Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F24684g3.159ON97397346120.0
AEL086W3.159ON96097434040.0
KAFR0C010603.159ON97398433980.0
SAKL0C08778g3.159ON100398133940.0
NCAS0C035303.159ON97797533930.0
KLTH0C08866g3.159ON97296333830.0
YDL031W (DBP10)3.159ON99599133550.0
Smik_4.2043.159ON99897933530.0
CAGL0K01551g3.159ON96998133460.0
Kwal_56.228043.159ON97396833430.0
Suva_4.2183.159ON1007100333430.0
NDAI0G028703.159ON99198833310.0
Skud_4.2203.159ON100199733240.0
Kpol_1032.113.159ON97798532810.0
KNAG0K011103.159ON100198532700.0
TPHA0M003303.159ON98197332210.0
ZYRO0B04972g3.159ON97998831200.0
TDEL0D046303.159ON96896831130.0
TBLA0B015903.159ON92993324200.0
TDEL0E042105.208ON7404366373e-70
CAGL0D03124g5.208ON7254336321e-69
NDAI0C024905.208ON7714106305e-69
KNAG0H025205.208ON7544106295e-69
NCAS0A015505.208ON7484126271e-68
ZYRO0B10318g5.208ON7504136242e-68
YLL008W (DRS1)5.208ON7524156234e-68
Kpol_534.535.208ON7524006217e-68
Smik_12.555.208ON7354156207e-68
TPHA0N007005.208ON7554076182e-67
KAFR0C064205.208ON7394276172e-67
KLLA0F15752g5.208ON7484046145e-67
Skud_12.595.208ON7584336121e-66
TBLA0C061605.208ON7574106102e-66
AAL164C5.208ON7344406031e-65
SAKL0G12760g5.208ON7374105994e-65
Suva_10.675.208ON7444155995e-65
KLTH0B03278g5.208ON7394075971e-64
NDAI0C042505.337ON5044205784e-64
KLLA0C14608g5.337ON4873985764e-64
TPHA0D019905.337ON4984505766e-64
Ecym_32175.337ON4863985721e-63
Kwal_33.151655.208ON7314015872e-63
NCAS0F027905.337ON5024175722e-63
KNAG0B046605.337ON4943985694e-63
ZYRO0C14234g5.337ON4944415686e-63
Kpol_1005.115.337ON5064175687e-63
TDEL0E028905.337ON5014175652e-62
SAKL0G09328g5.337ON5054305643e-62
YHR065C (RRP3)5.337ON5014205634e-62
Skud_8.1225.337ON5034135634e-62
Smik_8.1365.337ON5014205617e-62
AAL041C5.337ON4873995572e-61
CAGL0J10912g5.337ON4934175563e-61
TBLA0C035005.337ON5064205564e-61
Kwal_33.143255.337ON5004015512e-60
Suva_15.2545.337ON5034205485e-60
NDAI0F020106.148ON8884055438e-57
CAGL0L03846g2.164ON5444015233e-56
ZYRO0B09856g2.164ON5404025199e-56
KAFR0B045602.164ON5434015181e-55
NDAI0F027402.164ON5614015182e-55
TBLA0C055802.164ON5404015134e-55
TDEL0G014206.204ON5123825115e-55
ZYRO0G08580g6.204ON5394025127e-55
TDEL0F011902.164ON5494015129e-55
KLTH0D09328g2.164ON5514015111e-54
NCAS0G025602.164ON5564015111e-54
KLLA0F01034g8.614ON6274085114e-54
Skud_15.3708.614ON6094315104e-54
Smik_15.3908.614ON6094315104e-54
Suva_7.1926.204ON5184005044e-54
Smik_14.2152.164ON5474015064e-54
Ecym_54222.164ON5604015075e-54
YNL112W (DBP2)2.164ON5464015056e-54
YGL078C (DBP3)6.204ON5234005038e-54
Kwal_14.16536.148ON6883865128e-54
KLLA0F23716g2.164ON5544055031e-53
Smik_7.2056.204ON5224005011e-53
Skud_7.2046.204ON5164005002e-53
CAGL0H03377g6.204ON5404015012e-53
TBLA0D035206.148ON8894075172e-53
SAKL0A06204g6.148ON8434065152e-53
YOR204W (DED1)8.614ON6044315042e-53
Kwal_56.240056.204ON5334045003e-53
NCAS0B017308.614ON6184105034e-53
Suva_14.2262.164ON5434014985e-53
TDEL0B040606.148ON8473875125e-53
AFL027C6.148ON8164065116e-53
ZYRO0F10934g8.614ON6034135008e-53
NCAS0E039205.69ON4374124871e-52
TPHA0B028508.614ON6284114992e-52
NDAI0E015908.614ON6084074972e-52
TDEL0A055908.614ON5974064963e-52
TBLA0E041008.614ON8664245055e-52
SAKL0E10670g2.164ON5744014925e-52
NDAI0B009005.69ON4364124835e-52
AFL080W6.204ON5354044896e-52
ZYRO0G14960g6.148ON8313955037e-52
Smik_6.3188.614ON6134124939e-52
CAGL0L02915g8.614ON6174084921e-51
Kpol_1033.406.204ON5304294861e-51
YBR237W (PRP5)6.148ON8494065001e-51
TBLA0B042008.614ON6314084912e-51
NDAI0I011506.204ON5233874843e-51
KLTH0H05852g6.148ON8114064973e-51
SAKL0H08162g8.614ON6244084894e-51
Smik_8.2535.69ON4374094756e-51
Skud_8.2335.69ON4374124756e-51
NDAI0E024308.614ON6614114887e-51
YHR169W (DBP8)5.69ON4314084747e-51
TPHA0E024106.204ON5234084809e-51
Kpol_534.316.148ON8724084951e-50
KNAG0F020506.204ON5333824801e-50
Ecym_47755.40ON5004404781e-50
KAFR0B044805.69ON4354094731e-50
KLTH0H00638g5.69ON4334084731e-50
Suva_15.3695.69ON4374124731e-50
Ecym_22696.148ON8774054941e-50
KLLA0A09669g5.40ON4974294771e-50
NCAS0C017208.614ON6404134851e-50
KLLA0F10505g6.148ON8124064912e-50
YPL119C (DBP1)8.614ON6174354822e-50
Kpol_1072.508.614ON6504084833e-50
TDEL0G009305.69ON4364094694e-50
Skud_16.1618.614ON6194134804e-50
TPHA0N011306.148ON8774064886e-50
Smik_2.3806.148ON8504084861e-49
CAGL0J06908g8.614ON6044134761e-49
Skud_2.3696.148ON8484074832e-49
KLLA0A05203g5.69ON4354084633e-49
TPHA0L021605.40ON4984374673e-49
CAGL0I02354g5.69ON4374164615e-49
CAGL0M13519g5.40ON4944074646e-49
Suva_4.4946.148ON8503874798e-49
KAFR0B015205.40ON4964054631e-48
SAKL0H01430g5.40ON5004054584e-48
CAGL0K07029g6.148ON8163874716e-48
Kwal_56.247605.69ON4334094536e-48
KLTH0B08998g5.40ON4924074551e-47
Skud_13.4635.40ON5054354551e-47
KAFR0G034806.148ON8524064691e-47
KAFR0G020308.614ON6064084601e-47
NCAS0H012806.148ON8874054682e-47
TDEL0G006505.40ON4854044512e-47
TBLA0B079505.69ON3934094453e-47
TBLA0C067805.40ON4964354513e-47
AGR333C5.40ON5044044523e-47
Kpol_513.155.40ON5014054514e-47
NCAS0F022005.40ON5084044514e-47
KLLA0A10659g3.249ON3984204435e-47
Suva_13.4805.40ON5054514496e-47
Ecym_13958.469ON5654434521e-46
ZYRO0D07546g5.40ON4944054471e-46
SAKL0D03960g3.249ON3983994401e-46
YDR243C (PRP28)8.469ON5884114512e-46
KNAG0M006606.148ON8844074612e-46
AER301C5.69ON4354274412e-46
Kwal_23.42885.40ON4924204433e-46
YMR290C (HAS1)5.40ON5054044444e-46
NDAI0C036005.40ON5194034445e-46
KNAG0H013703.249ON3984014355e-46
Skud_4.5058.469ON6044104486e-46
Smik_13.5065.40ON5054044426e-46
NCAS0A104303.249ON3994214348e-46
KNAG0D027805.40ON4764044399e-46
TBLA0D028008.469ON5874224451e-45
Suva_2.4098.469ON5894004451e-45
Smik_4.4908.469ON5874114441e-45
Kwal_27.117348.469ON5714284412e-45
TPHA0M009003.249ON4004044302e-45
KAFR0E011603.249ON4054274294e-45
NCAS0B025708.469ON5903964404e-45
Kpol_1036.33.249ON3994004284e-45
YDR021W (FAL1)3.249ON3994004285e-45
TBLA0I018603.249ON3874214275e-45
ZYRO0A03476g3.249ON3994214277e-45
Ecym_47553.249ON3984004261e-44
Skud_4.2733.249ON3994004251e-44
TDEL0D037603.249ON3984004251e-44
Suva_2.1713.249ON3994214251e-44
Smik_4.2553.249ON3994214232e-44
CAGL0M06567g3.249ON3994034205e-44
CAGL0K11198g8.469ON5824394309e-44
NDAI0A058603.249ON3994004171e-43
Kwal_26.84702.164ON4253624182e-43
TBLA0C006408.124ON5794464272e-43
Kpol_165.12.164ON4413624173e-43
AER408W3.249ON3983994118e-43
ZYRO0A10802g5.241ON7714394298e-43
KLTH0C07964g3.249ON3983994101e-42
TPHA0B029302.164ON4273664075e-42
KLTH0A02244g8.87ON5984164158e-42
KNAG0I020502.164ON4233614058e-42
TDEL0B016708.469ON5794094131e-41
TPHA0C018608.469ON6074044132e-41
TBLA0D034005.241ON7754094172e-41
Skud_14.2192.164ON4353664005e-41
Smik_15.2245.643ON4774054035e-41
Skud_15.2105.643ON4824054026e-41
Suva_8.985.643ON4824054027e-41
SAKL0H11968g8.469ON5664284067e-41
KAFR0E028108.469ON5683834069e-41
CAGL0L08976g8.87ON6174084052e-40
Kpol_1058.438.87ON6074024033e-40
Kwal_23.51258.87ON5984064015e-40
KAFR0D046305.337ON4872713965e-40
TPHA0B030401.211ON3963793897e-40
ZYRO0E02530g8.124ON5564133961e-39
Skud_6.728.87ON6064163981e-39
KLTH0H15686g2.384ON4394493882e-39
YOR046C (DBP5)5.643ON4824053902e-39
AGL112C8.402ON6583983983e-39
Ecym_73248.87ON5974083953e-39
KLLA0A05731g1.211ON3963793843e-39
ACR253C1.211ON3963973834e-39
NCAS0J005808.87ON6114063944e-39
Smik_6.818.87ON6064163945e-39
YFL002C (SPB4)8.87ON6064163937e-39
KAFR0G006501.211ON3953793809e-39
KLLA0E21935g2.384ON4374463821e-38
ZYRO0F04312g8.87ON6024063901e-38
YJL138C (TIF2)1.211ON3953783773e-38
YKR059W (TIF1)1.211ON3953783773e-38
Kpol_2001.677.336ON4842083813e-38
SAKL0F11088g7.336ON4972153824e-38
TDEL0H009301.211ON3953783746e-38
TPHA0D009408.124ON5704593836e-38
Kpol_1060.581.211ON3963783746e-38
ADR260C2.384ON4384473767e-38
NCAS0A140607.336ON5102153807e-38
ZYRO0B05852g3.122ON7514253897e-38
KLTH0F08382g8.402ON6574533859e-38
TPHA0D007708.87ON6054023831e-37
YBR142W (MAK5)3.122ON7734603881e-37
Ecym_60492.384ON4384063741e-37
Ecym_51961.211ON3963783721e-37
KNAG0C038207.336ON5132183782e-37
ACR197W7.336ON4842433752e-37
SAKL0B02794g8.87ON5984063802e-37
KAFR0B009107.336ON5122113763e-37
Smik_10.941.211ON3953783693e-37
Smik_11.3211.211ON3953783693e-37
ZYRO0F11440g7.336ON5232393763e-37
Suva_6.598.87ON6064023793e-37
CAGL0I04356g1.211ON3963783683e-37
TBLA0D057501.211ON4013793693e-37
SAKL0H13574g8.402ON6684123813e-37
KLTH0F05610g1.211ON3963783684e-37
NCAS0B081301.211ON3963783684e-37
ZYRO0C04378g8.402ON6814123814e-37
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F24684g
         (973 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa]...  1781   0.0  
AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic ho...  1315   0.0  
KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {O...  1313   0.0  
SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} simil...  1311   0.0  
NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159   1311   0.0  
KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly...  1307   0.0  
YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putat...  1296   0.0  
Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W ...  1296   0.0  
CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highl...  1293   0.0  
Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {...  1292   0.0  
Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W...  1292   0.0  
NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON}             1287   0.0  
Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W...  1285   0.0  
Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {O...  1268   0.0  
KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON} Anc_3...  1264   0.0  
TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON}    1245   0.0  
ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {...  1206   0.0  
TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {O...  1203   0.0  
TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.1...   936   0.0  
TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {O...   249   3e-70
CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {...   248   1e-69
NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {O...   247   5e-69
KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {O...   246   5e-69
NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {O...   246   1e-68
ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {...   244   2e-68
YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}  DRS1Nucle...   244   4e-68
Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON} (137204...   243   7e-68
Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W...   243   7e-68
TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5....   242   2e-67
KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa] ...   242   2e-67
KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} simi...   241   5e-67
Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W...   240   1e-66
TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON} Anc_5...   239   2e-66
AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON} Syn...   236   1e-65
SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]...   235   4e-65
Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W...   235   5e-65
KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {...   234   1e-64
NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337    227   4e-64
KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} high...   226   4e-64
TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {O...   226   6e-64
Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}...   224   1e-63
Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008...   230   2e-63
NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337    224   2e-63
KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {O...   223   4e-63
ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]...   223   6e-63
Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {O...   223   7e-63
TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.3...   222   2e-62
SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly...   221   3e-62
YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}  ...   221   4e-62
Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON...   221   4e-62
Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON...   220   7e-62
AAL041C Chr1 complement(270739..272202) [1464 bp, 487 aa] {ON} S...   219   2e-61
CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} hig...   218   3e-61
TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {O...   218   4e-61
Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065...   216   2e-60
Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {...   215   5e-60
NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148    213   8e-57
CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [16...   206   3e-56
ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [162...   204   9e-56
KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632...   204   1e-55
NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686...   204   2e-55
TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 5...   202   4e-55
TDEL0G01420 Chr7 (287165..288703) [1539 bp, 512 aa] {ON} Anc_6.2...   201   5e-55
ZYRO0G08580g Chr7 complement(695127..696746) [1620 bp, 539 aa] {...   201   7e-55
TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 a...   201   9e-55
KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [165...   201   1e-54
NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 a...   201   1e-54
KLLA0F01034g Chr6 (93422..95305) [1884 bp, 627 aa] {ON} similar ...   201   4e-54
Skud_15.370 Chr15 (661915..663744) [1830 bp, 609 aa] {ON} YOR204...   201   4e-54
Smik_15.390 Chr15 (672576..674405) [1830 bp, 609 aa] {ON} YOR204...   201   4e-54
Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON...   198   4e-54
Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 ...   199   4e-54
Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 b...   199   5e-54
YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa] ...   199   6e-54
YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}  ...   198   8e-54
Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {O...   201   8e-54
KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129) ...   198   1e-53
Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON...   197   1e-53
Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON...   197   2e-53
CAGL0H03377g Chr8 complement(313755..315377) [1623 bp, 540 aa] {...   197   2e-53
TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.1...   203   2e-53
SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {...   202   2e-53
YOR204W Chr15 (722911..724725) [1815 bp, 604 aa] {ON}  DED1ATP-d...   198   2e-53
Kwal_56.24005 s56 complement(809954..811555) [1602 bp, 533 aa] {...   197   3e-53
NCAS0B01730 Chr2 complement(286249..288105) [1857 bp, 618 aa] {O...   198   4e-53
Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 ...   196   5e-53
TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {O...   201   5e-53
AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON} S...   201   6e-53
ZYRO0F10934g Chr6 (890412..892223) [1812 bp, 603 aa] {ON} simila...   197   8e-53
NCAS0E03920 Chr5 complement(769305..770618) [1314 bp, 437 aa] {O...   192   1e-52
TPHA0B02850 Chr2 complement(650888..652774) [1887 bp, 628 aa] {O...   196   2e-52
NDAI0E01590 Chr5 complement(315658..317484) [1827 bp, 608 aa] {O...   196   2e-52
TDEL0A05590 Chr1 (980392..982185) [1794 bp, 597 aa] {ON} Anc_8.6...   195   3e-52
TBLA0E04100 Chr5 (1032727..1035327) [2601 bp, 866 aa] {ON} Anc_8...   199   5e-52
SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [172...   194   5e-52
NDAI0B00900 Chr2 complement(209012..210322) [1311 bp, 436 aa] {O...   190   5e-52
AFL080W Chr6 (288205..289812) [1608 bp, 535 aa] {ON} Syntenic ho...   192   6e-52
ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} simi...   198   7e-52
Smik_6.318 Chr6 (498013..499854) [1842 bp, 613 aa] {ON} YPL119C ...   194   9e-52
CAGL0L02915g Chr12 complement(342831..344684) [1854 bp, 617 aa] ...   194   1e-51
Kpol_1033.40 s1033 complement(104203..105795) [1593 bp, 530 aa] ...   191   1e-51
YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA he...   197   1e-51
TBLA0B04200 Chr2 complement(970057..971952) [1896 bp, 631 aa] {O...   193   2e-51
NDAI0I01150 Chr9 (278832..280403) [1572 bp, 523 aa] {ON} Anc_6.204    191   3e-51
KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {...   196   3e-51
SAKL0H08162g Chr8 complement(702292..704166) [1875 bp, 624 aa] {...   192   4e-51
Smik_8.253 Chr8 (419155..420468) [1314 bp, 437 aa] {ON} YHR169W ...   187   6e-51
Skud_8.233 Chr8 (413556..414869) [1314 bp, 437 aa] {ON} YHR169W ...   187   6e-51
NDAI0E02430 Chr5 complement(503901..505886) [1986 bp, 661 aa] {O...   192   7e-51
YHR169W Chr8 (442181..443476) [1296 bp, 431 aa] {ON}  DBP8ATPase...   187   7e-51
TPHA0E02410 Chr5 (512919..514490) [1572 bp, 523 aa] {ON} Anc_6.2...   189   9e-51
Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}...   195   1e-50
KNAG0F02050 Chr6 (392126..393727) [1602 bp, 533 aa] {ON} Anc_6.2...   189   1e-50
Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar...   188   1e-50
KAFR0B04480 Chr2 complement(929008..930315) [1308 bp, 435 aa] {O...   186   1e-50
KLTH0H00638g Chr8 complement(64621..65922) [1302 bp, 433 aa] {ON...   186   1e-50
Suva_15.369 Chr15 (648232..649545) [1314 bp, 437 aa] {ON} YHR169...   186   1e-50
Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}...   194   1e-50
KLLA0A09669g Chr1 complement(847036..848529) [1494 bp, 497 aa] {...   188   1e-50
NCAS0C01720 Chr3 complement(317951..319873) [1923 bp, 640 aa] {O...   191   1e-50
KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {...   193   2e-50
YPL119C Chr16 complement(324411..326264) [1854 bp, 617 aa] {ON} ...   190   2e-50
Kpol_1072.50 s1072 complement(115009..116961) [1953 bp, 650 aa] ...   190   3e-50
TDEL0G00930 Chr7 complement(186836..188146) [1311 bp, 436 aa] {O...   185   4e-50
Skud_16.161 Chr16 complement(295968..297827) [1860 bp, 619 aa] {...   189   4e-50
TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {...   192   6e-50
Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W ...   191   1e-49
CAGL0J06908g Chr10 complement(662041..663855) [1815 bp, 604 aa] ...   187   1e-49
Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W ...   190   2e-49
KLLA0A05203g Chr1 complement(462167..463474) [1308 bp, 435 aa] {...   182   3e-49
TPHA0L02160 Chr12 complement(448305..449801) [1497 bp, 498 aa] {...   184   3e-49
CAGL0I02354g Chr9 (209279..210592) [1314 bp, 437 aa] {ON} highly...   182   5e-49
