YKNTVSNGALFHLAARLARYTGNTSYVDWAEKVYNWMEDTYLISNGTQMFVYDGASVTDN 239

Query: 239 CTSIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQ 298
           CT++ KY+W+YN G++L G AY+YN T  S++W  RT+  L  A+  FF + IMYE+ CQ
Sbjct: 240 CTTVTKYQWTYNQGLLLSGSAYLYNFTE-SELWHERTKGFL-NASVVFFNNSIMYEAACQ 297

Query: 299 ASNKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGL 358
               CNTDQR FKA FSR LG T+ L P T DT+   ++TS      SCSGGTDGHTCG+
Sbjct: 298 GPQTCNTDQRSFKAYFSRFLGATAQLVPETRDTVMHWVNTSAVAAATSCSGGTDGHTCGI 357

Query: 359 NWFTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQ 418
           NWF G WDG YGLGEQ  ALEI+        P P T                 + TN+  
Sbjct: 358 NWFYGGWDGYYGLGEQMSALEIMVNTRALHKPGPYTSENGGSSMGDGAAGTQATATNL-- 415

Query: 419 KNINITAGDKAGA 431
             +N+T G KA A
Sbjct: 416 SPLNVTPGSKAAA 428

>Kwal_26.8225 s26 (696173..697522) [1350 bp, 449 aa] {ON} YKL046C -
           Hypothetical ORF [contig 58] FULL
          Length = 449

 Score =  441 bits (1134), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 223/452 (49%), Positives = 283/452 (62%), Gaps = 6/452 (1%)

Query: 1   MKISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPY 60
           + ++ +++L +T+   L I LD ++  SI  ATAL+  G+ DYY G  YG T+GMF  PY
Sbjct: 3   ISLTCVFTLLVTLRGSLGIYLDVNNTESIKNATALVAGGLLDYYTGLQYGETIGMFSDPY 62

Query: 61  YWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWA 120
           YWWEAG  +G +++ W+  QN +Y  +L  AL+ Q+G ++DY+P NQ+  EGNDDQ  W 
Sbjct: 63  YWWEAGGAWGSILDYWHYTQNDTYNKILEQALLYQSGENHDYIPLNQSTTEGNDDQAFWG 122

Query: 121 LTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYK 180
           L VM A ERNFTNP  D  P WL + QAVFN M  RWD D C GGLRWQIFTWNSGY+YK
Sbjct: 123 LVVMAAAERNFTNPPPD-QPQWLYLAQAVFNTMALRWDEDTCGGGLRWQIFTWNSGYDYK 181

Query: 181 NTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCT 240
           NT+SNG LF LAARL RYTGN TY+E AEKVFDW+  I  +  + E  V+DGA +DDNCT
Sbjct: 182 NTVSNGALFHLAARLARYTGNDTYVEWAEKVFDWMKGIKLLTEENENFVYDGAKVDDNCT 241

Query: 241 SIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQA- 299
            I K  W+YN G+++ G AY+YN T G++ W TRT + L  ++  FF + ++YE  CQ  
Sbjct: 242 VITKLIWTYNQGLLMSGSAYLYNYT-GAEKWHTRTFEFL-NSSHIFFNNSVLYERACQGV 299

Query: 300 SNKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLN 359
           +  CNTDQR FKA FSR +G T+ L P +   I   I  S     +SCSGG DGHTCGLN
Sbjct: 300 TVSCNTDQRSFKAYFSRFMGLTAQLVPESRSKIMAWIQASALGAAQSCSGGRDGHTCGLN 359

Query: 360 WFTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQK 419
           WF   WDG++GLGEQ  ALEI+  LL  D PAP T  T              S TN+   
Sbjct: 360 WFYDGWDGKWGLGEQMSALEIMQNLLCLDRPAPYTAETGGSSVGNGAAGTETSATNL--S 417

Query: 420 NINITAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
            + ITAG +A A                W+VL
Sbjct: 418 PLAITAGSRAAAGIITAVIGLSIVACTIWLVL 449

>NCAS0A12750 Chr1 (2516616..2517959) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  440 bits (1132), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 220/447 (49%), Positives = 280/447 (62%), Gaps = 9/447 (2%)

Query: 9   LFLTVVS----VLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWE 64
           L  TV S    + A+DL+ +S  S+  AT+L+  G+ DYY GD YG TVGMF  PYYWWE
Sbjct: 6   LLFTVSSFSFPIAAVDLNLNSLQSLQNATSLVAYGLMDYYTGDQYGQTVGMFSDPYYWWE 65

Query: 65  AGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVM 124
           AG  +G M++ WY  QN +Y D++  AL+ Q G+D +Y+P NQ+  EGNDDQ  W +TVM
Sbjct: 66  AGGAWGTMLDYWYFMQNDTYNDIITAALLHQVGTDNNYIPLNQSTTEGNDDQAFWGITVM 125

Query: 125 TAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTIS 184
           TA ERNFTNP ED  P WL + QAVFN M  RWD+D C GGLRWQIF WNSGY+YKN++S
Sbjct: 126 TAAERNFTNPPED-QPQWLYLAQAVFNTMALRWDADSCGGGLRWQIFVWNSGYDYKNSVS 184

Query: 185 NGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVK 244
           NG LF +AARL RYTGN +Y++ AE+V+DW+ D+  +       V+DGA+  DNCT +  
Sbjct: 185 NGALFHMAARLARYTGNQSYVDWAERVYDWMSDVGLISNGSYKFVYDGASTTDNCTVLTT 244

Query: 245 YEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCN 304
           Y+W+YN G++L G AY+YN T GSD W  RT Q+L  A+S FF + I+YE+ CQ S  CN
Sbjct: 245 YQWTYNQGLLLSGAAYLYNYT-GSDTWLLRTNQLL-NASSVFFNNSILYEAACQKSGTCN 302

Query: 305 TDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGD 364
            DQR FKA F R LG T+ L   T  TI   ++ S     +SCSGGTDGHTCGLNWF+G 
Sbjct: 303 NDQRSFKAYFLRFLGQTAQLVSETQPTIMKWLNASAYAAAQSCSGGTDGHTCGLNWFSGG 362

Query: 365 WDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINIT 424
           WDG YGLGEQ  ALE +    V  LP P   +                 TN+    ++IT
Sbjct: 363 WDGMYGLGEQMSALEALVNTRVLHLPGPYNSTDGGSSIGNSAAGTEQEATNL--APLHIT 420

Query: 425 AGDKAGAXXXXXXXXXXXXXXXXWMVL 451
            G KA A                W+++
Sbjct: 421 DGSKAAAAIITSVVGISIVAAGVWLII 447

>NCAS0H02900 Chr8 (566940..568301) [1362 bp, 453 aa] {ON} Anc_2.570
          Length = 453

 Score =  439 bits (1129), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 220/448 (49%), Positives = 278/448 (62%), Gaps = 10/448 (2%)

Query: 9   LFLTVVSVL-----AIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWW 63
           L L++ S+L     A+ LD +   S+  AT+L+  G+ DYY G+ YG TVGMF  PYYWW
Sbjct: 11  LLLSLASILPSQVSALTLDLNDTESLQNATSLVAYGLMDYYTGNQYGKTVGMFSDPYYWW 70

Query: 64  EAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTV 123
           +AG  +G M++ WY   N +Y D +  AL+ QTG D DY+P NQ+  EGNDDQ  W + V
Sbjct: 71  QAGGAWGSMLDYWYYMNNDTYNDDIMAALLHQTGDDNDYVPLNQSTTEGNDDQAFWGIAV 130

Query: 124 MTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTI 183
           MTA ERNFTNP ED  P WL + QAVFN M  RWDSD C GGLRWQIF WNSGY+YKNT+
Sbjct: 131 MTAAERNFTNPPED-QPQWLYLAQAVFNTMAMRWDSDTCGGGLRWQIFIWNSGYDYKNTV 189

Query: 184 SNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIV 243
           SNG LF +A+RL RYTGN +Y++ AEKV+DW+ D+  +       V+DG  I DNCT++ 
Sbjct: 190 SNGALFHIASRLARYTGNQSYVDWAEKVYDWMYDVHLISNGSYMYVYDGVNIGDNCTTVT 249

Query: 244 KYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKC 303
            Y+W+YN G++L GCAY+YN T G ++W  RT+ +L  A   FF + I+YE+ CQ  N C
Sbjct: 250 PYQWTYNQGLLLSGCAYLYNFT-GEELWHNRTKNLLTAA-GVFFNNSILYEAACQGHNTC 307

Query: 304 NTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTG 363
           NTDQR FKA FSR LG T+ L P T + I   I+TS     +SCSGGTDGHTCG+NWF  
Sbjct: 308 NTDQRSFKAYFSRFLGTTAQLVPETRNQIMHWINTSAVAAAQSCSGGTDGHTCGINWFAD 367

Query: 364 DWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINI 423
            WDG YGLGEQ  ALEI+         AP T S                 TN+    ++I
Sbjct: 368 GWDGMYGLGEQMAALEIMVNTKALSKAAPYTSSNGGSSVGDGAAGTEPHPTNLAP--LHI 425

Query: 424 TAGDKAGAXXXXXXXXXXXXXXXXWMVL 451
           T G +AGA                W+V 
Sbjct: 426 TKGSRAGAGIITAVIGISIVTCALWLVF 453

>CAGL0L01727g Chr12 complement(184249..185589) [1341 bp, 446 aa]
           {ON} highly similar to uniprot|P36091 Saccharomyces
           cerevisiae YKL046c
          Length = 446

 Score =  436 bits (1121), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 205/381 (53%), Positives = 263/381 (69%), Gaps = 3/381 (0%)

Query: 1   MKISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPY 60
           M++  L S  +++VSV  ++LD    +S+  ATAL+  G+ DYY GD YG TVGMF  PY
Sbjct: 1   MRLVTLLSGLVSLVSVFGLELDLDDYASLQNATALVAYGLMDYYTGDQYGKTVGMFSDPY 60

Query: 61  YWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWA 120
           YWW+AG  +G M++ WY  QN +Y D +  AL+ QTG + DY+P NQ+  EGNDDQ  W 
Sbjct: 61  YWWQAGGAWGCMLDYWYFMQNDTYNDKIMAALLHQTGDNNDYVPLNQSTTEGNDDQAFWG 120

Query: 121 LTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYK 180
           + VM A ER F NP +D  P WL + QAVFN M  RWDS+ C GGLRWQIF WNSGY+YK
Sbjct: 121 IAVMQAAERKFPNPPDD-KPQWLYLTQAVFNTMALRWDSETCGGGLRWQIFVWNSGYDYK 179

Query: 181 NTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCT 240
           NT+SNG LF +AARL RYTGN +Y++ AE+V+DW+ D+  +       V+DG +I+DNCT
Sbjct: 180 NTVSNGALFHIAARLARYTGNQSYVDWAERVYDWMEDVHLIDNGTYRYVYDGVSINDNCT 239