CAGL0M13519g Chr13 complement(1330802..1332286) [1485 bp, 494 aa...   183   6e-49
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...   189   8e-49
KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.4...   182   1e-48
SAKL0H01430g Chr8 (149724..151226) [1503 bp, 500 aa] {ON} highly...   181   4e-48
CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa] ...   186   6e-48
Kwal_56.24760 s56 (1136947..1138248) [1302 bp, 433 aa] {ON} YHR1...   179   6e-48
KLTH0B08998g Chr2 complement(731722..733200) [1479 bp, 492 aa] {...   179   1e-47
Skud_13.463 Chr13 complement(823646..825163) [1518 bp, 505 aa] {...   179   1e-47
KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.1...   185   1e-47
KAFR0G02030 Chr7 complement(428516..430336) [1821 bp, 606 aa] {O...   181   1e-47
NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {O...   184   2e-47
TDEL0G00650 Chr7 (132659..134116) [1458 bp, 485 aa] {ON} Anc_5.4...   178   2e-47
TBLA0B07950 Chr2 complement(1884315..1885496) [1182 bp, 393 aa] ...   176   3e-47
TBLA0C06780 Chr3 complement(1636223..1637713) [1491 bp, 496 aa] ...   178   3e-47
AGR333C Chr7 complement(1353154..1354668) [1515 bp, 504 aa] {ON}...   178   3e-47
Kpol_513.15 s513 complement(41334..42839) [1506 bp, 501 aa] {ON}...   178   4e-47
NCAS0F02200 Chr6 (438960..440486) [1527 bp, 508 aa] {ON} Anc_5.40     178   4e-47
KLLA0A10659g Chr1 complement(927059..928255) [1197 bp, 398 aa] {...   175   5e-47
Suva_13.480 Chr13 complement(832037..833554) [1518 bp, 505 aa] {...   177   6e-47
Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}...   178   1e-46
ZYRO0D07546g Chr4 (657145..658629) [1485 bp, 494 aa] {ON} highly...   176   1e-46
SAKL0D03960g Chr4 complement(321960..323156) [1197 bp, 398 aa] {...   174   1e-46
YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}  ...   178   2e-46
KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {...   182   2e-46
AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}...   174   2e-46
Kwal_23.4288 s23 (654900..656378) [1479 bp, 492 aa] {ON} YMR290C...   175   3e-46
YMR290C Chr13 complement(850074..851591) [1518 bp, 505 aa] {ON} ...   175   4e-46
NDAI0C03600 Chr3 complement(826718..828277) [1560 bp, 519 aa] {O...   175   5e-46
KNAG0H01370 Chr8 complement(243799..244995) [1197 bp, 398 aa] {O...   172   5e-46
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...   177   6e-46
Smik_13.506 Chr13 complement(832760..834277) [1518 bp, 505 aa] {...   174   6e-46
NCAS0A10430 Chr1 (2073293..2074492) [1200 bp, 399 aa] {ON} Anc_3...   171   8e-46
KNAG0D02780 Chr4 complement(504774..506204) [1431 bp, 476 aa] {O...   173   9e-46
TBLA0D02800 Chr4 (686898..688661) [1764 bp, 587 aa] {ON} Anc_8.4...   176   1e-45
Suva_2.409 Chr2 complement(727948..729717) [1770 bp, 589 aa] {ON...   176   1e-45
Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON...   175   1e-45
Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {...   174   2e-45
TPHA0M00900 Chr13 (175733..176935) [1203 bp, 400 aa] {ON} Anc_3....   170   2e-45
KAFR0E01160 Chr5 (232985..234202) [1218 bp, 405 aa] {ON} Anc_3.2...   169   4e-45
NCAS0B02570 Chr2 (429423..431195) [1773 bp, 590 aa] {ON} Anc_8.469    174   4e-45
Kpol_1036.3 s1036 complement(10496..11695) [1200 bp, 399 aa] {ON...   169   4e-45
YDR021W Chr4 (486804..488003) [1200 bp, 399 aa] {ON}  FAL1Nucleo...   169   5e-45
TBLA0I01860 Chr9 (418583..419746) [1164 bp, 387 aa] {ON} Anc_3.2...   169   5e-45
ZYRO0A03476g Chr1 complement(277585..278784) [1200 bp, 399 aa] {...   169   7e-45
Ecym_4755 Chr4 complement(1469426..1470622) [1197 bp, 398 aa] {O...   168   1e-44
Skud_4.273 Chr4 (477488..478687) [1200 bp, 399 aa] {ON} YDR021W ...   168   1e-44
TDEL0D03760 Chr4 complement(689455..690651) [1197 bp, 398 aa] {O...   168   1e-44
Suva_2.171 Chr2 (297542..298741) [1200 bp, 399 aa] {ON} YDR021W ...   168   1e-44
Smik_4.255 Chr4 (467483..468682) [1200 bp, 399 aa] {ON} YDR021W ...   167   2e-44
CAGL0M06567g Chr13 complement(679126..680325) [1200 bp, 399 aa] ...   166   5e-44
CAGL0K11198g Chr11 complement(1087381..1089129) [1749 bp, 582 aa...   170   9e-44
NDAI0A05860 Chr1 complement(1331381..1332580) [1200 bp, 399 aa] ...   165   1e-43
Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {O...   165   2e-43
TBLA0C00640 Chr3 (129301..131040) [1740 bp, 579 aa] {ON} Anc_8.1...   169   2e-43
Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON} com...   165   3e-43
AER408W Chr5 (1418694..1419890) [1197 bp, 398 aa] {ON} Syntenic ...   162   8e-43
ZYRO0A10802g Chr1 complement(869465..871780) [2316 bp, 771 aa] {...   169   8e-43
KLTH0C07964g Chr3 complement(679877..681073) [1197 bp, 398 aa] {...   162   1e-42
TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.1...   161   5e-42
KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} simila...   164   8e-42
KNAG0I02050 Chr9 complement(399547..399554,399758..401021) [1272...   160   8e-42
TDEL0B01670 Chr2 (297786..299525) [1740 bp, 579 aa] {ON}              163   1e-41
TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.4...   163   2e-41
TBLA0D03400 Chr4 (844529..846856) [2328 bp, 775 aa] {ON} Anc_5.2...   165   2e-41
Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112...   158   5e-41
Smik_15.224 Chr15 complement(380539..381972) [1434 bp, 477 aa] {...   159   5e-41
Skud_15.210 Chr15 complement(374410..375858) [1449 bp, 482 aa] {...   159   6e-41
Suva_8.98 Chr8 complement(177272..178720) [1449 bp, 482 aa] {ON}...   159   7e-41
SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} simi...   160   7e-41
KAFR0E02810 Chr5 complement(567875..569581) [1707 bp, 568 aa] {O...   160   9e-41
CAGL0L08976g Chr12 complement(981008..982861) [1854 bp, 617 aa] ...   160   2e-40
Kpol_1058.43 s1058 complement(121252..123075) [1824 bp, 607 aa] ...   159   3e-40
Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa] ...   159   5e-40
KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {O...   157   5e-40
TPHA0B03040 Chr2 complement(690810..692000) [1191 bp, 396 aa] {O...   154   7e-40
ZYRO0E02530g Chr5 (197126..198796) [1671 bp, 556 aa] {ON} highly...   157   1e-39
Skud_6.72 Chr6 complement(140844..142664) [1821 bp, 606 aa] {ON}...   157   1e-39
KLTH0H15686g Chr8 complement(1353647..1354725,1354841..1355081) ...   154   2e-39
YOR046C Chr15 complement(414459..415907) [1449 bp, 482 aa] {ON} ...   154   2e-39
AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON} S...   157   3e-39
Ecym_7324 Chr7 complement(689228..691021) [1794 bp, 597 aa] {ON}...   156   3e-39
KLLA0A05731g Chr1 (536243..537433) [1191 bp, 396 aa] {ON} highly...   152   3e-39
ACR253C Chr3 complement(802236..803426) [1191 bp, 396 aa] {ON} S...   152   4e-39
NCAS0J00580 Chr10 (87108..88943) [1836 bp, 611 aa] {ON} Anc_8.87      156   4e-39
Smik_6.81 Chr6 complement(152467..154287) [1821 bp, 606 aa] {ON}...   156   5e-39
YFL002C Chr6 complement(145114..146934) [1821 bp, 606 aa] {ON}  ...   155   7e-39
KAFR0G00650 Chr7 complement(164087..165274) [1188 bp, 395 aa] {O...   150   9e-39
KLLA0E21935g Chr5 (1959770..1961083) [1314 bp, 437 aa] {ON} high...   151   1e-38
ZYRO0F04312g Chr6 complement(366863..368671) [1809 bp, 602 aa] {...   154   1e-38
YJL138C Chr10 complement(153504..154691) [1188 bp, 395 aa] {ON} ...   149   3e-38
YKR059W Chr11 (554987..556174) [1188 bp, 395 aa] {ON}  TIF1Trans...   149   3e-38
Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON} (1851...   151   3e-38
SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {...   151   4e-38
TDEL0H00930 Chr8 complement(152864..154051) [1188 bp, 395 aa] {O...   148   6e-38
TPHA0D00940 Chr4 complement(186966..188678) [1713 bp, 570 aa] {O...   152   6e-38
Kpol_1060.58 s1060 complement(135570..136760) [1191 bp, 396 aa] ...   148   6e-38
ADR260C Chr4 complement(1152257..1153573) [1317 bp, 438 aa] {ON}...   149   7e-38
NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON} Anc_7...   150   7e-38
ZYRO0B05852g Chr2 (468295..470550) [2256 bp, 751 aa] {ON} simila...   154   7e-38
KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} simila...   152   9e-38
TPHA0D00770 Chr4 (155185..157002) [1818 bp, 605 aa] {ON} Anc_8.8...   152   1e-37
YBR142W Chr2 (528317..530638) [2322 bp, 773 aa] {ON}  MAK5Essent...   154   1e-37
Ecym_6049 Chr6 (94618..95934) [1317 bp, 438 aa] {ON} similar to ...   148   1e-37
Ecym_5196 Chr5 complement(405570..406760) [1191 bp, 396 aa] {ON}...   147   1e-37
KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {O...   150   2e-37
ACR197W Chr3 (695405..696859) [1455 bp, 484 aa] {ON} Syntenic ho...   149   2e-37
SAKL0B02794g Chr2 complement(266645..268441) [1797 bp, 598 aa] {...   150   2e-37
KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {O...   149   3e-37
Smik_10.94 Chr10 complement(151257..152444) [1188 bp, 395 aa] {O...   146   3e-37
Smik_11.321 Chr11 (544869..546056) [1188 bp, 395 aa] {ON} YKR059...   146   3e-37
ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly...   149   3e-37
Suva_6.59 Chr6 complement(110278..112098) [1821 bp, 606 aa] {ON}...   150   3e-37
CAGL0I04356g Chr9 (389225..390415) [1191 bp, 396 aa] {ON} highly...   146   3e-37
TBLA0D05750 Chr4 (1420975..1422180) [1206 bp, 401 aa] {ON} Anc_1...   146   3e-37
SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} simi...   151   3e-37
KLTH0F05610g Chr6 complement(483243..484433) [1191 bp, 396 aa] {...   146   4e-37
NCAS0B08130 Chr2 (1551641..1552831) [1191 bp, 396 aa] {ON} Anc_1...   146   4e-37
ZYRO0C04378g Chr3 complement(342717..344762) [2046 bp, 681 aa] {...   151   4e-37
Kpol_1058.53 s1058 complement(136863..138191) [1329 bp, 442 aa] ...   147   4e-37
Suva_11.294 Chr11 (539139..540329) [1191 bp, 396 aa] {ON} YKR059...   145   5e-37
Smik_2.282 Chr2 (512869..515271) [2403 bp, 800 aa] {ON} YBR142W ...   151   5e-37
TBLA0H03240 Chr8 complement(787863..790166) [2304 bp, 767 aa] {O...   151   6e-37
Suva_4.163 Chr4 (294691..296031) [1341 bp, 446 aa] {ON} YDL084W ...   147   6e-37
Skud_10.76 Chr10 complement(128551..129738) [1188 bp, 395 aa] {O...   145   6e-37
Ecym_4646 Chr4 complement(1259564..1261036) [1473 bp, 490 aa] {O...   147   6e-37
KNAG0C01220 Chr3 complement(237478..238671) [1194 bp, 397 aa] {O...   145   6e-37
NDAI0B05440 Chr2 (1333810..1335000) [1191 bp, 396 aa] {ON} Anc_1...   145   7e-37
NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {O...   148   7e-37
Suva_6.218 Chr6 (395411..396601) [1191 bp, 396 aa] {ON} YJL138C ...   145   8e-37
Skud_4.171 Chr4 (300716..302056) [1341 bp, 446 aa] {ON} YDL084W ...   146   1e-36
YDL084W Chr4 (305237..306577) [1341 bp, 446 aa] {ON}  SUB2Compon...   146   1e-36
TDEL0C02100 Chr3 complement(362760..364199) [1440 bp, 479 aa] {O...   146   1e-36
ZYRO0D03058g Chr4 complement(237526..238713) [1188 bp, 395 aa] {...   144   1e-36
Kwal_23.3235 s23 (209691..211721) [2031 bp, 676 aa] {ON} YDR194C...   149   1e-36
Skud_11.295 Chr11 (536422..537711) [1290 bp, 429 aa] {ON} YKR059...   145   2e-36
SAKL0C06336g Chr3 complement(584406..585599) [1194 bp, 397 aa] {...   144   2e-36
Kpol_340.2 s340 complement(3233..5245) [2013 bp, 670 aa] {ON} co...   149   2e-36
KLTH0F07106g Chr6 (618637..620214) [1578 bp, 525 aa] {ON} highly...   146   3e-36
KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]...   146   3e-36
Smik_4.152 Chr4 (281728..283068) [1341 bp, 446 aa] {ON} YDL084W ...   144   4e-36
TDEL0F05260 Chr6 complement(983324..985291) [1968 bp, 655 aa] {O...   147   4e-36
KNAG0L00410 Chr12 complement(57484..59325) [1842 bp, 613 aa] {ON...   147   4e-36
KAFR0B06170 Chr2 complement(1271195..1273066) [1872 bp, 623 aa] ...   147   5e-36
TBLA0C00690 Chr3 complement(136694..138508) [1815 bp, 604 aa] {O...   147   5e-36
TPHA0G02050 Chr7 (420332..421648) [1317 bp, 438 aa] {ON} Anc_2.3...   144   5e-36
Ecym_8261 Chr8 complement(528229..530556) [2328 bp, 775 aa] {ON}...   148   6e-36
Kwal_33.14000 s33 complement(477253..478443) [1191 bp, 396 aa] {...   142   6e-36
CAGL0L06908g Chr12 complement(779554..780873) [1320 bp, 439 aa] ...   143   7e-36
TBLA0F02360 Chr6 (582109..583866) [1758 bp, 585 aa] {ON} Anc_7.3...   146   7e-36
Smik_4.77 Chr4 complement(147172..148692) [1521 bp, 506 aa] {ON}...   145   7e-36
Skud_4.96 Chr4 complement(166027..167550) [1524 bp, 507 aa] {ON}...   144   8e-36
NCAS0A03950 Chr1 (799925..801265) [1341 bp, 446 aa] {ON} Anc_2.384    143   8e-36
SAKL0E05148g Chr5 complement(419901..420979,421045..421372) [140...   144   8e-36
TPHA0D04520 Chr4 (985683..987191) [1509 bp, 502 aa] {ON} Anc_7.3...   144   9e-36
KLLA0C16599g Chr3 (1453655..1455199) [1545 bp, 514 aa] {ON} simi...   144   9e-36
CAGL0I03476g Chr9 complement(294849..296372) [1524 bp, 507 aa] {...   144   1e-35
YDR194C Chr4 complement(845952..847946) [1995 bp, 664 aa] {ON}  ...   146   1e-35
YDL160C Chr4 complement(170410..171930) [1521 bp, 506 aa] {ON}  ...   144   2e-35
TDEL0G03140 Chr7 (587922..589256) [1335 bp, 444 aa] {ON} Anc_2.3...   142   2e-35
Ecym_4165 Chr4 (350595..352571) [1977 bp, 658 aa] {ON} similar t...   145   2e-35
TBLA0B08880 Chr2 complement(2108994..2110322) [1329 bp, 442 aa] ...   142   2e-35
Suva_4.86 Chr4 complement(158173..159699) [1527 bp, 508 aa] {ON}...   143   3e-35
TBLA0B09205 Chr2 (2175882..2177243) [1362 bp, 453 aa] {ON}            142   3e-35
CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} simila...   145   3e-35
TPHA0L00960 Chr12 complement(194538..196568) [2031 bp, 676 aa] {...   145   3e-35
Smik_4.442 Chr4 complement(801552..803549) [1998 bp, 665 aa] {ON...   145   4e-35
ZYRO0A08272g Chr1 (665522..666853) [1332 bp, 443 aa] {ON} highly...   141   4e-35
KNAG0H01520 Chr8 complement(267709..269574) [1866 bp, 621 aa] {O...   144   4e-35
NDAI0E01750 Chr5 complement(346153..347505) [1353 bp, 450 aa] {O...   141   4e-35
Kpol_1041.33 s1041 complement(82855..84180) [1326 bp, 441 aa] {O...   141   5e-35
KLTH0H01562g Chr8 complement(140915..142390) [1476 bp, 491 aa] {...   142   5e-35
Skud_4.458 Chr4 complement(812448..814442) [1995 bp, 664 aa] {ON...   144   9e-35
TPHA0G02585 Chr7 (535997..537313) [1317 bp, 438 aa] {ON}              139   1e-34
KAFR0H02820 Chr8 (537121..538956) [1836 bp, 611 aa] {ON} Anc_8.6...   142   1e-34
KLTH0H04466g Chr8 (399689..401350) [1662 bp, 553 aa] {ON} simila...   141   2e-34
KAFR0F02940 Chr6 (582057..583388) [1332 bp, 443 aa] {ON} Anc_2.3...   139   2e-34
Suva_16.191 Chr16 complement(333913..335769) [1857 bp, 618 aa] {...   142   3e-34
Kwal_56.24588 s56 (1065225..1066766) [1542 bp, 513 aa] {ON} YDL1...   140   3e-34
NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241    143   3e-34
KNAG0A04660 Chr1 (663566..665707) [2142 bp, 713 aa] {ON} Anc_8.4...   142   4e-34
TDEL0C01160 Chr3 complement(198802..200613) [1812 bp, 603 aa] {O...   140   4e-34
Suva_8.257 Chr8 (461776..463632) [1857 bp, 618 aa] {ON} YOR204W ...   140   5e-34
AFL221C Chr6 complement(22711..23108,23775..25050) [1674 bp, 557...   140   6e-34
TPHA0N00940 Chr14 (202770..205085) [2316 bp, 771 aa] {ON} Anc_5....   141   9e-34
ADL273C Chr4 complement(225068..226939) [1872 bp, 623 aa] {ON} S...   140   1e-33
KAFR0E01640 Chr5 complement(335123..337405) [2283 bp, 760 aa] {O...   141   1e-33
ADL024C Chr4 complement(657270..658979) [1710 bp, 569 aa] {ON} S...   139   1e-33
KLLA0C15499g Chr3 complement(1345201..1346715) [1515 bp, 504 aa]...   137   3e-33
KLTH0D09746g Chr4 (805863..807728) [1866 bp, 621 aa] {ON} simila...   138   3e-33
KLTH0H08646g Chr8 (750413..752113) [1701 bp, 566 aa] {ON} highly...   137   4e-33
Suva_2.362 Chr2 complement(636909..638903) [1995 bp, 664 aa] {ON...   138   5e-33
SAKL0G11748g Chr7 complement(998525..1000816) [2292 bp, 763 aa] ...   137   1e-32
ACR040W Chr3 (431343..433634) [2292 bp, 763 aa] {ON} Syntenic ho...   137   1e-32
KAFR0C02220 Chr3 complement(439704..441239) [1536 bp, 511 aa] {O...   134   2e-32
NDAI0C04680 Chr3 complement(1077391..1079541) [2151 bp, 716 aa] ...   137   2e-32
NCAS0B03030 Chr2 (522163..524217) [2055 bp, 684 aa] {ON} Anc_8.402    136   2e-32
Ecym_2213 Chr2 (419873..421537) [1665 bp, 554 aa] {ON} similar t...   135   3e-32
Ecym_8298 Chr8 (605258..607174) [1917 bp, 638 aa] {ON} similar t...   135   3e-32
NCAS0D03740 Chr4 complement(694809..696368) [1560 bp, 519 aa] {O...   134   3e-32
TDEL0F01090 Chr6 (196968..198623) [1656 bp, 551 aa] {ON} Anc_8.1...   134   4e-32
KNAG0F02610 Chr6 complement(488956..491244) [2289 bp, 762 aa] {O...   136   4e-32
SAKL0A04752g Chr1 (434100..435749) [1650 bp, 549 aa] {ON} simila...   134   4e-32
KLLA0D09504g Chr4 complement(801783..804095) [2313 bp, 770 aa] {...   136   4e-32
Kwal_23.2883 s23 complement(58087..60381) [2295 bp, 764 aa] {ON}...   135   6e-32
NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241    135   9e-32
Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON} (25289....   135   1e-31
TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {O...   134   1e-31
TBLA0B05050 Chr2 (1191456..1192997) [1542 bp, 513 aa] {ON} Anc_6...   132   1e-31
KLTH0G07766g Chr7 complement(626094..628388) [2295 bp, 764 aa] {...   134   2e-31
Kpol_1062.5 s1062 complement(10370..11665) [1296 bp, 431 aa] {ON...   129   3e-31
Skud_7.100 Chr7 (187842..189518) [1677 bp, 558 aa] {ON} YGL171W ...   131   3e-31
CAGL0J01045g Chr10 (101282..103579) [2298 bp, 765 aa] {ON} highl...   132   4e-31
KLLA0D18667g Chr4 complement(1574160..1576217) [2058 bp, 685 aa]...   131   1e-30
Smik_7.100 Chr7 (177395..179068) [1674 bp, 557 aa] {ON} YGL171W ...   129   1e-30
Suva_7.92 Chr7 (178376..180052) [1677 bp, 558 aa] {ON} YGL171W (...   129   2e-30
CAGL0K02387g Chr11 (216795..218492) [1698 bp, 565 aa] {ON} highl...   129   2e-30
Ecym_8358 Chr8 (719978..721687) [1710 bp, 569 aa] {ON} similar t...   129   2e-30
SAKL0H02178g Chr8 complement(211451..212758) [1308 bp, 435 aa] {...   126   3e-30
KLLA0E14367g Chr5 (1268901..1270691) [1791 bp, 596 aa] {ON} simi...   128   5e-30
YGL171W Chr7 (182390..184084) [1695 bp, 564 aa] {ON}  ROK1RNA-de...   127   6e-30
Suva_12.48 Chr12 (66743..69055) [2313 bp, 770 aa] {ON} YJL033W (...   129   6e-30
NDAI0B02410 Chr2 complement(602541..604256) [1716 bp, 571 aa] {O...   127   7e-30
YJL033W Chr10 (383837..386149) [2313 bp, 770 aa] {ON}  HCA4Putat...   129   7e-30
Suva_11.256 Chr11 complement(469196..471424) [2229 bp, 742 aa] {...   129   9e-30
NDAI0C06300 Chr3 complement(1459510..1461354) [1845 bp, 614 aa] ...   127   9e-30
Smik_10.239 Chr10 (380101..382413) [2313 bp, 770 aa] {ON} YJL033...   129   9e-30
ZYRO0A02948g Chr1 (240353..242026) [1674 bp, 557 aa] {ON} simila...   126   1e-29
KNAG0A03280 Chr1 complement(416099..417922) [1824 bp, 607 aa] {O...   127   2e-29
KAFR0D01120 Chr4 complement(222704..224536) [1833 bp, 610 aa] {O...   127   2e-29