Query: 241 SIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQAS 300
           ++ KY+W+YN G++L G AY++N T GSD+W  RT   L  A+  FF + I+YE+ CQ  
Sbjct: 240 TVTKYQWTYNQGLMLSGSAYLFNMT-GSDLWHERTHAFL-NASRVFFNNSILYEAACQGP 297

Query: 301 NKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNW 360
           N CNTDQR FKA F+R LG T+ L P T   I   ++TS     KSCSGGTDGHTCGLNW
Sbjct: 298 NTCNTDQRSFKAYFARFLGSTAELVPETRQQIMTWLNTSALAAAKSCSGGTDGHTCGLNW 357

Query: 361 FTGDWDGQYGLGEQACALEII 381
           F  DWDG YGLGEQ  ALE++
Sbjct: 358 FRDDWDGMYGLGEQMAALEVM 378

>KAFR0A02170 Chr1 (454336..455685) [1350 bp, 449 aa] {ON} Anc_2.570
           YKL046C
          Length = 449

 Score =  427 bits (1099), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 210/429 (48%), Positives = 271/429 (63%), Gaps = 10/429 (2%)

Query: 5   PLYSLFLTVVSVL-----AIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSP 59
           P    F  ++S L     +++LD     S+  ATAL+  G+ DYYEG  YGGTVGMF SP
Sbjct: 3   PRIKTFALILSTLIWRSQSLELDLDDYQSLQNATALVAWGLMDYYEGTKYGGTVGMFSSP 62

Query: 60  YYWWEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVW 119
           YYWWEAG  FG +++ WY   N +Y D +  A++ Q G+D+DY+P NQ+  EGNDDQ  W
Sbjct: 63  YYWWEAGGAFGTLLDFWYFMDNDTYNDEILAAMVYQAGNDWDYIPLNQSTTEGNDDQAFW 122

Query: 120 ALTVMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNY 179
            +  MTA ERNFTNP  D  P WL + QAVFN M  RWD+D C GGLRWQIFTWNSGY+Y
Sbjct: 123 GIAAMTAAERNFTNPASD-EPQWLYLAQAVFNTMALRWDTDSCGGGLRWQIFTWNSGYDY 181

Query: 180 KNTISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNC 239
           KN++SNG LF LAARL RYTGN +Y++ AEKV++W+ D  F+       V+DGA+ +DNC
Sbjct: 182 KNSVSNGALFHLAARLARYTGNDSYVDWAEKVYNWMEDTGFITTGNTLYVYDGASTEDNC 241

Query: 240 TSIVKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQA 299
           +S+ KY+W+YN G++L G AY+YN +  S +W  RT   L  ++  F  + IM E+ CQ 
Sbjct: 242 SSVTKYQWTYNQGLILSGAAYLYNYSE-SSLWYNRTMTAL-SSSGVFLNNSIMCEAACQP 299

Query: 300 SNKCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLN 359
           +  C+TDQR FKA F+R LG T+ L P T   I   ++ S     +SCSGGTDGHTCGLN
Sbjct: 300 AGTCDTDQRSFKAYFARFLGVTAQLVPSTRTQIMTWMNASAYAVAESCSGGTDGHTCGLN 359

Query: 360 WFTGDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQK 419
           WF G WDG YGLGEQ  ALE++      D P P   +               + TN+   
Sbjct: 360 WFLGSWDGYYGLGEQMSALEVLVNTRALDKPGPYNSTNGGSSQGDGAAGTETTATNLAP- 418

Query: 420 NINITAGDK 428
            +NIT G K
Sbjct: 419 -LNITGGSK 426

>TBLA0H02580 Chr8 complement(610287..611636) [1350 bp, 449 aa] {ON} 
          Length = 449

 Score =  427 bits (1099), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 212/415 (51%), Positives = 271/415 (65%), Gaps = 6/415 (1%)

Query: 18  AIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFGGMIENWY 77
           A+ L+ +  SS+  A +L+  G+ DYY GD YG T+GMF +PYYWWEAG  +G MI+ WY
Sbjct: 20  AVHLNLNVTSSLQNAASLVAVGLMDYYNGDQYGQTIGMFSNPYYWWEAGGAWGCMIDYWY 79

Query: 78  LCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERNFTNPKED 137
             QN +Y D++  AL+ QTG   DY+P NQ+  EGNDDQ  W +TVM+A ERNFTNP  D
Sbjct: 80  FMQNDTYNDIISQALLYQTGDRNDYIPLNQSTTEGNDDQAFWGITVMSAAERNFTNPPPD 139

Query: 138 GTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQLAARLGR 197
             P WL + QAVFN M  RWD   CNGGLRWQIF WNSGY+YKN++SNG LF +AARL R
Sbjct: 140 -KPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYKNSVSNGALFHMAARLAR 198

Query: 198 YTGNTTYLEVAEKVFDWLVDIDFVVMKEEAN-VFDGATIDDNCTSIVKYEWSYNHGVVLG 256
           YTGN +Y++ A KV+DW+     +        V+DGA+I+ NCT I +++W+YN G++L 
Sbjct: 199 YTGNQSYVDWAVKVYDWMEKTGLISNDTYFKFVYDGASIETNCTDITQFQWTYNQGLILS 258

Query: 257 GCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTDQRVFKAIFSR 316
           GCAY+YN T  S  W TRTEQ + G ++ FF + I+YE+ CQ S +C+ DQR F+A F+R
Sbjct: 259 GCAYLYNHTEDSK-WLTRTEQFVNG-SAVFFNNSIVYEAACQGSKRCDNDQRSFRAYFAR 316