KLTH0E10890g Chr5 complement(976948..978717) [1770 bp, 589 aa] {...   126   2e-29
SAKL0H20218g Chr8 (1770946..1772670) [1725 bp, 574 aa] {ON} simi...   126   2e-29
Kwal_23.6387 s23 (1558522..1560468) [1947 bp, 648 aa] {ON} YNR03...   127   2e-29
Smik_11.281 Chr11 complement(472555..474783) [2229 bp, 742 aa] {...   127   2e-29
Skud_10.189 Chr10 (351797..354109) [2313 bp, 770 aa] {ON} YJL033...   127   3e-29
TPHA0H01160 Chr8 (257728..259029) [1302 bp, 433 aa] {ON} Anc_5.6...   123   3e-29
KLLA0C17424g Chr3 (1529941..1531680) [1740 bp, 579 aa] {ON} simi...   125   5e-29
KAFR0B02030 Chr2 complement(397276..398991) [1716 bp, 571 aa] {O...   124   8e-29
KNAG0D02250 Chr4 (387478..389160) [1683 bp, 560 aa] {ON} Anc_8.1...   124   9e-29
NCAS0B04630 Chr2 (845866..847557) [1692 bp, 563 aa] {ON} Anc_8.124    123   2e-28
Kpol_274.7 s274 complement(11790..13502) [1713 bp, 570 aa] {ON} ...   122   5e-28
AGL004C Chr7 complement(715482..717410) [1929 bp, 642 aa] {ON} S...   122   8e-28
SAKL0A08118g Chr1 (718720..720564) [1845 bp, 614 aa] {ON} highly...   121   1e-27
Ecym_5095 Chr5 (213368..214684) [1317 bp, 438 aa] {ON} similar t...   119   1e-27
ZYRO0C11660g Chr3 (912287..913594) [1308 bp, 435 aa] {ON} highly...   117   3e-27
KNAG0K00400 Chr11 (69795..71093) [1299 bp, 432 aa] {ON} Anc_5.69...   117   3e-27
Kpol_1007.10 s1007 complement(17289..19106) [1818 bp, 605 aa] {O...   119   5e-27
Smik_12.355 Chr12 complement(633462..635246) [1785 bp, 594 aa] {...   119   6e-27
Suva_10.374 Chr10 complement(655832..657616) [1785 bp, 594 aa] {...   118   8e-27
YLR276C Chr12 complement(695046..696830) [1785 bp, 594 aa] {ON} ...   117   2e-26
NDAI0C05120 Chr3 complement(1191160..1193046) [1887 bp, 628 aa] ...   117   2e-26
TBLA0E03420 Chr5 (846796..849024) [2229 bp, 742 aa] {ON} Anc_3.1...   117   3e-26
KLTH0A07084g Chr1 (587692..589578) [1887 bp, 628 aa] {ON} simila...   116   4e-26
Skud_12.359 Chr12 complement(636149..637930) [1782 bp, 593 aa] {...   115   6e-26
TPHA0K01120 Chr11 (235339..237153) [1815 bp, 604 aa] {ON} Anc_6....   115   8e-26
Suva_14.394 Chr14 (676747..678666) [1920 bp, 639 aa] {ON} YNR038...   114   2e-25
Kwal_34.15835 s34 (79657..80592) [936 bp, 311 aa] {ON} YOR204W (...   109   3e-25
KAFR0A04960 Chr1 (981797..983572) [1776 bp, 591 aa] {ON} Anc_6.7...   113   3e-25
CAGL0A03652g Chr1 complement(373100..375301) [2202 bp, 733 aa] {...   112   8e-25
Kwal_56.23291 s56 complement(479073..480842) [1770 bp, 589 aa] {...   112   8e-25
TDEL0G03990 Chr7 (726319..728085) [1767 bp, 588 aa] {ON} Anc_6.7...   112   9e-25
KNAG0A05850 Chr1 (873957..875306) [1350 bp, 449 aa] {ON} Anc_2.3...   110   1e-24
KNAG0A04130 Chr1 (559075..560904) [1830 bp, 609 aa] {ON} Anc_8.4...   112   1e-24
KAFR0G01440 Chr7 complement(319146..321305) [2160 bp, 719 aa] {O...   111   2e-24
NCAS0D02940 Chr4 complement(558088..559923) [1836 bp, 611 aa] {O...   111   2e-24
KLTH0G15224g Chr7 (1332767..1334557) [1791 bp, 596 aa] {ON} high...   110   2e-24
KLLA0C04576g Chr3 complement(417217..419001) [1785 bp, 594 aa] {...   110   3e-24
NDAI0I01960 Chr9 (457199..459025) [1827 bp, 608 aa] {ON} Anc_6.73     110   3e-24
KNAG0F03020 Chr6 complement(572005..573801) [1797 bp, 598 aa] {O...   109   5e-24
TDEL0D05010 Chr4 (911771..914023) [2253 bp, 750 aa] {ON} Anc_3.1...   110   6e-24
Kpol_1036.17 s1036 (45392..47683) [2292 bp, 763 aa] {ON} (45392....   109   1e-23
KNAG0K01980 Chr11 (405216..407381) [2166 bp, 721 aa] {ON} Anc_3....   109   1e-23
ZYRO0D14388g Chr4 complement(1218001..1219752) [1752 bp, 583 aa]...   107   2e-23
KLLA0C11253g Chr3 complement(967067..969457) [2391 bp, 796 aa] {...   108   2e-23
Suva_4.392 Chr4 (697442..699823) [2382 bp, 793 aa] {ON} YBR142W ...   108   3e-23
CAGL0F04983g Chr6 complement(507217..509004) [1788 bp, 595 aa] {...   107   3e-23
AGR278C Chr7 complement(1261914..1263701) [1788 bp, 595 aa] {ON}...   107   3e-23
NDAI0A06900 Chr1 (1578643..1580622) [1980 bp, 659 aa] {ON} Anc_3...   106   7e-23
NCAS0I02320 Chr9 (437124..439319) [2196 bp, 731 aa] {ON} Anc_3.1...   106   8e-23
KNAG0B03010 Chr2 (582008..583489) [1482 bp, 493 aa] {ON} Anc_5.6...   104   1e-22
SAKL0C10296g Chr3 complement(927939..930377) [2439 bp, 812 aa] {...   106   1e-22
Kwal_56.23164 s56 (430116..432539) [2424 bp, 807 aa] {ON} YBR142...   104   4e-22
Skud_11.257 Chr11 complement(465439..467658) [2220 bp, 739 aa] {...   103   6e-22
Skud_2.270 Chr2 (496096..498402) [2307 bp, 768 aa] {ON} YBR142W ...   103   7e-22
TBLA0A09740 Chr1 complement(2393212..2395065) [1854 bp, 617 aa] ...   103   8e-22
TBLA0D05490 Chr4 (1352976..1355243) [2268 bp, 755 aa] {ON}            103   9e-22
CAGL0L10021g Chr12 complement(1076197..1077711) [1515 bp, 504 aa...   102   1e-21
KLTH0G15840g Chr7 complement(1381355..1383748) [2394 bp, 797 aa]...   102   2e-21
Kpol_1016.14 s1016 complement(36309..38507) [2199 bp, 732 aa] {O...   102   2e-21
AER027W Chr5 (685709..687967) [2259 bp, 752 aa] {ON} Syntenic ho...   102   2e-21
AFR082C Chr6 complement(576175..578307) [2133 bp, 710 aa] {ON} S...   102   2e-21
KLLA0F13926g Chr6 complement(1290006..1292228) [2223 bp, 740 aa]...   102   2e-21
TPHA0M00750 Chr13 complement(141794..144082) [2289 bp, 762 aa] {...   101   4e-21
ZYRO0B15576g Chr2 complement(1265375..1266850) [1476 bp, 491 aa]...    99   7e-21
YKR024C Chr11 complement(485144..487372) [2229 bp, 742 aa] {ON} ...   100   8e-21
KLTH0D03190g Chr4 complement(306459..308609) [2151 bp, 716 aa] {...   100   9e-21
SAKL0D05258g Chr4 complement(416100..418247) [2148 bp, 715 aa] {...   100   1e-20
NCAS0G00610 Chr7 (105992..107407) [1416 bp, 471 aa] {ON} Anc_5.643     99   1e-20
Kwal_56.22971 s56 (351639..352331) [693 bp, 230 aa] {ON} YDR021W...    94   1e-20
KAFR0C06090 Chr3 complement(1208993..1210417) [1425 bp, 474 aa] ...    98   1e-20
TDEL0B02800 Chr2 (504332..505726) [1395 bp, 464 aa] {ON} Anc_5.6...    98   2e-20
KLLA0F06941g Chr6 complement(665970..667862) [1893 bp, 630 aa] {...    99   2e-20
TPHA0B01270 Chr2 complement(283532..285754) [2223 bp, 740 aa] {O...    99   3e-20
Ecym_6354 Chr6 (686603..688819) [2217 bp, 738 aa] {ON} similar t...    98   4e-20
Ecym_5326 Chr5 (663464..665737) [2274 bp, 757 aa] {ON} similar t...    98   4e-20
Kwal_26.7302 s26 complement(304411..306555) [2145 bp, 714 aa] {O...    98   4e-20
Kpol_473.7 s473 complement(21177..22613) [1437 bp, 478 aa] {ON} ...    96   5e-20
KLTH0F17050g Chr6 complement(1380459..1381888,1381971..1381977) ...    96   8e-20
TPHA0J01230 Chr10 complement(289735..291210) [1476 bp, 491 aa] {...    96   9e-20
CAGL0L03047g Chr12 (352032..354179) [2148 bp, 715 aa] {ON} simil...    97   9e-20
TBLA0J00890 Chr10 complement(199404..200900) [1497 bp, 498 aa] {...    96   1e-19
NCAS0B07760 Chr2 (1469599..1471845) [2247 bp, 748 aa] {ON} Anc_1...    96   1e-19
Ecym_5488 Chr5 (998651..1000099) [1449 bp, 482 aa] {ON} similar ...    94   2e-19
KNAG0C01480 Chr3 complement(294677..296947) [2271 bp, 756 aa] {O...    96   3e-19
ACR078W Chr3 (501241..502644) [1404 bp, 467 aa] {ON} Syntenic ho...    92   8e-19
ZYRO0F01826g Chr6 complement(149490..151799) [2310 bp, 769 aa] {...    93   1e-18
KLLA0F15950g Chr6 (1477113..1478522) [1410 bp, 469 aa] {ON} simi...    91   2e-18
Kpol_1028.29 s1028 complement(76405..78318) [1914 bp, 637 aa] {O...    92   2e-18
KAFR0A03450 Chr1 complement(708114..710348) [2235 bp, 744 aa] {O...    92   2e-18
NDAI0B05110 Chr2 (1249929..1252217) [2289 bp, 762 aa] {ON} Anc_1...    91   5e-18
SAKL0G01496g Chr7 (125044..125050,125133..126568) [1443 bp, 480 ...    90   6e-18
NDAI0F00700 Chr6 (170569..171699) [1131 bp, 376 aa] {ON} Anc_5.643     88   8e-18
SAKL0A00924g Chr1 complement(98231..100150) [1920 bp, 639 aa] {O...    89   2e-17
KNAG0D00300 Chr4 complement(40830..42743) [1914 bp, 637 aa] {ON}...    89   3e-17
Kwal_55.21609 s55 complement(912148..913269) [1122 bp, 373 aa] {...    87   3e-17
KAFR0C04690 Chr3 (934039..935928) [1890 bp, 629 aa] {ON} Anc_6.3...    88   5e-17
Ecym_2514 Chr2 (1000911..1002773) [1863 bp, 620 aa] {ON} similar...    87   6e-17
TDEL0H01300 Chr8 (221815..223962) [2148 bp, 715 aa] {ON} Anc_1.2...    87   8e-17
TPHA0M01940 Chr13 (401463..403469) [2007 bp, 668 aa] {ON} Anc_6....    87   9e-17
AGL225C Chr7 complement(275826..277649) [1824 bp, 607 aa] {ON} S...    87   1e-16
NCAS0A05470 Chr1 (1077464..1079413) [1950 bp, 649 aa] {ON} Anc_6...    86   2e-16
NDAI0K02300 Chr11 (514779..516908) [2130 bp, 709 aa] {ON} Anc_6....    86   2e-16
CAGL0G07975g Chr7 (752176..754131) [1956 bp, 651 aa] {ON} simila...    86   2e-16
TDEL0A07700 Chr1 (1338381..1340264) [1884 bp, 627 aa] {ON} Anc_6...    84   7e-16
Smik_14.369 Chr14 (653538..655427) [1890 bp, 629 aa] {ON} YNR038...    83   1e-15
TBLA0F04210 Chr6 (1034478..1036397) [1920 bp, 639 aa] {ON} Anc_6...    83   2e-15
ZYRO0C12012g Chr3 (936848..938722) [1875 bp, 624 aa] {ON} simila...    83   2e-15
Skud_14.371 Chr14 (663742..665631) [1890 bp, 629 aa] {ON} YNR038...    82   2e-15
YNR038W Chr14 (695595..697484) [1890 bp, 629 aa] {ON}  DBP6Essen...    80   1e-14
NCAS0D04130 Chr4 (779645..781408) [1764 bp, 587 aa] {ON} Anc_6.223     76   2e-13
AFR452C Chr6 complement(1250342..1251203) [862 bp, 287.333333333...    72   5e-13
Agos_YGOB_AFR452C Chr6 complement(1250310..1251203) [894 bp, 298...    72   5e-13
Suva_114.1 Chr114 complement(3..506) [504 bp, 168 aa] {ON} YKR05...    67   7e-12
Smik_7.216 Chr7 complement(376052..377737) [1686 bp, 561 aa] {ON...    70   1e-11
Ecym_2193 Chr2 (379905..381545) [1641 bp, 546 aa] {ON} similar t...    70   1e-11
NDAI0I00790 Chr9 complement(175765..177567) [1803 bp, 600 aa] {O...    69   3e-11
CAGL0M05753g Chr13 complement(610837..612543) [1707 bp, 568 aa] ...    69   3e-11
KLTH0H03960g Chr8 (361653..363323) [1671 bp, 556 aa] {ON} simila...    69   4e-11
TDEL0E05320 Chr5 complement(973951..975570) [1620 bp, 539 aa] {O...    68   5e-11
KLLA0B02310g Chr2 (205046..206800) [1755 bp, 584 aa] {ON} simila...    68   6e-11
SAKL0A04224g Chr1 (394175..395896) [1722 bp, 573 aa] {ON} simila...    68   7e-11
YGL064C Chr7 complement(381523..383208) [1686 bp, 561 aa] {ON}  ...    67   9e-11
Suva_7.205 Chr7 complement(374687..376435) [1749 bp, 582 aa] {ON...    67   1e-10
Skud_7.216 Chr7 complement(384838..386586) [1749 bp, 582 aa] {ON...    67   1e-10
AFL102W Chr6 (247419..249083) [1665 bp, 554 aa] {ON} Syntenic ho...    67   2e-10
Kwal_56.24094 s56 complement(846901..848571) [1671 bp, 556 aa] {...    65   4e-10
Kpol_1002.46 s1002 (135310..136929) [1620 bp, 539 aa] {ON} (1353...    65   5e-10
Kwal_56.22974 s56 (352370..352837) [468 bp, 155 aa] {OFF} YPL119...    61   5e-10
KAFR0K02330 Chr11 complement(477370..478992) [1623 bp, 540 aa] {...    62   5e-09
TPHA0J02440 Chr10 complement(537553..539259) [1707 bp, 568 aa] {...    62   7e-09
TBLA0A06180 Chr1 (1518694..1520301) [1608 bp, 535 aa] {ON} Anc_6...    61   1e-08
ZYRO0E07040g Chr5 complement(532475..534094) [1620 bp, 539 aa] {...    59   3e-08
Kpol_1009.3 s1009 complement(4730..6169) [1440 bp, 479 aa] {ON} ...    56   3e-07
KNAG0F01930 Chr6 (371697..373379) [1683 bp, 560 aa] {ON} Anc_6.2...    54   1e-06
Kpol_1029.1 s1029 (145..148,407..774) [372 bp, 123 aa] {OFF} (14...    44   3e-04
Smik_9.201 Chr9 complement(333404..336379) [2976 bp, 991 aa] {ON...    45   8e-04
Kwal_14.2171 s14 (643215..643973) [759 bp, 252 aa] {ON} YOR204W ...    44   0.001
Suva_9.211 Chr9 complement(344361..347336) [2976 bp, 991 aa] {ON...    45   0.001
YIR002C Chr9 complement(357415..360396) [2982 bp, 993 aa] {ON}  ...    45   0.001
Suva_2.502 Chr2 (888423..890483) [2061 bp, 686 aa] {ON} YDR332W ...    44   0.002
Kwal_55.20938 s55 complement(617612..618622) [1011 bp, 336 aa] {...    44   0.002
Kwal_47.19313 s47 complement(1186091..1189306) [3216 bp, 1071 aa...    44   0.002
CAGL0J01980g Chr10 (196812..199970) [3159 bp, 1052 aa] {ON} simi...    44   0.002
Skud_9.179 Chr9 complement(328238..331216) [2979 bp, 992 aa] {ON...    44   0.002
Kpol_365.4 s365 (7095..9170) [2076 bp, 691 aa] {ON} (7095..9170)...    43   0.004
TBLA0H01810 Chr8 complement(426223..428346) [2124 bp, 707 aa] {O...    43   0.005
KNAG0B06170 Chr2 complement(1212229..1216080) [3852 bp, 1283 aa]...    43   0.005
NDAI0B01020 Chr2 (236444..239377) [2934 bp, 977 aa] {ON} Anc_7.1...    42   0.007
SAKL0F04532g Chr6 (365436..368558) [3123 bp, 1040 aa] {ON} simil...    42   0.008
Kwal_23.4187 s23 (607525..611301) [3777 bp, 1258 aa] {ON} YLR398...    42   0.009
KLTH0F13310g Chr6 complement(1090990..1094076) [3087 bp, 1028 aa...    42   0.010
CAGL0C02563g Chr3 (259114..262965) [3852 bp, 1283 aa] {ON} simil...    42   0.010
NCAS0A13190 Chr1 complement(2593419..2596559) [3141 bp, 1046 aa]...    42   0.011
KLLA0D12694g Chr4 (1079740..1083843) [4104 bp, 1367 aa] {ON} sim...    42   0.012
YDR332W Chr4 (1131001..1133070) [2070 bp, 689 aa] {ON}  IRC3Puta...    41   0.014
NDAI0J02330 Chr10 complement(564963..568895) [3933 bp, 1310 aa] ...    41   0.015
Kpol_328.1 s328 complement(673..3711) [3039 bp, 1012 aa] {ON} co...    41   0.016
TBLA0A06360 Chr1 (1561496..1565389) [3894 bp, 1297 aa] {ON} Anc_...    41   0.019
Skud_4.599 Chr4 (1067036..1069102) [2067 bp, 688 aa] {ON} YDR332...    40   0.026
KAFR0A05880 Chr1 (1191511..1195341) [3831 bp, 1276 aa] {ON} Anc_...    40   0.027
ZYRO0B12650g Chr2 complement(1017101..1020862) [3762 bp, 1253 aa...    40   0.029
TPHA0G03720 Chr7 (787108..790563) [3456 bp, 1151 aa] {ON} Anc_3....    40   0.029
KLTH0D14630g Chr4 complement(1193537..1197340) [3804 bp, 1267 aa...    40   0.030
Ecym_3257 Chr3 (491150..494974) [3825 bp, 1274 aa] {ON} similar ...    40   0.036
NCAS0J01560 Chr10 complement(276723..280619) [3897 bp, 1298 aa] ...    40   0.038
KNAG0C05350 Chr3 complement(1044926..1047028) [2103 bp, 700 aa] ...    40   0.043
KLLA0D13552g Chr4 (1167629..1170655) [3027 bp, 1008 aa] {ON} sim...    39   0.051
KAFR0A07190 Chr1 complement(1453748..1457704) [3957 bp, 1318 aa]...    39   0.054
NDAI0C04460 Chr3 (1012182..1014188) [2007 bp, 668 aa] {ON} Anc_5...    39   0.060
TBLA0J01920 Chr10 (455227..458469) [3243 bp, 1080 aa] {ON} Anc_7...    39   0.062
Kpol_1055.74 s1055 (201332..205156) [3825 bp, 1274 aa] {ON} (201...    39   0.063
Suva_10.515 Chr10 complement(880776..884624) [3849 bp, 1282 aa] ...    39   0.071
SAKL0H02706g Chr8 (268843..272661) [3819 bp, 1272 aa] {ON} simil...    39   0.082
TPHA0I02220 Chr9 (496020..499136) [3117 bp, 1038 aa] {ON} Anc_7....    39   0.085
Skud_12.483 Chr12 complement(855363..859226) [3864 bp, 1287 aa] ...    39   0.091
Smik_12.485 Chr12 complement(853862..857722) [3861 bp, 1286 aa] ...    39   0.094
TDEL0E01090 Chr5 (222389..226162) [3774 bp, 1257 aa] {ON} Anc_4....    39   0.095
TPHA0B02170 Chr2 (503118..506930) [3813 bp, 1270 aa] {ON} Anc_4....    39   0.095
YLR398C Chr12 complement(915156..919019) [3864 bp, 1287 aa] {ON}...    39   0.099
KAFR0F01050 Chr6 (198407..201028) [2622 bp, 873 aa] {ON} Anc_6.2...    39   0.10 
Kpol_1018.31 s1018 (87697..91695) [3999 bp, 1332 aa] {ON} (87697...    39   0.11 
SAKL0A02904g Chr1 (263239..267465) [4227 bp, 1408 aa] {ON} simil...    39   0.11 
KLLA0E17095g Chr5 (1519323..1521395) [2073 bp, 690 aa] {ON} simi...    38   0.14 
Ecym_4473 Chr4 (962193..965228) [3036 bp, 1011 aa] {ON} similar ...    38   0.15 
TDEL0H03170 Chr8 complement(522372..525392) [3021 bp, 1006 aa] {...    38   0.16 
TDEL0E02500 Chr5 complement(483905..485878) [1974 bp, 657 aa] {O...    37   0.18 
KAFR0K01070 Chr11 (221301..224285) [2985 bp, 994 aa] {ON} Anc_7....    38   0.18 
KNAG0E03530 Chr5 (705077..708016) [2940 bp, 979 aa] {ON} Anc_7.1...    38   0.19 
Kwal_56.24359 s56 complement(966614..970789) [4176 bp, 1391 aa] ...    38   0.20 
NCAS0E00200 Chr5 complement(26080..29448) [3369 bp, 1122 aa] {ON...    37   0.22 
Smik_4.592 Chr4 (1057406..1059475) [2070 bp, 689 aa] {ON} YDR332...    37   0.22 
TPHA0H01510 Chr8 (340988..343018) [2031 bp, 676 aa] {ON} Anc_5.3...    37   0.22 
KLTH0E03630g Chr5 complement(327367..329385) [2019 bp, 672 aa] {...    37   0.25 
KNAG0D00680 Chr4 complement(102336..104981) [2646 bp, 881 aa] {O...    37   0.25 
ZYRO0G03938g Chr7 (318186..321206) [3021 bp, 1006 aa] {ON} simil...    37   0.26 
AFL159W Chr6 (134254..137706) [3453 bp, 1150 aa] {ON} Syntenic h...    37   0.35 
Kwal_55.20185 s55 complement(286058..288073) [2016 bp, 671 aa] {...    36   0.46 
CAGL0L00407g Chr12 (42659..46774) [4116 bp, 1371 aa] {ON} simila...    36   0.47 
AER067C Chr5 complement(757163..761011) [3849 bp, 1282 aa] {ON} ...    36   0.53 
ADR011C Chr4 complement(721693..724926) [3234 bp, 1077 aa] {ON} ...    36   0.55 
Skud_14.220 Chr14 (406111..406449) [339 bp, 112 aa] {ON} YNL112W...    33   0.61 
SAKL0G08228g Chr7 complement(700095..702248) [2154 bp, 717 aa] {...    35   0.79 
NCAS0F03010 Chr6 (598773..600782) [2010 bp, 669 aa] {ON} Anc_5.3...    35   0.87 
Kwal_26.8466 s26 complement(797363..797710) [348 bp, 115 aa] {OF...    33   0.90 
Ecym_2138 Chr2 (256787..260971) [4185 bp, 1394 aa] {ON} similar ...    35   1.0  
KLTH0H02706g Chr8 (238367..242578) [4212 bp, 1403 aa] {ON} simil...    35   1.2  
KAFR0I02480 Chr9 (503718..504266) [549 bp, 182 aa] {ON} Anc_5.29...    33   1.4  
TBLA0E00120 Chr5 complement(11340..15049,15149..15332) [3894 bp,...    35   1.4  
Ecym_8005 Chr8 (9383..11551) [2169 bp, 722 aa] {ON} similar to A...    35   1.4  
YMR190C Chr13 complement(640915..645258) [4344 bp, 1447 aa] {ON}...    35   1.5  
Suva_13.371 Chr13 complement(621139..625512) [4374 bp, 1457 aa] ...    35   1.6  
TDEL0G01200 Chr7 complement(246082..246765) [684 bp, 227 aa] {ON...    33   1.9  
Smik_13.395 Chr13 complement(625338..629669) [4332 bp, 1443 aa] ...    34   2.0  
TBLA0A02320 Chr1 complement(559955..564205) [4251 bp, 1416 aa] {...    34   2.1  
TDEL0A06910 Chr1 complement(1207623..1211717) [4095 bp, 1364 aa]...    34   2.2  
Kpol_1075.5 s1075 complement(13967..20494) [6528 bp, 2175 aa] {O...    34   2.7  
Skud_13.356 Chr13 complement(614958..619313) [4356 bp, 1451 aa] ...    33   3.8  
NCAS0A02870 Chr1 (549276..551888) [2613 bp, 870 aa] {ON} Anc_4.322     33   4.2  
SAKL0F00528g Chr6 complement(46584..50141) [3558 bp, 1185 aa] {O...    33   5.1  
Ecym_2529 Chr2 complement(1029384..1031567) [2184 bp, 727 aa] {O...    33   5.1  
KLTH0C06402g Chr3 complement(559759..561402) [1644 bp, 547 aa] {...    33   5.4  
KNAG0A02330 Chr1 (219856..222081) [2226 bp, 741 aa] {ON} Anc_8.4...    33   5.4  
KAFR0D04360 Chr4 complement(858295..860295) [2001 bp, 666 aa] {O...    33   5.6  
TPHA0D03600 Chr4 complement(754714..758556) [3843 bp, 1280 aa] {...    33   5.8  
NDAI0B02280 Chr2 complement(567453..574025) [6573 bp, 2190 aa] {...    33   6.1  
ZYRO0D10802g Chr4 (911004..912956) [1953 bp, 650 aa] {ON} simila...    32   8.2  

>KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa]
           {ON} similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis
          Length = 973

 Score = 1781 bits (4612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 881/973 (90%), Positives = 881/973 (90%)

Query: 1   MVDSSKRALPAEDYSSEDEDAFDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEFS 60
           MVDSSKRALPAEDYSSEDEDAFDIAGDIALNA               GFQAEVQDVIEFS
Sbjct: 1   MVDSSKRALPAEDYSSEDEDAFDIAGDIALNADSEDSDISDDDNDNIGFQAEVQDVIEFS 60

Query: 61  SDXXXXXXXXXXXXXXXXXXAGPIVDSKFPSLELSDDEKKATNESDDDLNDYFNTTADAA 120
           SD                  AGPIVDSKFPSLELSDDEKKATNESDDDLNDYFNTTADAA
Sbjct: 61  SDEEEKEKKPKKQNKKAKVKAGPIVDSKFPSLELSDDEKKATNESDDDLNDYFNTTADAA 120

Query: 121 AKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAF 180
           AKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAF
Sbjct: 121 AKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAF 180

Query: 181 VLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQF 240
           VLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQF
Sbjct: 181 VLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQF 240

Query: 241 GMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT 300
           GMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT
Sbjct: 241 GMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT 300

Query: 301 NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYL 360
           NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYL
Sbjct: 301 NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYL 360

Query: 361 LQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKA 420
           LQEAIKMPVATESQIKKLKQQN                        RRLPNANEMPSEKA
Sbjct: 361 LQEAIKMPVATESQIKKLKQQNDADSDSDDSEDEKKKKAKKAKKSKRRLPNANEMPSEKA 420

Query: 421 TIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAAR 480
           TIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAAR
Sbjct: 421 TIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAAR 480

Query: 481 GVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKK 540
           GVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS              GKK
Sbjct: 481 GVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSENELPYLLDLELFLGKK 540

Query: 541 ILLTPMYESSCQILRKKAESEGNNNFTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMIKS 600
           ILLTPMYESSCQILRKKAESEGNNNFTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMIKS
Sbjct: 541 ILLTPMYESSCQILRKKAESEGNNNFTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMIKS 600

Query: 601 DFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFL 660
           DFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFL
Sbjct: 601 DFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFL 660

Query: 661 AKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHSI 720
           AKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHSI
Sbjct: 661 AKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHSI 720

Query: 721 EDEILKGEDNEVGYSVPDEVLKEFEDADVLLEEQENIXXXXXXTFRDPTFYLSHFAPTSD 780
           EDEILKGEDNEVGYSVPDEVLKEFEDADVLLEEQENI      TFRDPTFYLSHFAPTSD
Sbjct: 721 EDEILKGEDNEVGYSVPDEVLKEFEDADVLLEEQENIKKKQKKTFRDPTFYLSHFAPTSD 780

Query: 781 IQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKYII 840
           IQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKYII
Sbjct: 781 IQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKYII 840

Query: 841 GESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPTSPSERTVGGKFKHK 900
           GESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPTSPSERTVGGKFKHK
Sbjct: 841 GESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPTSPSERTVGGKFKHK 900

Query: 901 TQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGYNGPGMKQEIKSVDXXXXXXXXXXXX 960
           TQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGYNGPGMKQEIKSVD            
Sbjct: 901 TQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGYNGPGMKQEIKSVDEIRKLREIKEKK 960

Query: 961 XXXNARPTKRRKH 973
              NARPTKRRKH
Sbjct: 961 RSKNARPTKRRKH 973

>AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL031W (DBP10)
          Length = 960

 Score = 1315 bits (3404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/974 (66%), Positives = 764/974 (78%), Gaps = 23/974 (2%)

Query: 4   SSKRALPAEDYSSEDEDAFDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEFSSDX 63
           +SKR    E++S E ED FDIAG+IAL++                   EVQD+IEFS D 
Sbjct: 4   ASKRKRDTEEHSDEGED-FDIAGNIALDSEDSDDSVSDSDN-------EVQDIIEFSDDE 55

Query: 64  XXXX--XXXXXXXXXXXXXAGPIVDSKFPSLELSDDEKKATNESDDDLNDYFNTTAD-AA 120
                              A P  D+ FPSLELSD E  A N   DD++ YFNTT+  AA
Sbjct: 56  KQNAPQVSKTAKGAKGAKVAAPRSDAAFPSLELSDGED-ADNGDKDDVDSYFNTTSQLAA 114

Query: 121 AKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAF 180
           +K KKGSFASFGLSK +L NIS+KGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF
Sbjct: 115 SKAKKGSFASFGLSKFILGNISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAF 174

Query: 181 VLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQF 240
           VLP+IEKLK HSAKIG RA+ILSPSRELA+QTH+VFKEF+KGS+LRS+LLTGGD LEDQF
Sbjct: 175 VLPLIEKLKMHSAKIGARAMILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQF 234

Query: 241 GMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT 300
            MMM NPDV+IATPGRFLHLKVEMNLDL S+EYVVFDEADRLFEMGFQEQLNELL + PT
Sbjct: 235 SMMMSNPDVIIATPGRFLHLKVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPT 294

Query: 301 NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYL 360
            RQTLLFSATLPSSLVDFAKAGL+NPVLVRLD ETK+SENLEMLF+S+K DEREANLLYL
Sbjct: 295 ARQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYL 354

Query: 361 LQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKA 420
           LQE IK+PVATE Q+++ ++Q+                        + LP+A +MPS  +
Sbjct: 355 LQEVIKIPVATEEQLQRFRKQS--NDDADDSDDETDKKKKHSKKSKQPLPSAKDMPSPNS 412

Query: 421 TIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAAR 480
           TI+FV TRHHVEYV+ LLK+CGYLVSY+YG L+QHAR+QQL+NFR GLT+ILVVTDVAAR
Sbjct: 413 TIIFVSTRHHVEYVSNLLKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAAR 472

Query: 481 GVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKK 540
           GVDIPLLANV+N SLP SSKIF+HRVGRTARAGN+GWA++I+S              GKK
Sbjct: 473 GVDIPLLANVVNMSLPASSKIFVHRVGRTARAGNKGWAYTILSESELPYLLDLELFLGKK 532

Query: 541 ILLTPMYESSCQILRKKAESEGNNN--FTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMI 598
           +LLTPMYE++C +L+KK  SEGN    F  PK+SY  R++LG+ PR +++ MGDL+ N++
Sbjct: 533 VLLTPMYEATCDLLKKKWISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLV 592

Query: 599 KSDFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLD 658
           +S+FEL  +K V++KAEKLY RTR PASAES+KR+KE++ +GWDEQN+ FGKN EKEKL+
Sbjct: 593 ESNFELQNLKAVSIKAEKLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLE 652

Query: 659 FLAKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRH 718
           FLAKLQ+R+NKETVFEFARN DDEM++LMKRRRRQIAPIQ++AKERQ+LLEKER  GLRH
Sbjct: 653 FLAKLQNRHNKETVFEFARNHDDEMAILMKRRRRQIAPIQQRAKERQQLLEKERQAGLRH 712

Query: 719 SIEDEILKGEDNEVGYSVPDEVLKEFEDADVLLEEQENIXXXXXXTFRDPTFYLSHFAPT 778
           ++EDEILKGE+NEVGYSVP E+L++FEDAD L  ++          FRD  FYLSHFAP 
Sbjct: 713 TLEDEILKGEENEVGYSVPQELLRDFEDADELAAKRNT-----KKGFRDENFYLSHFAPA 767

Query: 779 SDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKY 838
           SDIQDKQLQ++S FTN+ S A FDL NDDKVQVHKQTATVKWDKKRKKYVN QG+DNKKY
Sbjct: 768 SDIQDKQLQVASSFTNEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKY 827

Query: 839 IIGESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPTSPSERTVGGKFK 898
           IIGESGQKIPASFRSGKF +WSKARK+APLKVGARES+IP+NLLADPT    R   GKFK
Sbjct: 828 IIGESGQKIPASFRSGKFDEWSKARKLAPLKVGARESSIPANLLADPT--GSRLANGKFK 885

Query: 899 HKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGYNGPGMKQEIKSVDXXXXXXXXXX 958
           HK  KAPK+PDK+RDDY  Q KKV  A+E G+ VKGYN PGMKQE+++ +          
Sbjct: 886 HKQIKAPKMPDKNRDDYQSQLKKVNKAMESGLHVKGYNAPGMKQELRTTEQIRKQRSMAE 945

Query: 959 XXXXXNARPTKRRK 972
                NARP K+RK
Sbjct: 946 KRKAKNARPAKKRK 959

>KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {ON}
           Anc_3.159 YDL031W
          Length = 973

 Score = 1313 bits (3398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/984 (66%), Positives = 760/984 (77%), Gaps = 24/984 (2%)

Query: 1   MVDSSKRALPAEDYSSEDEDA--FDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIE 58
           MV  +KR L   D  SE E A  FDIA +IALN+                   EV+D+I 
Sbjct: 1   MVALNKRTLQEHDSDSETESANEFDIASNIALNSSDSDSDSDVDEQ-----DGEVEDIIS 55

Query: 59  FSSDXXXXXXXXXXXXXXXXXXAGPIVDSKFPSLELSDDE--KKATNESDDDLNDYFNTT 116
           +S D                          FP LELSDDE  KK  N++DDD+N YF+T 
Sbjct: 56  YSDDEKSQVEEVPKKSKKEKKVI-----KDFPLLELSDDEDSKKQANDNDDDVNSYFSTN 110

Query: 117 -ADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSG 175
             +   KHKKGSFASFGLSKL+L NISK+GFRQPTPIQRKTIPLILQ RDIVGMARTGSG
Sbjct: 111 NLNTKTKHKKGSFASFGLSKLILTNISKRGFRQPTPIQRKTIPLILQSRDIVGMARTGSG 170

Query: 176 KTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDS 235
           KTAAFVLPMIEKLKTHS+KIG RA+ILSPSRELA+QTH VFKEFSKGSDLRS+LLTGGDS
Sbjct: 171 KTAAFVLPMIEKLKTHSSKIGARAIILSPSRELAMQTHNVFKEFSKGSDLRSVLLTGGDS 230

Query: 236 LEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL 295
           LEDQFGM+M NPDV+IATPGRFLHLKVEMNLDLKSVEY+ FDEADRLFEMGFQEQLNEL+
Sbjct: 231 LEDQFGMIMANPDVIIATPGRFLHLKVEMNLDLKSVEYICFDEADRLFEMGFQEQLNELI 290

Query: 296 VAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREA 355
            + P+NRQTLLFSATLPSSLVDFAKAGL+NPVLVRLD ETKISENLEMLF+SIK +EREA
Sbjct: 291 YSLPSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDTETKISENLEMLFLSIKNEEREA 350

Query: 356 NLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXX--XXRRLPNAN 413
           NLLYLLQE I +P+ATE QIKKL  ++                          +RLP AN
Sbjct: 351 NLLYLLQEEICIPLATEEQIKKLNNESKIDDDSDSEDDEATRRQKRKSKNFKKQRLPPAN 410

Query: 414 EMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILV 473
           ++PSEKATI+FVPTRHHVEY++QLLK+CGYLVSYIYG L+Q AR +QLYNFR GLTSILV
Sbjct: 411 QLPSEKATIIFVPTRHHVEYISQLLKDCGYLVSYIYGTLDQRARNRQLYNFRLGLTSILV 470

Query: 474 VTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXX 533
           VTDVAARGVDIP+LANVIN+SLP SSK+F+HRVGRTARAGNRGWA+SIVS          
Sbjct: 471 VTDVAARGVDIPMLANVINFSLPVSSKVFVHRVGRTARAGNRGWAYSIVSENELPYLLDL 530

Query: 534 XXXXGKKILLTPMYESSCQILRKKAESEGNN--NFTDPKVSYTTRMVLGACPRSEIDGMG 591
               GKKILLT MY+++C I++KK  SEG +   F DPK SYT RMVLG+ PR +++ + 
Sbjct: 531 ELFLGKKILLTSMYDATCDIMKKKWVSEGKSELTFQDPKPSYTNRMVLGSAPRLQVEDLN 590