Query: 317 MLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWDGQYGLGEQAC 376
            LG T+ L P T D I   I+TS     ++CSGGTDGHTCGLNWF   WDG YGLGEQ  
Sbjct: 317 FLGVTAQLVPTTKDIIMDWINTSAYAAAQACSGGTDGHTCGLNWFNIGWDGYYGLGEQMG 376

Query: 377 ALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITAGDKAGA 431
           ALE +      D+PAP T S                 TN+    ++IT G KAGA
Sbjct: 377 ALEFLVNTRALDMPAPYTSSNGGSSTGNGAAGTEKPPTNL--GPLHITDGSKAGA 429

>NDAI0B01510 Chr2 complement(354643..355986) [1344 bp, 447 aa] {ON}
           Anc_2.570
          Length = 447

 Score =  427 bits (1097), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 209/434 (48%), Positives = 271/434 (62%), Gaps = 5/434 (1%)

Query: 18  AIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFGGMIENWY 77
           A+ LD ++  S+   TAL+  G+ DYY GD YG TVGMF +PYYWWEAG  +G M++ W+
Sbjct: 19  ALSLDLNNYQSLENDTALVAYGLMDYYNGDQYGQTVGMFSNPYYWWEAGGAWGTMLDYWF 78

Query: 78  LCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERNFTNPKED 137
             +N +Y D++  AL+ QTG + DY+P NQ+  EGNDDQ  W +  MTA ERNFTNP E 
Sbjct: 79  FMENDTYNDLIMSALLHQTGENNDYIPLNQSTTEGNDDQAFWGIAAMTAAERNFTNPPES 138

Query: 138 GTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQLAARLGR 197
            +P WL + QAVFN M  RWD+ +C GGLRWQIF WNSGY+YKN++SNG LF LAARL R
Sbjct: 139 -SPQWLYLAQAVFNTMALRWDAQNCGGGLRWQIFVWNSGYDYKNSVSNGALFHLAARLAR 197

Query: 198 YTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKYEWSYNHGVVLGG 257
           YTGN +Y++ AEK +DW+ D+  +    +  V+DG +I+ NCT+I  Y+WSYN G++L G
Sbjct: 198 YTGNQSYVDWAEKTYDWMSDVGLISNGTQKYVYDGTSIETNCTTITSYQWSYNQGLMLAG 257

Query: 258 CAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTDQRVFKAIFSRM 317
            AY+YN T GS +W  RT  +L  ATS FF + IMYE  CQ +  CN DQR FK+  +R 
Sbjct: 258 AAYLYNFT-GSTIWLNRTMDLL-DATSVFFNNSIMYEVACQPTGTCNNDQRSFKSYLARF 315

Query: 318 LGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWDGQYGLGEQACA 377
           LG T+ L   T   I   ++TS      SCSGGTDGHTCGLNWF   WDG YGLGEQ  A
Sbjct: 316 LGLTAQLVTITQSRIMNWLNTSAIAVAHSCSGGTDGHTCGLNWFDNGWDGYYGLGEQMSA 375

Query: 378 LEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITAGDKAGAXXXXXX 437
           L+++    V D PAP   +               + TN+    ++IT G K GA      
Sbjct: 376 LDVLVNTRVLDRPAPYNSTNGGSSIGDGAAGTEATPTNLAP--LHITKGSKVGAAFITAA 433

Query: 438 XXXXXXXXXXWMVL 451
                     W++L
Sbjct: 434 IGLSIVFTSIWIIL 447

>TBLA0H02590 Chr8 complement(612543..613895) [1353 bp, 450 aa] {ON} 
          Length = 450

 Score =  425 bits (1092), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 213/426 (50%), Positives = 270/426 (63%), Gaps = 9/426 (2%)

Query: 8   SLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGL 67
           SL     + L IDLD    SS+  AT+LI  G+ DYY G  YG  +GMF  PYYWWEAG 
Sbjct: 12  SLLPLFTNALKIDLD--DFSSLQNATSLIAYGMMDYYNGHDYGQVIGMFAKPYYWWEAGG 69

Query: 68  VFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAV 127
            +G +++ WY  QN +Y D++ +AL+ QTG   DY+P NQ+  EGNDDQ  W +  +TA 
Sbjct: 70  AWGCLLDYWYYMQNDTYNDLITEALLYQTGDRNDYVPLNQSTTEGNDDQAFWGIAAITAA 129

Query: 128 ERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGC 187
           ERNFTNP  D  P WL + QAVFN M  RWD   CNGGLRWQIF WNSGY+YKN++SNG 
Sbjct: 130 ERNFTNPPPD-KPQWLYLAQAVFNTMALRWDDSTCNGGLRWQIFVWNSGYSYKNSVSNGA 188

Query: 188 LFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEAN--VFDGATIDDNCTSIVKY 245
           LF +AARL RYTGN +Y+E A+K++DW+     +  + E    V+DGA I+ NCT I +Y
Sbjct: 189 LFHIAARLARYTGNQSYVEWADKIYDWMFGTGIISDEYETYKFVYDGANIETNCTDITRY 248

Query: 246 EWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNT 305
           +W+YN G+VL GCAY+YN T   + W  RTEQ L G+   FF D+++YE+ CQ +  CN 
Sbjct: 249 QWTYNQGLVLAGCAYLYNHTQ-DEKWLIRTEQFLNGSV-VFFRDNVIYEAACQPNKNCNN 306

Query: 306 DQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDW 365
           DQR FKA F+R LG T+ L P T DTI   I+TS     ++CSGGTDGHTCG++W    W
Sbjct: 307 DQRSFKAYFARFLGVTAQLIPSTRDTIMRWINTSAYAAAQACSGGTDGHTCGMDWVWKGW 366