Query: 592 DLYSNMIKSDFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKN 651
           DLY+ ++   F+L  +K  ALKAEKLYFRTRT AS ESMKRSKEI+ SGWDEQNI FGKN
Sbjct: 591 DLYTGVLSGSFDLKMMKQTALKAEKLYFRTRTSASPESMKRSKEIILSGWDEQNIRFGKN 650

Query: 652 AEKEKLDFLAKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKE 711
            EKEK  FLAKLQ+R+NKETVFEFARNPDDEMSVLMKRRRRQ+APIQRKA+ER+EL+EKE
Sbjct: 651 VEKEKFQFLAKLQNRHNKETVFEFARNPDDEMSVLMKRRRRQLAPIQRKAEERRELMEKE 710

Query: 712 RMIGLRHSIEDEILKGEDNEVGYSVPDEVLKEFEDADVLLEEQENIXXXXXXTFRDPTFY 771
           R+ GL H IED+ILKG+D E GY+VP++ LKEFEDAD +LE           TFRD  F+
Sbjct: 711 RLAGLTHRIEDQILKGDDFEAGYTVPEDALKEFEDADKVLEASN--KKSEQKTFRDENFF 768

Query: 772 LSHFAPTSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQ 831
           LSH+APTS IQD+Q ++S+GFTN A+ AA+DL +DDKVQVHKQTATVKWDKKRKKYVN Q
Sbjct: 769 LSHYAPTSAIQDQQYKLSTGFTNAAAEAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNMQ 828

Query: 832 GLDNKKYIIGESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPT---SP 888
           G+DNKKYI+GESGQKI ASFRSGKF++WSKARK+ PLKVGAREST+ +NLL++PT   S 
Sbjct: 829 GIDNKKYIVGESGQKIAASFRSGKFEEWSKARKLKPLKVGARESTMQTNLLSNPTENNSN 888

Query: 889 SERTVGGKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGYNGPGMKQEIKSVD 948
            ++TV GKFKHK  K+PKLPDK RDDY  QKKKV +AL RG  VKGY+GPGMK E+KS +
Sbjct: 889 GQKTVRGKFKHKQMKSPKLPDKFRDDYEKQKKKVASALARGAHVKGYSGPGMKNELKSTE 948

Query: 949 XXXXXXXXXXXXXXXNARPTKRRK 972
                          NARP+K+RK
Sbjct: 949 QIRKERMAKENRRAKNARPSKKRK 972

>SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} similar to
            uniprot|Q12389 Saccharomyces cerevisiae YDL031W DBP10
            Essential protein involved in ribosome biogenesis
            putative ATP-dependent RNA helicase of the DEAD- box
            protein family
          Length = 1003

 Score = 1311 bits (3394), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 663/981 (67%), Positives = 764/981 (77%), Gaps = 31/981 (3%)

Query: 20   DAFDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEFSSDXXXXXXXXXXXXXXXXX 79
            D FDIAGDIAL++                 + EVQDVIEFS D                 
Sbjct: 25   DVFDIAGDIALDSSEDDDDDDDDGEQDS--EQEVQDVIEFS-DGEEQGKKNQSKGAAKSA 81

Query: 80   XAGPIVDSK-----FPSLELSDDEKKATNESDDDLNDYFNTTADAA-AKHKKGSFASFGL 133
              G    +K     FP+LELSD E +A +   D +NDYF+TTA AA  KHKKGSF SFG 
Sbjct: 82   AKGNSKGAKQPRPSFPTLELSDAEDEAPDADKDAVNDYFSTTAAAAAGKHKKGSFPSFGF 141

Query: 134  SKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSA 193
            SK +L NIS+KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF LPMIEKLK HSA
Sbjct: 142  SKFILNNISRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSA 201

Query: 194  KIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIAT 253
            KIGVRAVILSPSRELA+QT++VFKEFS+GSDLRS+LLTGGDSLE+QFGMMMGNPDVVIAT
Sbjct: 202  KIGVRAVILSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIAT 261

Query: 254  PGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPS 313
            PGRFLHLKVEMNLDLK+VEYVVFDEADRLFEMGFQEQLNELL A P  RQTLLFSATLP 
Sbjct: 262  PGRFLHLKVEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPH 321

Query: 314  SLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATES 373
            SLVDFAKAGL+NPVLVRLDAE+K+SENLEMLF++ K  EREANLLYLLQE I++PVAT  
Sbjct: 322  SLVDFAKAGLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAE 381

Query: 374  QIKKLKQ-QNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVE 432
            Q+K+L+   +                        R++P+ANE+PSEKATI+FVPTRHHVE
Sbjct: 382  QLKQLRALNDRSDSDADSDANDKNDRKKRKKQARRKMPSANELPSEKATILFVPTRHHVE 441

Query: 433  YVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVIN 492
            YV+QLLK+ GYLVSYIYG L+Q+ARKQQL+NFR+GLTSILVVTDVAARGVDIP+LANVIN
Sbjct: 442  YVSQLLKDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVIN 501

Query: 493  YSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKILLTPMYESSCQ 552
            +SLP SSKIFIHRVGRTARAGN GWA+SIVS              GKKILL PMY+++C+
Sbjct: 502  FSLPSSSKIFIHRVGRTARAGNSGWAYSIVSENELPYLLDLELFLGKKILLAPMYDATCE 561

Query: 553  ILRKKAESEG--NNNFTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMIKSDFELNTVKGV 610
            ++RK+  +EG   + F  P+VSYT RMVLG+CPR E++ MGDLY N+++S F+L  +K V
Sbjct: 562  LMRKQWVAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSV 621

Query: 611  ALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFLAKLQHRNNKE 670
            ALKAEKLYFRTR PAS E+MKRSKEI+ SGWDEQN+ FGKN EKEKLDFLAKLQ+RN+KE
Sbjct: 622  ALKAEKLYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKE 681

Query: 671  TVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHSIEDEILKGEDN 730
            TVFEFARN +DEM+VLM+RRRRQIAPIQRKA+ERQELLEKERM GLRH++EDE+LKG D 
Sbjct: 682  TVFEFARNQEDEMAVLMRRRRRQIAPIQRKARERQELLEKERMAGLRHTLEDEVLKGGDG 741

Query: 731  EVGYSVPDEVL-KEFEDADVLLEEQEN------------------IXXXXXXTFRDPTFY 771
            E GYSVP+EVL +EFEDAD +L+EQEN                         T++DP F+
Sbjct: 742  EFGYSVPEEVLAQEFEDADKILDEQENKKKTKTMKTRQGETKPKPKPKPKPKTYKDPNFF 801

Query: 772  LSHFAPTSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQ 831
            LSH+AP  DIQDKQLQ++SGFTNDA++A FDL +D+KVQVHKQTATVKWDKKRKKYVN Q
Sbjct: 802  LSHYAPAGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNAQ 861

Query: 832  GLDNKKYIIGESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPTSPSER 891
            GLDNKKYIIGESGQKIPASFRSGKF +WSKARK+ PLKVGARE++ PSNLL+DP S   R
Sbjct: 862  GLDNKKYIIGESGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPASGGRR 921

Query: 892  TVGGKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGYNGPGMKQEIKSVDXXX 951
              GG+FKHK  KAPKLPD+HRDDY  Q+KKV  ALERG+ VKG+  PG K E+KS +   
Sbjct: 922  VAGGRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGFGAPGAKSEMKSTEQIR 981

Query: 952  XXXXXXXXXXXXNARPTKRRK 972
                        NARP+K+RK
Sbjct: 982  SQRVAKDKRLAKNARPSKKRK 1002

>NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159
          Length = 977

 Score = 1311 bits (3393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 659/975 (67%), Positives = 760/975 (77%), Gaps = 24/975 (2%)

Query: 11  AEDYSSEDED---AFDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEFSSDXXXXX 67
           AE  SS DED    FDIAGDIALN+                 + +VQDVIE+S D     
Sbjct: 15  AEAASSGDEDQDVGFDIAGDIALNSSESDASESDDD------EEDVQDVIEYSDDETETK 68

Query: 68  XXXXXXXXXXXXXAGPIVDSKFPSLELSDDE--KKATNESDDDLNDYFNTTADAAAKHKK 125
                             D  FPSLELSDDE  ++   + DDD+N YF+TT    +KHKK
Sbjct: 69  KKNDKKKNNNKTKE----DKSFPSLELSDDEADRRNNEDEDDDVNAYFSTTNLDKSKHKK 124

Query: 126 GSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI 185
           GSF SFGLSK ++ NI++KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF+LPMI
Sbjct: 125 GSFPSFGLSKFIISNITRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMI 184

Query: 186 EKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMG 245
           EKLKTHS KIG RAVILSPSRELA+QTH VFK+FSKG+ LRS+LLTGGDSLEDQFGMMM 
Sbjct: 185 EKLKTHSGKIGARAVILSPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMN 244

Query: 246 NPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTL 305
           NPDV+IATPGRFLHLKVEMNLDLKS+EY VFDEADRLFEMGFQEQLNELL + P++RQTL
Sbjct: 245 NPDVIIATPGRFLHLKVEMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTL 304

Query: 306 LFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAI 365
           LFSATLPSSLVDFAKAGL+NPVLVRLDAETKISENLEMLF+S K DEREANLLYLLQE I
Sbjct: 305 LFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVI 364

Query: 366 KMPVATESQIKKLKQQNXX--XXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
           K+P+A+  Q+ K   QN                           RLP AN++PSEK+TI+
Sbjct: 365 KIPLASRDQLAKFNAQNIKDNASDSDSDGDDKRQKGKRKKFKKERLPPANQLPSEKSTIL 424

Query: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483
           FVPTRHHVEY++ LL+  GYL+SYIYG L+QHARK+QLYNFR GLTSILVVTDVAARGVD
Sbjct: 425 FVPTRHHVEYISNLLRESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVD 484

Query: 484 IPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKILL 543
           IP+LANVIN+SLP SSKIF+HRVGRTARAGNRGWA+SIVS              GKKIL+
Sbjct: 485 IPMLANVINFSLPASSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILM 544

Query: 544 TPMYESSCQILRKKAESEGNN--NFTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMIKSD 601
           TPMY+S   I+ KK  +EG++  NF  PKVSYT RM+LG+ PR E++G+GDLY N++KS+
Sbjct: 545 TPMYDSMSDIMLKKWIAEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSN 604

Query: 602 FELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFLA 661
           FE+  +KGVA+KAEKLYFRTR  AS ES+KRSKEI+ SGWDEQNI FGKNAEKEKLDFLA
Sbjct: 605 FEIQLLKGVAMKAEKLYFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLA 664

Query: 662 KLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHSIE 721
           KLQ+R NKETVFEFA NPDDEMSV MKRRRRQ+APIQRKAKER ELL+KE++ GL H++E
Sbjct: 665 KLQNRRNKETVFEFASNPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTME 724

Query: 722 DEILKGEDNE-VGYSVPDEVLKEFEDADVLLEEQENIXXXXXXTFRDPTFYLSHFAPTSD 780
           DE+LKG++ E   Y++ ++ LK+FED D LL  QEN       TF+DPTF+LSH+AP SD
Sbjct: 725 DEVLKGDNAEDNSYTISEDTLKQFEDGDELLAGQEN--KKKKKTFKDPTFFLSHYAPASD 782

Query: 781 IQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKYII 840
           IQDKQLQ+++GF N+A+ AA+DL NDDKVQVHKQTATVKWDKKRKKYVN QGLDNKKYII
Sbjct: 783 IQDKQLQVANGFANEAAQAAYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKYII 842

Query: 841 GESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPTS--PSERTVGGKFK 898
           GESGQKI ASFRSGKF +W+KARK+ PLKVGARES+IPSNLL+DPT    ++ +V GKFK
Sbjct: 843 GESGQKIAASFRSGKFDEWTKARKLKPLKVGARESSIPSNLLSDPTQGPGAQNSVRGKFK 902

Query: 899 HKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGYNGPGMKQEIKSVDXXXXXXXXXX 958
           HK  KAPKLPDKHRDDY  QKKKV  ALE GV+V+G+ GPGMK E+KS +          
Sbjct: 903 HKQLKAPKLPDKHRDDYQTQKKKVAKALENGVQVRGFRGPGMKSELKSTEEIRKQRAFME 962

Query: 959 XXXXXNARPTKRRKH 973
                NARP KRRK+
Sbjct: 963 KKRAKNARPAKRRKY 977

>KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis putative ATP-dependent RNA helicase of the
           DEAD-box protein family
          Length = 972

 Score = 1307 bits (3383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 644/963 (66%), Positives = 762/963 (79%), Gaps = 13/963 (1%)

Query: 16  SEDEDAFDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEFSSDXXXXXXXXXXXXX 75
           S+DED  DIAG+IAL++                   +VQD+IEFS +             
Sbjct: 16  SDDEDV-DIAGNIALDSSDSSSSSDNDDDGSEDEAGDVQDIIEFSDEDEEEARAKAAPQK 74

Query: 76  XXXXXAGPIVDSKFPSLELSDDEKKATN-ESDDDLNDYFNTTADAAAKHKKGSFASFGLS 134
                     +  FP+LELSD+E      +  DD+ +YF+T    AAKHKKGSFASFGLS
Sbjct: 75  KKKNAH----EGGFPALELSDNEDHDDGKDGADDVTEYFSTNNPEAAKHKKGSFASFGLS 130

Query: 135 KLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAK 194
           K ++ NI+KKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLK HSAK
Sbjct: 131 KFIVSNIAKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKGHSAK 190

Query: 195 IGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATP 254
           IG RAVILSPSRELA+QTH+VF+EFS+GSDLRS+LLTGG+SLE+QFG+MM NPDVVIATP
Sbjct: 191 IGARAVILSPSRELAMQTHKVFREFSRGSDLRSVLLTGGESLEEQFGLMMSNPDVVIATP 250

Query: 255 GRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSS 314
           GRFLHLKVEMNLDLKSVEY+VFDEADRLFEMGF+EQL+ELL A P  RQTLLFSATLPSS
Sbjct: 251 GRFLHLKVEMNLDLKSVEYLVFDEADRLFEMGFEEQLSELLAALPVARQTLLFSATLPSS 310

Query: 315 LVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQ 374
           LV+FAKAGL+NPVLVRLDAETK+SENLEMLF+S K +EREANLLYLLQEA+K+PVATE Q
Sbjct: 311 LVNFAKAGLTNPVLVRLDAETKVSENLEMLFLSSKNEEREANLLYLLQEAMKIPVATEEQ 370

Query: 375 I--KKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVE 432
           +   K K +N                        ++LP+ANE+PSE ATIVFVPTRHHVE
Sbjct: 371 LLEYKAKVKNSYDSDDSDEDAKAKAKKQRKSAIRKKLPSANELPSEHATIVFVPTRHHVE 430

Query: 433 YVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVIN 492
           Y++QLLK+CGYLVSY+YG L+QHAR+QQL+NFRAGLT+ILVVTDVAARGVDIPLLANV+N
Sbjct: 431 YISQLLKDCGYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVTDVAARGVDIPLLANVVN 490

Query: 493 YSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKILLTPMYESSCQ 552
           YSLP SSKIF+HRVGRTARAGN+G+A+SIVS              GKKILLTPM+E++ +
Sbjct: 491 YSLPASSKIFVHRVGRTARAGNKGFAYSIVSENELPYLLDLELFLGKKILLTPMFEATTE 550

Query: 553 ILRKKAESEGNN--NFTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMIKSDFELNTVKGV 610
           +L+ K  +EGN+   F  PKVSYT RMVLGACPR +++  GDL+ N+ +S F+L  +KGV
Sbjct: 551 LLKSKWIAEGNSELTFNPPKVSYTNRMVLGACPRLDLETCGDLFKNLTQSSFDLQQLKGV 610

Query: 611 ALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFLAKLQHRNNKE 670
           A KAEKLYFRTR PAS++SMKRSKE++ SGWDEQN+ FGKN EKEKLDFLAKLQ+RNNKE
Sbjct: 611 AAKAEKLYFRTRPPASSQSMKRSKEVIASGWDEQNLRFGKNIEKEKLDFLAKLQNRNNKE 670

Query: 671 TVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHSIEDEILKGEDN 730
           TVFEFARN DDEMS+LMK+RR QIAPIQR+AKER+ELLEKERM GLRH++EDEILKG++N
Sbjct: 671 TVFEFARNQDDEMSLLMKKRRIQIAPIQRRAKERKELLEKERMAGLRHTVEDEILKGDEN 730

Query: 731 EVGYSVPDEVL-KEFEDADVLLEEQENIXXXXXXTFRDPTFYLSHFAPTSDIQDKQLQIS 789
           EVGYSVP+EVL +EF+DAD LL  Q         +FRDP F+LSH+AP S+IQDKQL+++
Sbjct: 731 EVGYSVPEEVLHREFQDADELLGAQSK--SKRPKSFRDPAFFLSHYAPASEIQDKQLEVT 788

Query: 790 SGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKYIIGESGQKIPA 849
           +GFTN+A+NA FDL NDDKVQ HKQ AT KWDKKR+KYVNTQGLDNKKYI+GESG KIPA
Sbjct: 789 NGFTNEAANATFDLHNDDKVQNHKQVATTKWDKKRQKYVNTQGLDNKKYIMGESGHKIPA 848

Query: 850 SFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPTSPSERTVGGKFKHKTQKAPKLPD 909
           SFRSGKF +WSKARK+ PLKVGA+ES+  + +L++PT+  +R++GG+FKH   +APKLPD
Sbjct: 849 SFRSGKFDEWSKARKLGPLKVGAKESSTTAKMLSNPTAEGQRSIGGRFKHNKVRAPKLPD 908

Query: 910 KHRDDYAFQKKKVEAALERGVRVKGYNGPGMKQEIKSVDXXXXXXXXXXXXXXXNARPTK 969
           KHRDDY  QKKKVE A+  G+ VKGYN PGMK E++S                 NARP K
Sbjct: 909 KHRDDYHVQKKKVEKAVSSGIPVKGYNAPGMKSEMRSTQQIYKERVAKEKKRAKNARPAK 968

Query: 970 RRK 972
           +RK
Sbjct: 969 KRK 971

>YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putative
           ATP-dependent RNA helicase of the DEAD-box protein
           family, constituent of 66S pre-ribosomal particles;
           essential protein involved in ribosome biogenesis
          Length = 995

 Score = 1296 bits (3355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/991 (65%), Positives = 760/991 (76%), Gaps = 20/991 (2%)

Query: 2   VDSSKRALPAED--YSSEDEDAFDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEF 59
           V   KR L  +D   S ED+ AFDIA +IALN                    +VQDVIE+
Sbjct: 4   VQKRKRDLEDQDDNGSEEDDIAFDIANEIALNDSESDANDSDSEVEADYGPNDVQDVIEY 63

Query: 60  SSDXXX--XXXXXXXXXXXXXXXAGPIVDSKFPSLELSDDEKKA-----TNESDDDLNDY 112
           SSD                          + FP LE+SDDE  A     T + +DD+N+Y
Sbjct: 64  SSDEEEGVNNKKKAENKDIKKKKNSKKEIAAFPMLEMSDDENNASGKTQTGDDEDDVNEY 123

Query: 113 FNTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMART 172
           F+T      KHKKGSF SFGLSK+VL NI +KGFRQPTPIQRKTIPLILQ RDIVGMART
Sbjct: 124 FSTNNLEKTKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMART 183

Query: 173 GSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTG 232
           GSGKTAAF+LPM+EKLK+HS KIG RAVILSPSRELA+QT  VFK+F++G++LRS+LLTG
Sbjct: 184 GSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTG 243

Query: 233 GDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLN 292
           GDSLE+QFGMMM NPDV+IATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLN
Sbjct: 244 GDSLEEQFGMMMTNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLN 303

Query: 293 ELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDE 352
           ELL + PT RQTLLFSATLP+SLVDF KAGL NPVLVRLDAETK+SENLEMLF+S K  +
Sbjct: 304 ELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNAD 363

Query: 353 REANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXX---XXXXXXXRRL 409
           REANLLY+LQE IK+P+AT  Q++KL+  N                           +++
Sbjct: 364 REANLLYILQEIIKIPLATSEQLQKLQNSNNEADSDSDDENDRQKKRRNFKKEKFRKQKM 423

Query: 410 PNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLT 469
           P ANE+PSEKATI+FVPTRHHVEY++QLL++CGYL+SYIYG L+QHARK+QLYNFRAGLT
Sbjct: 424 PAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKRQLYNFRAGLT 483

Query: 470 SILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXX 529
           SILVVTDVAARGVDIP+LANVINY+LPGSSKIF+HRVGRTARAGN+GWA+SIV+      
Sbjct: 484 SILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAENELPY 543

Query: 530 XXXXXXXXGKKILLTPMYESSCQILRKKAESEG--NNNFTDPKVSYTTRMVLGACPRSEI 587
                   GKKILLTPMY+S   +++K+   EG     F  PK+SYT R+VLG+CPR ++
Sbjct: 544 LLDLELFLGKKILLTPMYDSLVDVMKKRWIDEGKPEYQFQPPKLSYTKRLVLGSCPRLDV 603

Query: 588 DGMGDLYSNMIKSDFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIY 647
           +G+GDLY N++ S+F+L   K  A+KAEKLY+RTRT AS ES+KRSKEI+ SGWD QN +
Sbjct: 604 EGLGDLYKNLMSSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEIISSGWDAQNAF 663

Query: 648 FGKNAEKEKLDFLAKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQEL 707
           FGKN EKEKLDFLAKLQ+R NKETVFEF RNPDDEM+V MKRRR+Q+APIQRKA ER+EL
Sbjct: 664 FGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKATERREL 723

Query: 708 LEKERMIGLRHSIEDEILKGEDNEVGYSVPDEVLKEFEDADVLLE--EQENIXXXXXXTF 765
           LEKERM GL HSIEDEILKG+D E GY+V ++ LKEFEDAD LLE  E EN       +F
Sbjct: 724 LEKERMAGLSHSIEDEILKGDDGETGYTVSEDALKEFEDADQLLEAQENENKKKKKPKSF 783

Query: 766 RDPTFYLSHFAPTSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRK 825
           +DPTF+LSH+AP  DIQDKQLQI++GF NDA+ AA+DL +DDKVQVHKQTATVKWDKKRK
Sbjct: 784 KDPTFFLSHYAPAGDIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTATVKWDKKRK 843

Query: 826 KYVNTQGLDNKKYIIGESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADP 885
           KYVNTQG+DNKKYIIGESGQKI ASFRSG+F DWSKAR + PLKVG+RE++IPSNLL DP
Sbjct: 844 KYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRETSIPSNLLEDP 903

Query: 886 T---SPSERTVGGKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGY-NGPGMK 941
           +   + + RTV GKFKHK  KAPK+PDKHRD+Y  QKKKVE AL+ G+ VKGY N PG++
Sbjct: 904 SQGPAANGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVEKALQSGISVKGYNNAPGLR 963

Query: 942 QEIKSVDXXXXXXXXXXXXXXXNARPTKRRK 972
            E+KS +               NARP+K+RK
Sbjct: 964 SELKSTEQIRKDRIIAEKKRAKNARPSKKRK 994

>Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W
           (REAL)
          Length = 998

 Score = 1296 bits (3353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/979 (66%), Positives = 754/979 (77%), Gaps = 21/979 (2%)

Query: 15  SSEDEDAFDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEFSSDXXXXXXXXXXXX 74
           S ED+ AFDIA DIALN                   ++VQD+IE+SSD            
Sbjct: 19  SEEDDIAFDIANDIALNDSESDSNDSENEIEAGYGPSDVQDIIEYSSDDEEEGKKSNKKK 78

Query: 75  XXXXXXAGPIVDSK-----FPSLELSDDEKKATN-----ESDDDLNDYFNTTADAAAKHK 124
                  G    +K     FP LELSDDE   +      E +DD+N+YF+T      KHK
Sbjct: 79  KTNDKKPGKNKHNKKEVAAFPILELSDDENNISGQTQAGEEEDDVNEYFSTNNLEKQKHK 138

Query: 125 KGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPM 184
           KGSF SFGLSK+VL NI +KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF+LPM
Sbjct: 139 KGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPM 198

Query: 185 IEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMM 244
           +EKLK+HS KIG RAVILSPSRELA+QT  VFK+F++G++LRS+LLTGGDSLE+QF MMM
Sbjct: 199 VEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMM 258

Query: 245 GNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQT 304
            NPDV+IATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL + PT RQT
Sbjct: 259 SNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQT 318

Query: 305 LLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEA 364
           LLFSATLP+SLVDF KAGL NPVLVRLDAETK+SENLEMLF+S K  +REANLLY+LQE 
Sbjct: 319 LLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEV 378

Query: 365 IKMPVATESQIKKL-KQQNXXXXXXXXXXXXXXXXXXXXXXXXR--RLPNANEMPSEKAT 421
           I++P+AT  Q+ KL K  N                        R  ++P ANE+PSEKAT
Sbjct: 379 IRIPLATSEQLLKLQKSTNEADSDSDDENDRQKKKINFKKEKFRKQKMPAANELPSEKAT 438

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           I+FVPTRHHVEY++QLL++CGYL+SYIYG L+QHARK QLYNFRAGLTSILVVTDVAARG
Sbjct: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKI 541
           VDIP+LANVINY+LPGSSKIF+HRVGRTARAGN+GWA+SIV+              GKKI
Sbjct: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAENELPYLLDLELFLGKKI 558

Query: 542 LLTPMYESSCQILRKKAESEGNN--NFTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMIK 599
           LLTPMY+S   +++K+   EGN+  NF  PK+SYT R+VLG+CPR +++G+GDLY N++ 
Sbjct: 559 LLTPMYDSLVDVMKKRWVEEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMT 618

Query: 600 SDFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDF 659
           S+F+L   K  A+KAEKLY+RTRT AS ES+KRSKEI+ SGWD QN YFGKN EKEKLDF
Sbjct: 619 SNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDF 678

Query: 660 LAKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHS 719
           LAKLQ+R NKETVFEF RNPDDEM+V MKRRR+Q+APIQRKA ER+ELLEKERM GL HS
Sbjct: 679 LAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHS 738

Query: 720 IEDEILKGEDNEVGYSVPDEVLKEFEDADVLLEEQEN--IXXXXXXTFRDPTFYLSHFAP 777
           IEDEILKG+D E GY+V ++ LK FEDAD LLE QEN         TF+DPTF+LSH+AP
Sbjct: 739 IEDEILKGDDGETGYTVSEDALKNFEDADQLLEAQENESKKKKKPKTFKDPTFFLSHYAP 798

Query: 778 TSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKK 837
             +IQDKQLQI++GF NDA+ AA+DL +DDKVQVHKQTATVKWDKKRKKYVNTQG+DNKK
Sbjct: 799 AGEIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKK 858

Query: 838 YIIGESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADP---TSPSERTVG 894
           YIIGESGQKI ASFRSG+F DWSKAR + PLKVG+RES+IPSNLL DP   T  + RTV 
Sbjct: 859 YIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRESSIPSNLLQDPSQGTGSNGRTVR 918

Query: 895 GKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGY-NGPGMKQEIKSVDXXXXX 953
           GKFKHK  KAPK+PDKHRD+Y  QKKKV+ AL+ G+ VKGY N PG++ E+KS +     
Sbjct: 919 GKFKHKQMKAPKMPDKHRDNYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKD 978

Query: 954 XXXXXXXXXXNARPTKRRK 972
                     NARP+K+RK
Sbjct: 979 RNMAEKKRAKNARPSKKRK 997

>CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highly
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031w
          Length = 969

 Score = 1293 bits (3346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/981 (66%), Positives = 751/981 (76%), Gaps = 22/981 (2%)

Query: 1   MVDSSKRALPAEDYSSEDEDAFDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEFS 60
           MV + KR    E  S  DE+  DIAG++  +                    EVQDVIE+S
Sbjct: 1   MVKNLKRKERDEHESDSDEE-IDIAGNLVADGSDSESDDSSDGS-----DEEVQDVIEYS 54

Query: 61  SDXXXXXXXXXXXXXXXXXXAGPIVDSKFPSLELSDDEKKATNESDDDLND--YFNTTAD 118
           SD                       D  FPSLELSDDE +     +DD +   YF+   D
Sbjct: 55  SDEEEPAKPAKAVKKKVE-------DKSFPSLELSDDEDEKKKVDNDDDDVNAYFSVNTD 107

Query: 119 AAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTA 178
           A +KHKKGSFASFGLSKL+L+NISK+GFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTA
Sbjct: 108 AKSKHKKGSFASFGLSKLILVNISKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTA 167

Query: 179 AFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLED 238
           AFVLPMIEKLKTHS+KIG RA+ILSPSRELA+QTH VFKEFS+G+ LRS+LLTGGDSLED
Sbjct: 168 AFVLPMIEKLKTHSSKIGARAIILSPSRELAMQTHSVFKEFSRGTHLRSVLLTGGDSLED 227

Query: 239 QFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAF 298
           QFGMMM NPDV+IATPGRFLHLKVEMNLDLKSVEY VFDEADRLFEMGFQEQLNELL A 
Sbjct: 228 QFGMMMTNPDVIIATPGRFLHLKVEMNLDLKSVEYAVFDEADRLFEMGFQEQLNELLAAL 287

Query: 299 PTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLL 358
           P++RQTLLFSATLP+SLVDFAKAGL NPVLVRLDAE+KIS+NLEMLF+S K DEREANLL
Sbjct: 288 PSSRQTLLFSATLPTSLVDFAKAGLVNPVLVRLDAESKISDNLEMLFLSTKNDEREANLL 347

Query: 359 YLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSE 418
           Y+LQE IK+P+AT  QIK+L                            + +P ANE+PSE
Sbjct: 348 YILQEVIKLPLATPEQIKQLNDNKADDSDESAEEDEDKKRRKRKSFNRKAMPKANELPSE 407

Query: 419 KATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVA 478
           KAT+VFVPTRHHVEY++ LLK+CGYLVSYIYGAL+QHARK QLYNFR GLTSILVVTDVA
Sbjct: 408 KATVVFVPTRHHVEYLSNLLKDCGYLVSYIYGALDQHARKSQLYNFRIGLTSILVVTDVA 467

Query: 479 ARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXG 538
           ARGVDIP+LANV+NYSLP SSKIFIHRVGRTARAGNRGWA+SIVS              G
Sbjct: 468 ARGVDIPMLANVVNYSLPASSKIFIHRVGRTARAGNRGWAYSIVSENELPYLLDLELFLG 527

Query: 539 KKILLTPMYESSCQILRKKAESEGNNN--FTDPKVSYTTRMVLGACPRSEIDGMGDLYSN 596
           +KILLTPMYE+  ++ ++K  +EGN+   F  PK+SYT+RMVLG+CPR +I+ + +LY+N
Sbjct: 528 RKILLTPMYEALERLSKEKWVAEGNDETLFQSPKISYTSRMVLGSCPRLDIEALSELYNN 587

Query: 597 MIKSDFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEK 656
           ++KS+F+L+  K  ALKAEKLYFRTRT AS ES+KRSKEI+ SGWDEQN+ FGKN EKEK
Sbjct: 588 LMKSNFDLDMAKKTALKAEKLYFRTRTSASPESLKRSKEIISSGWDEQNVLFGKNLEKEK 647

Query: 657 LDFLAKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGL 716
             FL KLQ+R NKETVFEF RNP+DEM+ LM RRRR IAPIQRKAKER+ELLEKERM GL
Sbjct: 648 NAFLEKLQNRRNKETVFEFTRNPEDEMANLMHRRRRAIAPIQRKAKERKELLEKERMAGL 707

Query: 717 RHSIEDEILKGEDNEVGYSVPDEVLKEFEDADVLLEEQENIXXXXXXTFRDPTFYLSHFA 776
            H++EDEILKG+D EVGY+V ++ LK FEDAD +L EQEN       TFRDP F+LSH+A
Sbjct: 708 THALEDEILKGDDAEVGYTVTEDTLKAFEDADTILAEQENASKKKKKTFRDPNFFLSHYA 767

Query: 777 PTSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNK 836
           P ++IQDKQL++S GF N+A+ +A+DL +DDKVQVHKQTATVKWDKKRKKYVN  G+DNK
Sbjct: 768 PANEIQDKQLELSGGFINEAAQSAYDLNSDDKVQVHKQTATVKWDKKRKKYVNMNGIDNK 827

Query: 837 KYIIGESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPT----SPSERT 892
           KYIIGESGQKI ASFRSGKF +WSKARK+APLK GA ES+IPSNLL DPT        + 
Sbjct: 828 KYIIGESGQKIAASFRSGKFDEWSKARKLAPLKTGANESSIPSNLLVDPTRGPGKSGSKL 887

Query: 893 VGGKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGY-NGPGMKQEIKSVDXXX 951
             GKFKHK +KAP+LPDK RDDY  QKKKVE+ALERG+ VKGY N P  K E+KSV    
Sbjct: 888 PNGKFKHKLEKAPRLPDKKRDDYHKQKKKVESALERGIAVKGYNNAPAFKSELKSVAQIR 947

Query: 952 XXXXXXXXXXXXNARPTKRRK 972
                       NARP+K+RK
Sbjct: 948 KDRKTKENRHAKNARPSKKRK 968

>Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {ON}
           YDL031W (DBP10) - similar to RNA helicases [contig 184]
           FULL
          Length = 973

 Score = 1292 bits (3343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 641/968 (66%), Positives = 767/968 (79%), Gaps = 12/968 (1%)

Query: 12  EDYSSEDEDAFDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEFSSDXXXXXXXXX 71
           ED  S++ED  DIAG+IAL++                 + +VQD+I+FS D         
Sbjct: 12  EDPLSDEEDV-DIAGNIALDSDESSESEDDSEDGEGE-EGDVQDIIDFSGDEEETSKNAK 69

Query: 72  XXXXXXXXXAGPIVDSKFPSLELSDDEK-KATNESDDDLNDYFNTTADAAAKHKKGSFAS 130
                    +     + FP LELSDDE+ +A N+ +DD+ +YF TT   A+KHKKGSFAS
Sbjct: 70  KTGKAEKKPSSK--QASFPLLELSDDEEEQAANDGEDDVTEYFTTTNAEASKHKKGSFAS 127

Query: 131 FGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKT 190
           FGLSK ++ NI+KKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE+LK 
Sbjct: 128 FGLSKFIISNIAKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIERLKG 187

Query: 191 HSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVV 250
           HSAKIG RAVI+SPSRELA+QTH+VF+EFS+GSDLRS+LLTGG+SLE+QFG+MM NPDVV
Sbjct: 188 HSAKIGARAVIMSPSRELALQTHKVFREFSRGSDLRSVLLTGGESLEEQFGLMMSNPDVV 247

Query: 251 IATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSAT 310
           IATPGRFLHLKVEMNLDLKS+EYVVFDEADRLFEMGF+EQLNELL AFP  RQTLLFSAT
Sbjct: 248 IATPGRFLHLKVEMNLDLKSIEYVVFDEADRLFEMGFEEQLNELLAAFPVARQTLLFSAT 307

Query: 311 LPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVA 370
           LPSSLVDFAKAGL++PVLVRLD ETK+SENLEML++S K +EREANLLYLLQEA+++PVA
Sbjct: 308 LPSSLVDFAKAGLTSPVLVRLDTETKVSENLEMLYLSSKNEEREANLLYLLQEAMQIPVA 367

Query: 371 TESQIKKLKQQ--NXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTR 428
           TE Q+ + + +  +                        R++P ANE+PSE ATIVFVPTR
Sbjct: 368 TEEQLAEYRTKIKDDYDSDDSDSKDKLKAKKKKKAMIRRKMPAANELPSEHATIVFVPTR 427

Query: 429 HHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLA 488
           HHVEY+TQLLK+CGYLVSY+YG L+QHAR+QQL+NFRAGLT+ILVVTDVAARGVDIP+LA
Sbjct: 428 HHVEYITQLLKDCGYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVTDVAARGVDIPMLA 487

Query: 489 NVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKILLTPMYE 548
           NV+NYSLP SSKIF+HRVGRTARAGN+G A+SIVS              GKKILLTPMYE
Sbjct: 488 NVVNYSLPASSKIFVHRVGRTARAGNKGSAYSIVSDNELPYLLDLELFLGKKILLTPMYE 547

Query: 549 SSCQILRKKAESEGNN--NFTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMIKSDFELNT 606
           ++ ++L+ +  +EG +   F  PKVSYT RMVLGACPR E++  GDL+ ++I S F+L  
Sbjct: 548 ATTEMLKSRWIAEGKSELTFNAPKVSYTNRMVLGACPRLELETCGDLFKSLIDSSFDLKQ 607

Query: 607 VKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFLAKLQHR 666
           +K VA KAEKLYFRTR PAS++SMKRSKE+L SGWDEQN+ FGKN EKEKLDFLAKLQ+R
Sbjct: 608 LKAVANKAEKLYFRTRPPASSQSMKRSKEVLSSGWDEQNLRFGKNMEKEKLDFLAKLQNR 667

Query: 667 NNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHSIEDEILK 726
           ++KETVFEFARN DDEM++LMK+RR QIAPIQR+AKER+ELLEKER  GL HS+EDEILK
Sbjct: 668 HHKETVFEFARNHDDEMALLMKKRRIQIAPIQRRAKERKELLEKERKAGLVHSVEDEILK 727

Query: 727 GEDNEVGYSVPDEVL-KEFEDADVLLEEQENIXXXXXXTFRDPTFYLSHFAPTSDIQDKQ 785
           G++ EVGYSVP+EVL +EFEDAD LLE Q+        +FRDPT++LSH+AP S+IQDKQ
Sbjct: 728 GDETEVGYSVPEEVLHQEFEDADELLEGQKK--EKKQKSFRDPTYFLSHYAPASEIQDKQ 785

Query: 786 LQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKYIIGESGQ 845
           L++S+GFTN+A+NA FDL NDDKVQ HKQ AT+KWDKKR+KYVN+QGLDNKKYI GESG 
Sbjct: 786 LEVSNGFTNEAANATFDLHNDDKVQNHKQIATIKWDKKRQKYVNSQGLDNKKYITGESGH 845

Query: 846 KIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPTSPSERTVGGKFKHKTQKAP 905
           KIPASFRSGKF +WSKARK+ P+KVGARES+  S +L++PTS ++R  GGKFKH   KAP
Sbjct: 846 KIPASFRSGKFDEWSKARKLGPIKVGARESSSTSKMLSNPTSNNQRMGGGKFKHNKVKAP 905

Query: 906 KLPDKHRDDYAFQKKKVEAALERGVRVKGYNGPGMKQEIKSVDXXXXXXXXXXXXXXXNA 965
           KLPDK+RDDY  QKKKVE A+  G+RVKG+N PGMK E+++                 NA
Sbjct: 906 KLPDKNRDDYHVQKKKVEKAISSGIRVKGFNAPGMKSEMRTPQQIYKERVAKEKKRAKNA 965

Query: 966 RPTKRRKH 973
           RP K+RK+
Sbjct: 966 RPAKKRKY 973

>Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W
            (REAL)
          Length = 1007

 Score = 1292 bits (3343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 654/1003 (65%), Positives = 762/1003 (75%), Gaps = 32/1003 (3%)

Query: 2    VDSSKRALPAEDYS-SEDEDA-FDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEF 59
            V   KR L  +D S SE+EDA FDIA DIALNA                  + VQDVIE+
Sbjct: 4    VQKRKRDLGDQDGSGSEEEDAAFDIANDIALNASESDSDDSGSEEEADYGLSGVQDVIEY 63

Query: 60   SSDXXXXXXXXXXXXXXXXXX--------------AGPIVDSKFPSLELSDDE-----KK 100
            SSD                                 G    + FP+LELSDDE     K 
Sbjct: 64   SSDEEEKGKNKKKTDAKNTKKNKEDNKTKTKTKTKNGKKEAAAFPTLELSDDENSVPGKN 123

Query: 101  ATNESDDDLNDYFNTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLI 160
              ++ +DD+N+YF+TT     KHKKGSF SFGLSK+VL NI +KGFRQPTPIQRKTIPLI
Sbjct: 124  QADDDEDDVNEYFSTTNLEKTKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLI 183

Query: 161  LQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFS 220
            LQ RDIVGMARTGSGKTAAF+LPM+EKLK+HS KIG RAVILSPSRELA+QT  VFKEF+
Sbjct: 184  LQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKEFA 243

Query: 221  KGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEAD 280
            +G+ LRS+LLTGGDSLE+QF MMM NPDV+IATPGRFLHLKVEMNLDLKSVEYVVFDEAD
Sbjct: 244  RGTALRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEAD 303

Query: 281  RLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISEN 340
            RLFEMGFQEQLNELL + PT RQTLLFSATLP+SLVDF KAGL NPVLVRLD ETK+SEN
Sbjct: 304  RLFEMGFQEQLNELLASLPTARQTLLFSATLPNSLVDFVKAGLVNPVLVRLDTETKVSEN 363

Query: 341  LEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXX---XXXXXXXX 397
            LEMLF+S K D+REANLLY+LQE IK+P+AT  Q++KL++ N                  
Sbjct: 364  LEMLFVSTKNDDREANLLYILQEVIKIPLATSEQLQKLQKSNNEADSESDDDNDRQKKRK 423

Query: 398  XXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHAR 457
                     +R+P  NE+PSEKATI+FVPTRHHVEY++QLL++CG+L+SYIYG L+QHAR
Sbjct: 424  NFKKEKFRKQRMPGGNELPSEKATILFVPTRHHVEYISQLLRDCGFLISYIYGTLDQHAR 483