Query: 366 DGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITA 425
           DG YGLGEQ  ALE +      D+P P T                   TN+    ++ITA
Sbjct: 367 DGYYGLGEQMAALEFMVNTRALDMPPPYTSFNGGSSTGSGAAGTERDPTNL--SPLHITA 424

Query: 426 GDKAGA 431
           G KAGA
Sbjct: 425 GSKAGA 430

>TBLA0H02600 Chr8 complement(614887..616236) [1350 bp, 449 aa] {ON}
           Anc_2.570 YKL046C
          Length = 449

 Score =  423 bits (1087), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 214/426 (50%), Positives = 273/426 (64%), Gaps = 8/426 (1%)

Query: 9   LFLTVVSVL--AIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAG 66
           L ++V++ +  A+ L+ +  SS+  A AL+  G+ DYY G+ YG T+GMF  PYYWWEAG
Sbjct: 9   LKISVITTITNAVSLNLNDSSSLDNAAALVAYGLMDYYNGNQYGQTIGMFSDPYYWWEAG 68

Query: 67  LVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTA 126
             +G M++ WY  QN +Y D++Y+AL  QTG D DY+P NQ+  EGNDDQ  W +  +TA
Sbjct: 69  GAWGCMLDYWYYMQNDTYNDVIYEALQYQTGDDNDYIPLNQSTTEGNDDQAFWGIAAITA 128

Query: 127 VERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNG 186
            ERNFTNP  D  P WL + QAVFN M  RWDSD CNGGLRWQIF WNSGY+YKN++SNG
Sbjct: 129 AERNFTNPPPD-KPQWLYLAQAVFNTMALRWDSDTCNGGLRWQIFVWNSGYSYKNSVSNG 187

Query: 187 CLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEAN-VFDGATIDDNCTSIVKY 245
            LF +AARL RYTGN +Y++ +EKV+DW++    +        V DG  I+ NCT I  Y
Sbjct: 188 ALFHIAARLARYTGNQSYVDWSEKVYDWMLGTGLISNGTTYKFVHDGVNIETNCTDITPY 247

Query: 246 EWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNT 305
           +W+YN G++L GCAY+YN T   + W  RT Q L G +  FF + ++YE+ CQ +  CN 
Sbjct: 248 QWTYNQGLLLAGCAYLYNFTQ-DEKWLIRTNQFLNG-SGVFFNNSVIYEAACQPNKNCNN 305

Query: 306 DQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDW 365
           DQR FKA F+R LG T+ L P T DTI   IDTS     ++CSGGTDGHTCG++W    W
Sbjct: 306 DQRSFKAYFARFLGVTAQLLPSTRDTIMQWIDTSAYAAAQACSGGTDGHTCGMDWNWNGW 365

Query: 366 DGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITA 425
           DG YGLGEQ  ALE +      DLP P T S                 TN+    +NITA
Sbjct: 366 DGYYGLGEQMAALEFMVNTRALDLPPPYTSSNGGSSTGSGAAGTEQKPTNL--GPLNITA 423

Query: 426 GDKAGA 431
           G KAGA
Sbjct: 424 GSKAGA 429

>KNAG0A07180 Chr1 (1127961..1129352) [1392 bp, 463 aa] {ON} 
          Length = 463

 Score =  417 bits (1072), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 203/395 (51%), Positives = 260/395 (65%), Gaps = 3/395 (0%)

Query: 3   ISPLYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYW 62
           +S L +L   V  V A+D+D  +  SI  AT+LI  G+ DYY G+ YG TVGMF  PYYW
Sbjct: 13  VSVLLALSAVVSKVAALDIDLDNLDSIRNATSLIAYGLMDYYTGEQYGKTVGMFADPYYW 72

Query: 63  WEAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALT 122
           WEAG  +G M++  +   N +Y+  +  A++ QTG   +Y+P NQ+  EGNDDQ  W + 
Sbjct: 73  WEAGGAWGSMLDYSWFMDNDTYDSQIMSAMLHQTGEHNNYIPLNQSTTEGNDDQAFWGIA 132

Query: 123 VMTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNT 182
            MTA ERNFTNP ED  P WL + QAVFN M  RWD++ C GGLRWQIF WNSGY+YKNT
Sbjct: 133 AMTAAERNFTNPPED-KPQWLYLAQAVFNTMALRWDTESCGGGLRWQIFNWNSGYDYKNT 191

Query: 183 ISNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSI 242
           +SNG LF +A+RL RYTGN +Y++ AEKV+DW+ D+  +       V+DG   +DNC+++
Sbjct: 192 VSNGALFHMASRLARYTGNQSYVDWAEKVYDWMWDVHVISNSTYMFVYDGVDANDNCSTV 251

Query: 243 VKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFE-DDIMYESTCQASN 301
            +Y+W+YNHG++L G AY+YN T G +VW  RT++++  A  FF     IMYE+ CQA+ 
Sbjct: 252 TQYQWTYNHGLLLAGSAYLYNFT-GDEVWHNRTKKLVTAAQVFFNSTTGIMYEAACQAAL 310

Query: 302 KCNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWF 361
            CN DQR FKA FSR LG T+ L P T   I   ++TS     KSCSGG DGHTCGLNWF
Sbjct: 311 TCNNDQRSFKAYFSRFLGLTAQLVPETRTQIMGWLNTSAVAAGKSCSGGYDGHTCGLNWF 370