Query: 458  KQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGW 517
            K+QLYNFRAGLTSILVVTDVAARGVDIP+LANVINY+LPGSSKIF+HRVGRTARAGN+GW
Sbjct: 484  KRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGW 543

Query: 518  AFSIVSXXXXXXXXXXXXXXGKKILLTPMYESSCQILRKKAESEGNNNFT--DPKVSYTT 575
            A+SIV+              GKKILL PMY+S   +++K+   EG   +T   P +SYT 
Sbjct: 544  AYSIVAENELPYLLDLELFLGKKILLAPMYDSLAGLMKKRWVDEGKPEYTFQPPTLSYTK 603

Query: 576  RMVLGACPRSEIDGMGDLYSNMIKSDFELNTVKGVALKAEKLYFRTRTPASAESMKRSKE 635
            R+VLG+CPR +++G+GDLY N++ S+F+L   K  ALKAE+LY+RTRT AS ES+KRSKE
Sbjct: 604  RLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTALKAEQLYYRTRTAASPESLKRSKE 663

Query: 636  ILRSGWDEQNIYFGKNAEKEKLDFLAKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIA 695
            I+ SGWD QN YFGKN EKEKLDFLAKLQ+R NKETVFEF RNPDDEMSVLMKRRR+Q+A
Sbjct: 664  IIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMSVLMKRRRKQLA 723

Query: 696  PIQRKAKERQELLEKERMIGLRHSIEDEILKGEDNEVGYSVPDEVLKEFEDADVLLEEQE 755
            PIQRK++ER+ELLEKERM GL HSIEDEILKG D E GY++ ++ LKEFEDAD LLE QE
Sbjct: 724  PIQRKSRERRELLEKERMAGLSHSIEDEILKGNDGETGYTISEDALKEFEDADQLLEAQE 783

Query: 756  N--IXXXXXXTFRDPTFYLSHFAPTSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHK 813
            N         TF+DP+F+LSH+AP  +IQDKQL+I+ GF NDA++AA+DL  DDKVQVHK
Sbjct: 784  NDSKKKKKPKTFKDPSFFLSHYAPAGEIQDKQLEITGGFANDAAHAAYDLNGDDKVQVHK 843

Query: 814  QTATVKWDKKRKKYVNTQGLDNKKYIIGESGQKIPASFRSGKFQDWSKARKIAPLKVGAR 873
            QTATVKWDKKRKKYVNTQGLDNKKYIIGESGQKI ASFRSG+F DWSKAR + PLKVG+R
Sbjct: 844  QTATVKWDKKRKKYVNTQGLDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSR 903

Query: 874  ESTIPSNLLADPT-SPSER--TVGGKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALERGV 930
            ES+IPSNLLADP+  P  R   V GKFKHK  KAPK+PDKHRD+Y  QKKKVE AL+ GV
Sbjct: 904  ESSIPSNLLADPSQGPGARGGAVRGKFKHKQMKAPKMPDKHRDNYYTQKKKVEKALQSGV 963

Query: 931  RVKGY-NGPGMKQEIKSVDXXXXXXXXXXXXXXXNARPTKRRK 972
             V+GY N PG++ E+KS D               NARPTK+RK
Sbjct: 964  NVRGYNNAPGLRSELKSTDQIRKDRAAADKKRAKNARPTKKRK 1006

>NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON} 
          Length = 991

 Score = 1287 bits (3331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/988 (65%), Positives = 761/988 (77%), Gaps = 35/988 (3%)

Query: 11  AEDYSSEDEDA--FDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEFSSDXXXXXX 68
           A D S  + DA  FDIA DIALNA                   +VQDVI++S        
Sbjct: 12  AVDSSDSENDAADFDIATDIALNASDSDDASSDSD------NEDVQDVIDYSDSEHQQED 65

Query: 69  XXXXXXXXXXXXAGPIVDSKFPSLELSDDE--KKATNESDDDLND--------YFNTTAD 118
                           +D  FP LELSDDE  KK +N  ++  ++        YF+TT  
Sbjct: 66  NKIARKEKQKKQD---IDKSFPILELSDDEDTKKKSNSKNNGSDNDDDDDINAYFSTTNL 122

Query: 119 AAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTA 178
             +KHKKGSF SFGLSK+++ NI+K+GFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTA
Sbjct: 123 EKSKHKKGSFPSFGLSKIIVTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTA 182

Query: 179 AFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLED 238
           AF+LPMI K+KTHS+KIG RAVILSPSRELA+QTH VFKEFSKG+ LRS+LLTGGDSLED
Sbjct: 183 AFILPMIRKIKTHSSKIGARAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLED 242

Query: 239 QFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAF 298
           QFGMMM NPDV+IATPGRFLHLKVEM+LDLKS+EY VFDEADRLFEMGFQ+QLNELL + 
Sbjct: 243 QFGMMMNNPDVIIATPGRFLHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASL 302

Query: 299 PTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLL 358
           P+NRQTLLFSATLPSSLVDFAKAGL+NPVLVRLDAE+KISENLEMLF+S K DEREANLL
Sbjct: 303 PSNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLL 362

Query: 359 YLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXX---XXXXXXXXXXXXXXRRLPNANEM 415
           YLLQ+ IK+P+AT+ Q +K   QN                            RLP AN++
Sbjct: 363 YLLQDVIKIPLATKEQQRKFNDQNKKDNESDSDADDNNNNNKNKKKRKFKKERLPPANQL 422

Query: 416 PSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVT 475
           PSEKATI+FVPTRHHVEY++QLLK+ GYL+SYIYG L+QHARK+QLYNFR GLTSILVVT
Sbjct: 423 PSEKATILFVPTRHHVEYISQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVT 482

Query: 476 DVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXX 535
           DVAARGVDIP+LANVIN+SLP SSKIFIHRVGRTARAGNRGWA+SIVS            
Sbjct: 483 DVAARGVDIPMLANVINFSLPASSKIFIHRVGRTARAGNRGWAYSIVSESELPYLLDLEL 542

Query: 536 XXGKKILLTPMYESSCQILRKKAESEGNN--NFTDPKVSYTTRMVLGACPRSEIDGMGDL 593
             GKKI+LTPMY+S C+I++ K  +EGN+  +F +PK++YT R++LG+ PR E++G+GDL
Sbjct: 543 FLGKKIMLTPMYDSLCEIMKNKWIAEGNDESSFVNPKIAYTDRLILGSAPRLEVEGLGDL 602

Query: 594 YSNMIKSDFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAE 653
           Y NM++++FEL  +K VA+KAEKLYFRTRT AS ES+KRSKEI+ SGWDEQN+ FGKN E
Sbjct: 603 YKNMMQNNFELKLIKDVAMKAEKLYFRTRTSASPESLKRSKEIIASGWDEQNVLFGKNQE 662

Query: 654 KEKLDFLAKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERM 713
           KEKLDFLAKLQ+R NKETVFEF+RNPDDEMSV MKRRRRQ+APIQRKA+ER+ELL+ E+M
Sbjct: 663 KEKLDFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPIQRKARERKELLQMEKM 722

Query: 714 IGLRHSIEDEILKGEDNEVGYSVPDEVLK-EFEDADVLLEEQEN---IXXXXXXTFRDPT 769
            GL HS+EDEILKG+DNE GYSV ++ LK +F+DAD LL +QEN          +F+DP 
Sbjct: 723 AGLTHSVEDEILKGDDNEAGYSVSEDTLKQQFQDADELLADQENKSKKDKKSKKSFKDPN 782

Query: 770 FYLSHFAPTSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVN 829
           F+LSH+AP  DIQDKQL++++GF NDA+  A+DL NDDKVQVHKQTA VKWDKKRKKYVN
Sbjct: 783 FFLSHYAPAGDIQDKQLELTTGFVNDAAKVAYDLNNDDKVQVHKQTAMVKWDKKRKKYVN 842

Query: 830 TQGLDNKKYIIGESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPTSPS 889
           TQGLDNKKYIIGE GQKI ASFRSGKF +W+K RK+ PLKVGARE+TIPSN+LA+PT+ S
Sbjct: 843 TQGLDNKKYIIGEGGQKIAASFRSGKFDEWAKKRKMKPLKVGARETTIPSNILANPTNGS 902

Query: 890 E----RTVGGKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGY-NGPGMKQEI 944
                 T+ GKFKHK  KAPK+PDKHRDDY  QKKKVE AL  G++V+GY N PGM  E+
Sbjct: 903 HGSQGNTIRGKFKHKQMKAPKMPDKHRDDYHIQKKKVEKALANGIQVRGYGNAPGMSNEL 962

Query: 945 KSVDXXXXXXXXXXXXXXXNARPTKRRK 972
           KS +               NARP+KRRK
Sbjct: 963 KSTEQIMKDRNVKENKRAKNARPSKRRK 990

>Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W
            (REAL)
          Length = 1001

 Score = 1285 bits (3324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/997 (64%), Positives = 761/997 (76%), Gaps = 26/997 (2%)

Query: 2    VDSSKRALPAEDYS-SEDED-AFDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEF 59
            V   KR L  +D S SE+ED AFDIA DIALN                    +VQDVI++
Sbjct: 4    VQKRKRDLEDQDVSGSEEEDTAFDIANDIALNGSDSDSDGSSSGTEADYGLGDVQDVIKY 63

Query: 60   SSDXXXX--------XXXXXXXXXXXXXXAGPIVDSKFPSLELSDDEKKAT-----NESD 106
            SSD                          +G    + FP+LELSDDE  A+     ++ +
Sbjct: 64   SSDEEREGDSKKKANGKNGKKNKSDNKKKSGKKEVAAFPTLELSDDENDASGKTQADDDE 123

Query: 107  DDLNDYFNTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDI 166
            DD+N+YF+TT     KHKKGSF SFGLSK+VL NI +KGFRQPTPIQRKTIPLILQ RDI
Sbjct: 124  DDVNEYFSTTNLEKTKHKKGSFPSFGLSKVVLNNIKRKGFRQPTPIQRKTIPLILQSRDI 183

Query: 167  VGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLR 226
            VGMARTGSGKTAAF+LPM+EKLK+HS KIG RAVILSPSRELA+QT  VFK+F+KG++LR
Sbjct: 184  VGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFAKGTELR 243

Query: 227  SILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMG 286
            S+LLTGGDSLE+QF MMM NPDV+IATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMG
Sbjct: 244  SVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMG 303

Query: 287  FQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFI 346
            FQEQLNELL + P  RQTLLFSATLP+SLVDF KAGL NPVLVRLD ETK+SENLEMLF+
Sbjct: 304  FQEQLNELLASLPARRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDTETKVSENLEMLFL 363

Query: 347  SIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXX-- 404
            S K  +REANLLY+LQE IK+P+AT  Q++KL++ N                        
Sbjct: 364  SSKNADREANLLYILQEVIKIPLATSEQLQKLQKSNNEADSDSDDENDRHKKKRNFKKEK 423

Query: 405  -XXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYN 463
               +++P ANE+PSE+ATI+FVPTRHHVEY++QLL++CGYL+SYIYG L+QHARK+QLYN
Sbjct: 424  FRKQKMPAANELPSERATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKRQLYN 483

Query: 464  FRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
            FRAGLTSILVVTDVAARGVDIP+LANVINY+LPGSSKIF+HRVGRTARAGN+GWA+SIVS
Sbjct: 484  FRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVS 543

Query: 524  XXXXXXXXXXXXXXGKKILLTPMYESSCQILRKKAESEGN--NNFTDPKVSYTTRMVLGA 581
                          GKKILL PMY++    ++K+   EGN    F  PK+SYT R+VLG+
Sbjct: 544  ENELPYLLDLELFLGKKILLAPMYDNLVDSIKKRWIDEGNLEFQFQPPKLSYTKRLVLGS 603

Query: 582  CPRSEIDGMGDLYSNMIKSDFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGW 641
            CPR +++G+GDLY N++ S+F+L      ++KAEKLY+RTRT AS ES+KRSKEI+ SGW
Sbjct: 604  CPRLDVEGLGDLYKNLMTSNFDLQLAMKTSMKAEKLYYRTRTSASPESLKRSKEIIASGW 663

Query: 642  DEQNIYFGKNAEKEKLDFLAKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKA 701
            D QN +FGKN EKEKLDFLAKLQ+R NKETVFEF RNPDDEM+VLMKRRR+Q+APIQRKA
Sbjct: 664  DAQNAFFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVLMKRRRKQLAPIQRKA 723

Query: 702  KERQELLEKERMIGLRHSIEDEILKGEDNEVGYSVPDEVLKEFEDADVLLEEQEN--IXX 759
             ER++LLEKERM GL HSIE+EILKG+D E GY+V +E LKEFEDAD LLE QEN     
Sbjct: 724  SERRKLLEKERMAGLSHSIENEILKGDDGETGYTVSEEALKEFEDADQLLEAQENDSKKK 783

Query: 760  XXXXTFRDPTFYLSHFAPTSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVK 819
                TF+DPTF+LSH+AP  +IQDKQLQI+SGF NDA++AA+DL  DDKVQVHKQTATVK
Sbjct: 784  KKPKTFKDPTFFLSHYAPAGEIQDKQLQIASGFANDAAHAAYDLNTDDKVQVHKQTATVK 843

Query: 820  WDKKRKKYVNTQGLDNKKYIIGESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPS 879
            WDKKRKKYVNTQG+DNKKYIIGESGQKI ASFRSG+F DWSKAR + PLK G+RES+IPS
Sbjct: 844  WDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKAGSRESSIPS 903

Query: 880  NLLADPT---SPSERTVGGKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGY- 935
            NLLADP+     + RT  GKFKHK  KAPK+PDKHRD+Y  QKKKVE AL+ GV VKG+ 
Sbjct: 904  NLLADPSQGPGSNGRTARGKFKHKQMKAPKMPDKHRDNYYSQKKKVEKALQSGVNVKGHN 963

Query: 936  NGPGMKQEIKSVDXXXXXXXXXXXXXXXNARPTKRRK 972
            N PG+  E+KS +               NARP+K+RK
Sbjct: 964  NAPGLSSELKSTEQIRKDRVMAEKKRAKNARPSKKRK 1000

>Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {ON}
           complement(27093..30026) [2934 nt, 978 aa]
          Length = 977

 Score = 1268 bits (3281), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 639/985 (64%), Positives = 757/985 (76%), Gaps = 24/985 (2%)

Query: 1   MVDSSKRALPAEDYSSEDEDAFDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEFS 60
           ++   KR +   + SS+D+D FDI  +I LN                  + EVQD+++FS
Sbjct: 3   IISKRKRHVEDSNSSSDDDDGFDITSNIGLNTADSSDESESSGDD----EEEVQDIVDFS 58

Query: 61  SDXXXXXXXXXXXXXXXXXXAGPIVDSKFPSLELSDDE----KKATNESDDDLNDYFNTT 116
            +                       ++ FPSLE+SDDE    K    + DDDLNDYF+  
Sbjct: 59  DEEDTKKKPKSSNKTLTD-------NNSFPSLEISDDEDSNNKGDHEDDDDDLNDYFSIN 111

Query: 117 ADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGK 176
               +KHKKGSF SFG SKL+L N+ KKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGK
Sbjct: 112 NSEKSKHKKGSFPSFGFSKLILSNVHKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGK 171

Query: 177 TAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSL 236
           TAAFVLPMIEKLK+HS+KIG RAVILSPSRELA+QTHRVFKEFSKG+ LRS+LLTGGDSL
Sbjct: 172 TAAFVLPMIEKLKSHSSKIGARAVILSPSRELALQTHRVFKEFSKGTHLRSVLLTGGDSL 231

Query: 237 EDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLV 296
           EDQF MMM NPDV++ATPGRFLHLKVEM+LDLK+VEYVVFDEADRLFEMGFQEQLNELL 
Sbjct: 232 EDQFSMMMSNPDVIVATPGRFLHLKVEMSLDLKTVEYVVFDEADRLFEMGFQEQLNELLA 291

Query: 297 AFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREAN 356
           A P NRQTLLFSATLPSSLVDFAKAGL+NPVLVRLDAETKISENLE+LF+S K +ERE N
Sbjct: 292 ALPMNRQTLLFSATLPSSLVDFAKAGLTNPVLVRLDAETKISENLEILFLSTKNEERENN 351

Query: 357 LLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPN----- 411
           LLYLLQ+ IK+P+ T+ QIKKL   N                         +        
Sbjct: 352 LLYLLQDVIKIPLGTDDQIKKLSDFNKSLSDSDSEDEDNKGKQNSRKSKKGKFQKLKVSA 411

Query: 412 ANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSI 471
           +NE+P+EK+TIVF PTRHHVEY+TQLLK+ G+LVSY+YG L+QHARK+QL NFRAGLTSI
Sbjct: 412 SNELPTEKSTIVFAPTRHHVEYITQLLKDSGFLVSYLYGTLDQHARKRQLLNFRAGLTSI 471

Query: 472 LVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXX 531
           LVVTDVAARGVDIP+LANVINYSLP SSKIFIHRVGRTARAGNRGWA+SIVS        
Sbjct: 472 LVVTDVAARGVDIPMLANVINYSLPASSKIFIHRVGRTARAGNRGWAYSIVSETELPYML 531

Query: 532 XXXXXXGKKILLTPMYESSCQILRKKAESEGN--NNFTDPKVSYTTRMVLGACPRSEIDG 589
                 GKKILLT MYE+SC++++ K  ++GN  ++F DPK+SYT R+VLG+ PR +I+ 
Sbjct: 532 DLELFLGKKILLTSMYEASCKLMKSKWIADGNTESSFEDPKISYTNRLVLGSAPRYDIES 591

Query: 590 MGDLYSNMIKSDFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFG 649
           +GDLY N+I+S+F+L   K V+LKAEKLY RTRT AS ES+KRSKE++ SGWDEQNI FG
Sbjct: 592 VGDLYKNIIESNFDLQMAKKVSLKAEKLYCRTRTAASPESIKRSKEVIASGWDEQNIRFG 651

Query: 650 KNAEKEKLDFLAKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLE 709
           +N EKEKL+FLAK Q+R NKETVFEF +NP+D+ ++LM++RR+QIAPIQRKA++RQELL+
Sbjct: 652 RNLEKEKLNFLAKFQNRRNKETVFEFGKNPNDDTAILMQKRRKQIAPIQRKARKRQELLD 711

Query: 710 KERMIGLRHSIEDEILKGEDNEVGYSVPDEVLKEFEDADVLLEEQENIXXXXXXTFRDPT 769
           KER+ GL H IEDEILKGED+E GYSVP+E LK FEDAD +LEEQE+       TFRDP 
Sbjct: 712 KERVAGLTHKIEDEILKGEDHEAGYSVPEEALKSFEDADKILEEQESSRKKKSKTFRDPN 771

Query: 770 FYLSHFAPTSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVN 829
           F++SH+AP  DIQDKQLQI+SGFTNDA+ AA+DL +DDKVQVHKQTATVKWDKKRKKYVN
Sbjct: 772 FFISHYAPAGDIQDKQLQITSGFTNDAAQAAYDLNDDDKVQVHKQTATVKWDKKRKKYVN 831

Query: 830 TQGLDNKKYIIGESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPT--S 887
            QG+DNKKYIIGESGQKIPASF+SGKF +WSK+R I  +K GARE++IP+NLL+DPT  S
Sbjct: 832 MQGIDNKKYIIGESGQKIPASFKSGKFAEWSKSRNIKGIKTGARETSIPTNLLSDPTTDS 891

Query: 888 PSERTVGGKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGYNGPGMKQEIKSV 947
            S+R  GG+FKHK  KAP+LPDK RDDY  QKKKV++A+ERGV VKG+ G     E+K+ 
Sbjct: 892 GSQRGPGGRFKHKQNKAPRLPDKFRDDYQSQKKKVQSAIERGVSVKGFGGSSGNTELKTT 951

Query: 948 DXXXXXXXXXXXXXXXNARPTKRRK 972
                           NARPTK+RK
Sbjct: 952 AQIRKERMAKEKKRQKNARPTKKRK 976

>KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON} Anc_3.159
            YDL031W
          Length = 1001

 Score = 1264 bits (3270), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/985 (64%), Positives = 751/985 (76%), Gaps = 32/985 (3%)

Query: 10   PAEDYSSEDED--AFDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEFSSDXXXXX 67
            P    S+E+ED    DIAGDIAL +                 Q ++ D+I++S D     
Sbjct: 26   PGTGSSAEEEDDALVDIAGDIALESSDEEEEED--------VQGDIADIIDYS-DEEPAE 76

Query: 68   XXXXXXXXXXXXXAGPIVDSKFPSLELSDDE--KKATNESDDDLNDYFNTTADA-AAKHK 124
                              ++ FPSLELSDDE  K A + SDDD+N YF+T   A   K K
Sbjct: 77   AKGKQQKQKQKPSKKSPKENAFPSLELSDDESSKAAGDASDDDVNAYFSTNNQAEKQKFK 136