Query: 362 TGDWDGQYGLGEQACALEIINQLLVHDLPAPLTES 396
              WDG YGLGEQ  ALE I        PAP T +
Sbjct: 371 KDGWDGMYGLGEQMSALECILNTRALMKPAPYTAT 405

>Kpol_1056.4 s1056 complement(6537..7889) [1353 bp, 450 aa] {ON}
           complement(6537..7889) [1353 nt, 451 aa]
          Length = 450

 Score =  414 bits (1064), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 209/426 (49%), Positives = 269/426 (63%), Gaps = 8/426 (1%)

Query: 6   LYSLFLTV--VSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWW 63
           L SL  TV   +  A++LD ++  S+  AT+L+  G+ DYY G  YG T+GMF +PYYWW
Sbjct: 7   LISLLCTVWFRAGHAVELDLNNLDSLRNATSLVAYGLMDYYNGLQYGQTIGMFSNPYYWW 66

Query: 64  EAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTV 123
           EAG  +G MI+ WY  QN +Y D++  AL  QTG + DY+P NQ+  EGNDDQ  W + V
Sbjct: 67  EAGGAWGTMIDYWYYMQNDTYNDIIMQALQYQTGVNNDYVPLNQSTTEGNDDQAFWGIAV 126

Query: 124 MTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTI 183
           M+A ERNFTNP  D  P WL + QAVFN M  RWD   CNGGLRWQIF WNSGY+YKN++
Sbjct: 127 MSAAERNFTNPPAD-RPQWLYLAQAVFNTMALRWDDQTCNGGLRWQIFVWNSGYDYKNSV 185

Query: 184 SNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMK-EEANVFDGATIDDNCTSI 242
           SNG LF + ARL R+TGN +Y+E AEKV+DW+  ++ +    + A V+DG  I DNCT +
Sbjct: 186 SNGALFHIGARLARFTGNDSYVEWAEKVYDWMESVNLIEDDGKGAFVYDGVNIGDNCTKV 245

Query: 243 VKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNK 302
              +W+YNHG++L GCAY+YN T G   W  RTE+ L  A   FF   +M+E+ CQ  + 
Sbjct: 246 TNLQWTYNHGLILSGCAYLYNYT-GDAKWYNRTERFLEYA-YVFFNRTVMFEAACQGVHT 303

Query: 303 CNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFT 362
           C TDQR FKA FSR LG T+ L P T  TI   ++ S     +SCSGG DGHTCG+NWF 
Sbjct: 304 CTTDQRTFKAYFSRFLGMTAQLVPDTQHTIMTYMNASAYGAAQSCSGGYDGHTCGINWFY 363

Query: 363 GDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNIN 422
           G WDG YGLGEQ CALE++       +P P   +                 TN+    +N
Sbjct: 364 GGWDGYYGLGEQMCALEVMINTRALHVPGPYNSTNGGSSTGDGAAGTEQHPTNL--SPLN 421

Query: 423 ITAGDK 428
           IT+G +
Sbjct: 422 ITSGSR 427

>TDEL0B06580 Chr2 (1164804..1166147) [1344 bp, 447 aa] {ON}
           Anc_2.570 YKL046C
          Length = 447

 Score =  410 bits (1054), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 207/446 (46%), Positives = 268/446 (60%), Gaps = 5/446 (1%)

Query: 6   LYSLFLTVVSVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEA 65
           L +L  T     A+ +D ++  SI  A++L+  G+ DYY G  YG T+GMF  PYYWWEA
Sbjct: 7   LAALASTFACANAVWIDLNNTESIHNASSLVAVGLMDYYTGLQYGETIGMFSDPYYWWEA 66

Query: 66  GLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMT 125
           G  +G M++ W+  QN +Y D++  AL+ Q G+  DY+P NQ+  EGNDDQ  W +  MT
Sbjct: 67  GGAWGCMLDYWWYMQNDTYNDIIMQALLYQVGTHNDYVPLNQSTTEGNDDQAFWGIAAMT 126

Query: 126 AVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISN 185
           A ERNFTNP  D  P WL + QAVFN M  RWD+  CNGGLRWQIF WN+GY+YKNT+SN
Sbjct: 127 AAERNFTNPPSD-QPQWLYLAQAVFNTMALRWDTTSCNGGLRWQIFMWNTGYDYKNTVSN 185

Query: 186 GCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKY 245
           G LF LAARL RYTGN +Y++ A+KV+DW+  +  +       V+DG  I  NC +I  Y
Sbjct: 186 GALFNLAARLARYTGNQSYVDWADKVYDWMYGVGLISNGNSRFVYDGVNIAHNCANITGY 245

Query: 246 EWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNT 305
           +WSYNHG++L GCAY+YN T   + W  RT + L  A S F+ + ++YE  CQ  NKCNT
Sbjct: 246 QWSYNHGLMLSGCAYLYNMTK-DEKWGNRTFEYLNSA-SIFYNNSVLYEVACQTVNKCNT 303

Query: 306 DQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDW 365
           DQR FKA F+R LG T+ L P   D     I+ S     +SCSGG DGHTCG+NWF   W
Sbjct: 304 DQRSFKAYFTRFLGVTAELIPQARDQAMKWINASALGAAQSCSGGYDGHTCGINWFYDGW 363

Query: 366 DGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITA 425
           DG YGLGEQ  ALE +      + P P   +               S TN+    ++ITA
Sbjct: 364 DGMYGLGEQMSALEALVNTQALNRPPPYNSTNGGSSTGDGAAGTEESPTNL--SPLDITA 421

Query: 426 GDKAGAXXXXXXXXXXXXXXXXWMVL 451
           G +AGA                W++L
Sbjct: 422 GSRAGAGIITCVIGISILSCALWLIL 447

>ABR060W Chr2 (504045..505400) [1356 bp, 451 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL046C
          Length = 451

 Score =  404 bits (1038), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 201/415 (48%), Positives = 257/415 (61%), Gaps = 7/415 (1%)

Query: 19  IDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFGGMIENWYL 78
           ++LD     SI  AT+L+  G+ DYY G  YG TVG F  PYYWWEAG  +G +++ WY 
Sbjct: 22  LNLDVDDLQSIREATSLLATGLMDYYHGHDYGETVGKFSDPYYWWEAGGAWGSILDYWYY 81

Query: 79  CQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERNFTNPKEDG 138
            +N++Y D+L D+L+ Q G D  Y P N+T  EGNDDQ  W + VM A ER   NP  D 
Sbjct: 82  MENSTYNDLLTDSLLHQAGEDLSYTPWNETTTEGNDDQFFWGMAVMDAAERKNPNPPAD- 140

Query: 139 TPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQLAARLGRY 198
            P  LA+ QAVFN M  RWD + CNGGLRWQIF WN GY+YKN++SNG LF +AARL RY
Sbjct: 141 QPQRLALAQAVFNTMALRWDMETCNGGLRWQIFRWNDGYHYKNSVSNGALFHMAARLTRY 200

Query: 199 TGNTTYLEVAEKVFDWLVDIDF--VVMKEEANVFDGATIDDNCTSIVKYEWSYNHGVVLG 256
           TGN TYLE AE+V+DW+  +    +V      V+DG  I+DNCT++ K +W+YNHG+++ 
Sbjct: 201 TGNATYLEWAERVYDWMYGVGLISIVQPNWHVVYDGTDINDNCTNLNKLQWTYNHGLIMA 260

Query: 257 GCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTDQRVFKAIFSR 316
           GCA++YN T   ++W  RT + L  A   F  +D +YE+ CQ  + CN DQR FKA FSR
Sbjct: 261 GCAFIYNHTQ-DELWHQRTLRFLDSA-RIFLSNDTLYEAGCQGGDNCNIDQRSFKAYFSR 318

Query: 317 MLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWDGQYGLGEQAC 376
            LG T+ L P + +TI   I  S      SCSGG DGHTCGLNW    WDG++GLGEQ  
Sbjct: 319 FLGLTAQLVPESRETIVRWIRASAQGAAASCSGGRDGHTCGLNWLINGWDGKWGLGEQMA 378

Query: 377 ALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITAGDKAGA 431
           ALEII  L   + PAP T                    N+    ++I AGD+AGA
Sbjct: 379 ALEIIQNLRCLERPAPYTAMNGGTSPGDPAAGTKTKAENL--PPLDIKAGDRAGA 431

>Ecym_4577 Chr4 complement(1128622..1129974) [1353 bp, 450 aa] {ON}
           similar to Ashbya gossypii ABR060W
          Length = 450

 Score =  395 bits (1014), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 204/429 (47%), Positives = 268/429 (62%), Gaps = 8/429 (1%)

Query: 6   LYSLFLTVVS--VLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWW 63
           +  +FL ++   V A++LD    SS+ +AT+LI  G+ DYY G   G T+GMF SPYYWW
Sbjct: 7   ILGVFLNLLGTDVSALELDVDDFSSMQSATSLISTGVLDYYTGLDPGNTIGMFSSPYYWW 66

Query: 64  EAGLVFGGMIENWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTV 123
           EAG  +G +I+ W+  +N +Y D++  AL+ Q G   DY+P NQ+  EGNDDQ  W + V
Sbjct: 67  EAGAAWGALIDYWFYMENDTYNDIIKQALLYQVGKYEDYVPLNQSTTEGNDDQAFWGIAV 126

Query: 124 MTAVERNFTNPKEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTI 183
           M+A E+ F NP  D  P WLA+ QAVFN M  RWDS  CNGGLRWQIFTWN+GY+YKN++
Sbjct: 127 MSAAEKGFPNPDPD-QPQWLALAQAVFNTMAYRWDSSSCNGGLRWQIFTWNTGYDYKNSV 185

Query: 184 SNGCLFQLAARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEE-ANVFDGATIDDNCTSI 242
           SNG LF LAARL RYTGN +Y + AEKV+DW+  +  +    +   V+DGA I DNC+  
Sbjct: 186 SNGALFHLAARLARYTGNQSYADWAEKVYDWMASVQLINQTGDWTFVYDGAFIHDNCSRP 245

Query: 243 VKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNK 302
              +WSYNHG++LGGCAY+ + T GSDVW  RT ++L  A S FF + ++ E  CQ +  
Sbjct: 246 SVLQWSYNHGLILGGCAYLTDFT-GSDVWHNRTLRLLRSA-SIFFPNGVVTEVACQEAGT 303

Query: 303 CNTDQRVFKAIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFT 362
           CNTDQR FKA F R LG T+ L P + +     I  S      SCSGG DGHTCG+N+  
Sbjct: 304 CNTDQRSFKAYFMRFLGLTAQLIPESREIAMKWIRDSAKGAALSCSGGRDGHTCGMNYSR 363

Query: 363 GDWDGQYGLGEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNIN 422
           G +D  YGLGEQ  ALE I  L   +  +PLT S             N +   +    ++
Sbjct: 364 GSYDESYGLGEQLAALETIQNLRCLEKGSPLTASEGGTSIGNPGAGGNRNLGTL--SPLD 421

Query: 423 ITAGDKAGA 431
           I+  D+AGA
Sbjct: 422 ISNADRAGA 430

>ZYRO0E06380g Chr5 (484736..486097) [1362 bp, 453 aa] {ON} similar
           to uniprot|P36091 Saccharomyces cerevisiae YKL046C DCW1
           Mannosidase GPI-anchored membrane protein required for
           cell wall biosynthesis homologous to Dfg5p
          Length = 453

 Score =  390 bits (1001), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 190/440 (43%), Positives = 271/440 (61%), Gaps = 7/440 (1%)

Query: 15  SVLAIDLDTSSKSSICTATALIQQGISDYYEGDVYGGTVGMFVSPYYWWEAGLVFGGMIE 74
           S  A+D+D +   ++  A+AL+ +G+ DYY GD YG T+GMF  PYYWWEAG  +  +I+
Sbjct: 18  SASALDIDLNDFKTLQNASALVAKGLMDYYTGDQYGQTIGMFSWPYYWWEAGGAWNTLID 77

Query: 75  NWYLCQNTSYEDMLYDALMAQTGSDYDYMPSNQTMVEGNDDQGVWALTVMTAVERNFTNP 134
            W+  +N +Y D + +AL+ Q+G ++DY+P NQ+ VEGNDDQ  W + V+ A ER F NP
Sbjct: 78  YWFYMKNDTYNDKVTEALLYQSGDNHDYVPLNQSTVEGNDDQAFWGIAVLNAAERKFPNP 137

Query: 135 KEDGTPGWLAMVQAVFNQMYSRWDSDHCNGGLRWQIFTWNSGYNYKNTISNGCLFQLAAR 194
            +D  P WL + QAVFN M  RWD+  C GGLRWQIFTWN+GY+YKNT+SNG LF +AAR
Sbjct: 138 PDD-QPQWLYLGQAVFNTMALRWDTATCGGGLRWQIFTWNTGYDYKNTVSNGALFHIAAR 196

Query: 195 LGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEAN--VFDGATIDDNCT-SIVKYEWSYNH 251
           L  +TGN++Y++ AE+V+DW+ D+  +  + + N  V+DG  + +NC+  + +  W+YNH
Sbjct: 197 LAYFTGNSSYVDWAERVYDWMHDVKLIEPENDDNKYVYDGVDVSNNCSGPVTRIVWTYNH 256

Query: 252 GVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNKCNTDQRVFK 311
           G+VL GCAY+Y  T G  +W  R++  L  A   F+ D I+YE +CQ S  CN DQR FK
Sbjct: 257 GLVLSGCAYLYKET-GDKIWYNRSKAFLETAAKLFYNDSILYEYSCQQSKTCNVDQRSFK 315

Query: 312 AIFSRMLGYTSVLAPFTTDTITPLIDTSXXXXXKSCSGGTDGHTCGLNWFTGDWDGQYGL 371
           + +S  L  T+ L P   + I  +++ +     ++C GG DGHTCG+NW    WDGQYGL
Sbjct: 316 SYYSTFLAATAQLIPDFREQIMKVVNATAYAAAQACVGGYDGHTCGINWNQKGWDGQYGL 375

Query: 372 GEQACALEIINQLLVHDLPAPLTESTXXXXXXXXXXXLNVSTTNVLQKNINITAGDKAGA 431
           GEQ  ALE +      + PAP   +               + TN+  K ++ITAG +AGA
Sbjct: 376 GEQMAALEALVVTQAMNKPAPYNSTNGGNSTGDGAAGTQTAPTNL--KPLHITAGSRAGA 433

Query: 432 XXXXXXXXXXXXXXXXWMVL 451
                           W+V+
Sbjct: 434 GIITCVVGFSIIASFLWLVM 453

>SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {ON}
           similar to uniprot|P07272 Saccharomyces cerevisiae
           YLR014C PPR1 Zinc finger transcription factor containing
           a Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 898

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/80 (21%), Positives = 36/80 (45%), Gaps = 4/80 (5%)

Query: 243 VKYEWSYNHGVVLGGCAYMYNATNGSDVWQTRTEQILGGATSFFFEDDIMYESTCQASNK 302
           +KY W   H + + G +Y+Y   N +       ++    ++        +Y+ TC A+  
Sbjct: 670 IKYTWIAVHNLFIAGMSYLYTVYNSNKGGLESVDETKECSSKLLQVSHALYD-TCDAARN 728

Query: 303 CNTDQRVFKAIFSRMLGYTS 322
           C    R+F+ +F+ ++   S
Sbjct: 729 C---YRIFQVLFAAVIALRS 745

>Suva_10.206 Chr10 (385842..388430) [2589 bp, 862 aa] {ON} YLR115W
           (REAL)
          Length = 862

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 30/66 (45%), Gaps = 11/66 (16%)

Query: 192 AARLGRYTGNTTYLEVAEKVFDWLVDIDFVVMKEEANVFDGATIDDNCTSIVKYEWSYNH 251
           A  +G Y  N   LE  EK FD +V + +  + +  + FDG T+            +YN 
Sbjct: 108 AGVIGPYDTNKLDLEDIEKSFDHIVPLKYSQLVDLRSRFDGLTL-----------LAYNA 156

Query: 252 GVVLGG 257
           GV  GG
Sbjct: 157 GVCPGG 162

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,536,052
Number of extensions: 1994440
Number of successful extensions: 3795
Number of sequences better than 10.0: 56
Number of HSP's gapped: 3749
Number of HSP's successfully gapped: 56
Length of query: 451
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 338
Effective length of database: 40,524,141
Effective search space: 13697159658
Effective search space used: 13697159658
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)