Query: 125  KGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPM 184
            KGSFASFGLSK +L N+++KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAFVLPM
Sbjct: 137  KGSFASFGLSKAILSNVTRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPM 196

Query: 185  IEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMM 244
            IEKLKTHS+KIGVRA+ILSPSRELA+QTH VFK+FSKG+ LRS+LLTGGDSLE+QFGMMM
Sbjct: 197  IEKLKTHSSKIGVRAIILSPSRELALQTHNVFKDFSKGTHLRSVLLTGGDSLEEQFGMMM 256

Query: 245  GNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQT 304
             NPDVVIATPGRFLHLKVEMNL LK+VEY VFDEADRLFEMGFQEQLNELL A P++RQT
Sbjct: 257  SNPDVVIATPGRFLHLKVEMNLVLKTVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQT 316

Query: 305  LLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEA 364
            LLFSATLPSSLV+FAKAGL+NPVLVRLDAE+KISENL+MLF+SIK DEREANLLYLLQ  
Sbjct: 317  LLFSATLPSSLVEFAKAGLTNPVLVRLDAESKISENLQMLFLSIKNDEREANLLYLLQNV 376

Query: 365  IKMPVATESQIKKLKQQNXXXXXXXXXXXXXXX--------XXXXXXXXXRRLPNANEMP 416
            IK+P+AT  Q+KKL+  +                                +RLP ANE+P
Sbjct: 377  IKIPLATPEQLKKLRDSDAKFSESESEDESNEKRGGKRDFKKNGKKKFVKQRLPAANELP 436

Query: 417  SEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTD 476
            SE AT+VFVPTRHHVEY++Q+LK+CGYLVSYIYG+L+Q+ARK QLYNFR GLTSILVVTD
Sbjct: 437  SENATVVFVPTRHHVEYISQVLKDCGYLVSYIYGSLDQNARKSQLYNFRLGLTSILVVTD 496

Query: 477  VAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXX 536
            VAARGVDIP+LANVINYSLP SSKIFIHRVGRTARAGN+GWA++IVS             
Sbjct: 497  VAARGVDIPMLANVINYSLPSSSKIFIHRVGRTARAGNKGWAYTIVSESELPYLLDLELF 556

Query: 537  XGKKILLTPMYESSCQILRKKAESEGNN--NFTDPKVSYTTRMVLGACPRSEIDGMGDLY 594
              KK+LLTPM E+   IL++K   +GN+  +F  P VSYT R+VLG+CPR +++ MGDL+
Sbjct: 557  LSKKVLLTPMLEAKNAILKQKWIDQGNDEMSFKPPAVSYTDRIVLGSCPRLDLESMGDLF 616

Query: 595  SNMIKSDFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEK 654
             N+++++F+L+ +K  +LKAEKLYFRTRT AS ES+KRSKE++ SGWDEQNI FG N EK
Sbjct: 617  KNILENNFDLSLMKATSLKAEKLYFRTRTHASLESLKRSKEVIASGWDEQNIIFGSNVEK 676

Query: 655  EKLDFLAKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMI 714
            EK++FLAKLQ+R NKETVFEF+RNPDDEMSV MKRRRRQ+AP+Q+KAKER+ELLEKER  
Sbjct: 677  EKINFLAKLQNRRNKETVFEFSRNPDDEMSVFMKRRRRQLAPVQKKAKERRELLEKERRS 736

Query: 715  GLRHSIEDEILKGEDN---EVGYSVPDEVLKEFEDADVLLEEQENIXXXXXXTFRDPTFY 771
            GL HSIEDEI    +N   E GY+V +E LK+FEDAD LL++Q          ++DP F+
Sbjct: 737  GLSHSIEDEIFNQNNNTEMETGYTVSEEALKQFEDADELLQKQSE-KKTKPKNYKDPNFF 795

Query: 772  LSHFAPTSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQ 831
            LSH+AP +DIQDKQLQ++SGFTNDA+ AA+DL +DDKVQVHKQTATVKWDKKRKKYVN Q
Sbjct: 796  LSHYAPAADIQDKQLQVTSGFTNDAAQAAYDLNDDDKVQVHKQTATVKWDKKRKKYVNMQ 855

Query: 832  GLDNKKYIIGESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPTSPS-- 889
            G+DNKKYIIGESGQKI ASFRSGKF +WSKAR I PLKVGA+E +I ++LL DPT  S  
Sbjct: 856  GIDNKKYIIGESGQKIAASFRSGKFDEWSKARHIKPLKVGAKEDSIETHLLRDPTGRSNI 915

Query: 890  --ERTVGGKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGYNGPGMKQEIKSV 947
               RT  GK+KHK  KAPKLPDKHRD+Y  QKKK+ +A+ERG  VKG+NGPG + E+KS 
Sbjct: 916  SGNRTASGKYKHKQDKAPKLPDKHRDNYHSQKKKIASAMERGTYVKGFNGPGTQSELKST 975

Query: 948  DXXXXXXXXXXXXXXXNARPTKRRK 972
                            NARP K+RK
Sbjct: 976  AQIRKGRLQAEKKKAKNARPNKKRK 1000

>TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON} 
          Length = 981

 Score = 1245 bits (3221), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/973 (63%), Positives = 727/973 (74%), Gaps = 28/973 (2%)

Query: 18  DEDAFDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEFSSDXXXXXXXXXXXXXXX 77
           +++  DIA  IA NA                    VQD+IE+S +               
Sbjct: 20  EDNGVDIAKSIAFNASGSDSSDDSDEEDDFKVDDGVQDLIEYSDEETTEKEVKKTKK--- 76

Query: 78  XXXAGPIVDSKFPSLELSDDE------KKATNESDDDLNDYFNTTADAAAKHKKGSFASF 131
                    + FP LE+SDDE        A N+  DD+NDYF+T     +KHKKGSF SF
Sbjct: 77  -------ASNPFPLLEMSDDEDDKNSKNSAFNDDADDVNDYFSTNMQDKSKHKKGSFPSF 129

Query: 132 GLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTH 191
           GLSKL+L NI+KKGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF+LPMIEKLKTH
Sbjct: 130 GLSKLILSNINKKGFRQPTPIQRKTIPLILQRRDIVGMARTGSGKTAAFILPMIEKLKTH 189

Query: 192 SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVI 251
           S KIG RAVILSPSRELA+QTH+VFK+FS+GS LRS+LLTGGDSLE+QF MMM NPDV++
Sbjct: 190 SGKIGARAVILSPSRELAMQTHKVFKDFSRGSQLRSVLLTGGDSLEEQFSMMMSNPDVIV 249

Query: 252 ATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATL 311
           ATPGRF+HLKVEM LDLK+VEYVVFDEADRLFEMGFQEQLNELL + P NRQTLLFSATL
Sbjct: 250 ATPGRFMHLKVEMGLDLKTVEYVVFDEADRLFEMGFQEQLNELLASLPMNRQTLLFSATL 309

Query: 312 PSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVAT 371
           P+SLVDFAKAGL+NPVLVRLDAE+KISENL++ F S K +EREA LLY+LQ+ I + + T
Sbjct: 310 PNSLVDFAKAGLTNPVLVRLDAESKISENLQLAFFSTKNEEREATLLYILQDVIDLQIGT 369

Query: 372 ESQIKKLKQQNXXX------XXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFV 425
           E +IKKL   N                               +LP+ANE+PSEKATIVFV
Sbjct: 370 EEEIKKLTASNKRSDEIDSDNEREQADRKLNKKKKFEKFIKPKLPSANELPSEKATIVFV 429

Query: 426 PTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIP 485
           PTRHHVEY++ LLK+CGYLVSY+YG L+QHARK QL+NFRAGLTSILVVTDVAARGVDIP
Sbjct: 430 PTRHHVEYISNLLKDCGYLVSYLYGTLDQHARKHQLFNFRAGLTSILVVTDVAARGVDIP 489

Query: 486 LLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKILLTP 545
           +LANVINYSLP SSKIF+HRVGRTARAGN+GWA+SI S              GKKILLT 
Sbjct: 490 MLANVINYSLPASSKIFVHRVGRTARAGNKGWAYSIASETELPYLLDLELFLGKKILLTQ 549

Query: 546 MYESSCQILRKKAESEGNNNFT--DPKVSYTTRMVLGACPRSEIDGMGDLYSNMIKSDFE 603
           MYE++C + + K  + GN  +T   PK SYT RM+LG+CPR E++ +GDLY N++ + F+
Sbjct: 550 MYEATCSLAKNKWIAAGNEEYTFQPPKPSYTDRMILGSCPRLELENIGDLYKNIMSASFD 609

Query: 604 LNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFLAKL 663
           L   K  +LKAEKLYFRTRT AS ES+KR KE++ SGWDEQ+I FGKN EKEKLDFL+K 
Sbjct: 610 LQMAKKTSLKAEKLYFRTRTAASPESIKRGKELIASGWDEQHIMFGKNVEKEKLDFLSKF 669

Query: 664 QHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHSIEDE 723
           Q+RNNKETVFEF RNP D  +VLM RRRRQ+APIQRKA ER++LLEKER+ GL H++EDE
Sbjct: 670 QNRNNKETVFEFGRNPTDATAVLMNRRRRQLAPIQRKAVERRKLLEKERLAGLSHALEDE 729

Query: 724 ILKGEDNEVGYSVPDEVLKEFEDADVLLEEQENIXXXXXXTFRDPTFYLSHFAPTSDIQD 783
           ILKGED+E GY++  E L  FEDAD LL+EQE          +DP F+LSH+AP  DIQD
Sbjct: 730 ILKGEDHESGYTISKEALAAFEDADKLLQEQEKKKRKPKTY-KDPQFFLSHYAPAKDIQD 788

Query: 784 KQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKYIIGES 843
           KQL ++SGFTNDA+ AA+DL NDDKVQVHKQTA +KWDK RKKYVN  GLDNKKYIIGE 
Sbjct: 789 KQLNLTSGFTNDAAQAAYDLNNDDKVQVHKQTANIKWDKGRKKYVNINGLDNKKYIIGEG 848

Query: 844 GQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPTSPSE--RTVGGKFKHKT 901
           GQKIPASF+SG+F +WSKAR I PLK G RE +IP+NLLAD T PS+  RT GG+FKHK 
Sbjct: 849 GQKIPASFKSGRFDEWSKARHIKPLKAGVREDSIPTNLLADVTGPSDGSRTFGGRFKHKQ 908

Query: 902 QKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGYNG-PGMKQEIKSVDXXXXXXXXXXXX 960
            KAP+LPDKHRDDY  QKKKV+ ALERGV+VKGYN    +K E+K+V             
Sbjct: 909 NKAPRLPDKHRDDYESQKKKVQNALERGVQVKGYNNRNSVKSELKTVAQIRKERMVNENK 968

Query: 961 XXXNARPTKRRKH 973
              NARP+K+RK+
Sbjct: 969 QKKNARPSKKRKY 981

>ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {ON}
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis putative ATP-dependent RNA helicase of the
           DEAD- box protein family
          Length = 979

 Score = 1206 bits (3120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 615/988 (62%), Positives = 733/988 (74%), Gaps = 26/988 (2%)

Query: 1   MVDSSKRALPAEDYSSEDEDAFDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEFS 60
           M  + KR L  E+ +SE E+ FDIAG+IAL +                +Q    DVI++S
Sbjct: 1   MGSTLKRKLEDEESNSEGEEGFDIAGNIALTSSESEGEDGSDEDSEENYQ----DVIDYS 56

Query: 61  SDXXXXXXXXXXXXXXXXXXAGPIVDSKFPSLELSDDE------KKATNESDDDLNDYFN 114
            D                          FP LELSD+E      KK  +   DD+++YF 
Sbjct: 57  DDDKEKEAGKKKKEPVKKSDK-----HDFPILELSDNEEDADAKKKKEDGDADDISEYFT 111

Query: 115 TTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGS 174
           T    + KHKKGSF SFG SK +L NI+KKGFRQPTPIQRKTIPLILQ RDIVGMARTGS
Sbjct: 112 TNNSESKKHKKGSFPSFGFSKFILNNINKKGFRQPTPIQRKTIPLILQNRDIVGMARTGS 171

Query: 175 GKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234
           GKTAAFVLPMIEKLK HS+KIG RAVILSPSRE+A+QT++VFKEFSKGSDLRS+LLTGGD
Sbjct: 172 GKTAAFVLPMIEKLKAHSSKIGARAVILSPSREIAMQTYKVFKEFSKGSDLRSVLLTGGD 231

Query: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294
           SLEDQFGMMM NPDVV+ATPGRFLHLKVEMNL+LKSVEY VFDEADRLFEMGF EQLNEL
Sbjct: 232 SLEDQFGMMMSNPDVVVATPGRFLHLKVEMNLNLKSVEYAVFDEADRLFEMGFAEQLNEL 291

Query: 295 LVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDERE 354
           L + P  RQTLLFSATLP++LVDFAKAGL+NPVLVRLDAE+KISENLEMLF+S K DERE
Sbjct: 292 LASLPEKRQTLLFSATLPNTLVDFAKAGLTNPVLVRLDAESKISENLEMLFVSTKHDERE 351

Query: 355 ANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXR-----RL 409
           ANL YLLQE IK+P+ATE Q   L + N                              +L
Sbjct: 352 ANLFYLLQEVIKIPLATEEQKMILGEGNKALSDSEDSDAENGKKDRRKKGKKNKAKRPKL 411

Query: 410 PNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLT 469
           P+ANE+PSEKATIVFVPTRHHVEY++QLLK CGYLVSYIYG L+QHAR++QLYNFRAGLT
Sbjct: 412 PSANELPSEKATIVFVPTRHHVEYISQLLKACGYLVSYIYGTLDQHARRRQLYNFRAGLT 471

Query: 470 SILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXX 529
           SILVVTDVAARGVDIP+LANVIN+++P SSKIF+HRVGRTARAGNRGWA+SIVS      
Sbjct: 472 SILVVTDVAARGVDIPMLANVINFTMPSSSKIFVHRVGRTARAGNRGWAYSIVSESELPY 531

Query: 530 XXXXXXXXGKKILLTPMYESSCQILRKKAESEGNNN--FTDPKVSYTTRMVLGACPRSEI 587
                   GKKILL PMYE++C +L++K  +EGN+   F  PKVSYT RMVLG+CPR E+
Sbjct: 532 LLDLELFLGKKILLAPMYEATCNLLKEKWVNEGNDEFRFQPPKVSYTDRMVLGSCPRIEL 591

Query: 588 DGMGDLYSNMIKSDFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIY 647
           + MGDLY N++ S+++L + +GV++KAE +Y RTR PASAESMKR+K+++ SGWDEQNI 
Sbjct: 592 ESMGDLYKNLMDSNYDLGSTRGVSIKAEIMYMRTRQPASAESMKRAKQMIISGWDEQNIL 651

Query: 648 FGKNAEKEKLDFLAKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQEL 707
           FGKN E EK  FLAKLQ R NKETVFEFARNPDD+MSVLMK+RR+Q+ P+Q +AK+RQEL
Sbjct: 652 FGKNMEAEKNKFLAKLQDRRNKETVFEFARNPDDKMSVLMKKRRQQLEPVQLRAKQRQEL 711

Query: 708 LEKERMIGLRHSIEDEILKGEDNEVGYSVPDEVLKEFEDADVLLEEQEN---IXXXXXXT 764
           +EKE++ GL HS+EDE+L     EVGYSVPD VL+EFEDAD +LE+QE           +
Sbjct: 712 MEKEKLAGLTHSLEDEVLDKYKGEVGYSVPDAVLEEFEDADQVLEDQETEGKKQKQKSKS 771

Query: 765 FRDPTFYLSHFAPTSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQTATVKWDKKR 824
           F+D  F++SH+AP   +QD QL ISSGFT DA+ A++DL +DDK+QVHKQTATVKWDKK+
Sbjct: 772 FKDSNFFMSHYAPAQSVQDSQLNISSGFTTDAAQASYDLNDDDKIQVHKQTATVKWDKKK 831

Query: 825 KKYVNTQGLDNKKYIIGESGQKIPASFRSGKFQDWSKARKIAPLKVGARESTIPSNLLAD 884
           KKYVN QG DN +YI  ESGQKIPAS+RSGKF +WSK RK+   KVG+RES++ +NLL D
Sbjct: 832 KKYVNPQGADNVRYITSESGQKIPASYRSGKFDEWSKKRKLKMPKVGSRESSMATNLLQD 891

Query: 885 PTSPSERTVGGKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGY-NGPGMKQE 943
           PT  +  +   +F HK  KAPK+PDK+RDDY  QK KV  ALE+G+ VKG+ N PGM  E
Sbjct: 892 PTRGNPSSNNRRFMHKQVKAPKVPDKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNE 951

Query: 944 IKSVDXXXXXXXXXXXXXXXNARPTKRR 971
           ++S D               NAR  K+R
Sbjct: 952 LRSADQIRKQRVVKDKRRAKNARVGKKR 979

>TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {ON}
           Anc_3.159 YDL031W
          Length = 968

 Score = 1203 bits (3113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 604/968 (62%), Positives = 726/968 (75%), Gaps = 30/968 (3%)

Query: 16  SEDEDAFDIAGDIALNAXXXXXXXXXXXXXXXGFQAEVQDVIEFSSDXXXXXXXXXXXXX 75
           S  E+ +DI  DIALN+                 +   QD+IE+S +             
Sbjct: 21  SGSEEDYDIVNDIALNSSDSDEDDSSEDS-----EGGEQDIIEYSDEEEEHQHEKKKSAP 75

Query: 76  XXXXXAGPIVDSKFPSLELSDDEKKATNESDDDLNDYFNTTADAAAKHKKGSFASFGLSK 135
                     D  FP LE S DE +   +    +N+YF+TTA    KHKKGSF SFGLSK
Sbjct: 76  K---------DKSFPKLEASGDEAEDDADD---VNEYFSTTAQTNKKHKKGSFPSFGLSK 123

Query: 136 LVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKI 195
           L+L NIS+KGF QPTPIQRKTIPLILQ RDIVG+ARTGSGKTAAF+LPMIEKLK+HS+K+
Sbjct: 124 LILNNISRKGFHQPTPIQRKTIPLILQSRDIVGLARTGSGKTAAFILPMIEKLKSHSSKV 183

Query: 196 GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPG 255
           G RAVILSPSRELA+QTH+VFK+FS+G+ LRS+LLTGGDSLE+QFGMMM NPDV++ATPG
Sbjct: 184 GARAVILSPSRELAMQTHKVFKDFSRGTHLRSVLLTGGDSLEEQFGMMMSNPDVIVATPG 243

Query: 256 RFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSL 315
           RFLHLKVEMNLDLKS+EY VFDE+DRLFEMGF+EQLNELL A P+NRQTLLFSATLP+SL
Sbjct: 244 RFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFEEQLNELLAALPSNRQTLLFSATLPNSL 303

Query: 316 VDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQI 375
           VDFAKAGL+NPVLVRLD E+KISENLEMLF+S K DEREA LLYL+QE I++P+ATE QI
Sbjct: 304 VDFAKAGLTNPVLVRLDQESKISENLEMLFLSTKHDEREAALLYLIQEVIQIPLATEEQI 363

Query: 376 KKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXR--RLPNANEMPSEKATIVFVPTRHHVEY 433
           K +K ++                        +  R+P AN++PSEK+TI+FVPTRHHVEY
Sbjct: 364 KLIKDKSPDSDEESDDDNGKRSHNKHKKEKFKKVRMPAANQLPSEKSTILFVPTRHHVEY 423

Query: 434 VTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINY 493
           +  LLKNCGYLVSYIYG+L+Q AR +QLYNFRAGLTSILVVTDVAARGVDIP+LANVIN+
Sbjct: 424 IANLLKNCGYLVSYIYGSLDQRARNRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINF 483

Query: 494 SLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKILLTPMYESSCQI 553
           S P SSKIF+HRVGRTARAGNRGWA+SI+S              GKKIL TPMYE++  +
Sbjct: 484 SFPSSSKIFVHRVGRTARAGNRGWAYSIISESELPYLLDLELFLGKKILTTPMYEAATDL 543

Query: 554 LRKKAESEGNNN--FTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMIKSDFELNTVKGVA 611
           L K+   EG     F  PK SYT R+VLG+CPR +ID MGDLY N++ S FEL T++GVA
Sbjct: 544 LEKRWVEEGKEKILFKAPKPSYTNRLVLGSCPRLDIDSMGDLYKNLM-SSFELETLRGVA 602

Query: 612 LKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFLAKLQHRNNKET 671
            KAEKLY RTRT AS ES+KRS+E++ SGWDEQN+ FGKN EKEKLDFLAKLQ R NKET
Sbjct: 603 KKAEKLYLRTRTAASVESVKRSRELMTSGWDEQNVMFGKNLEKEKLDFLAKLQDRTNKET 662

Query: 672 VFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHSIEDEILKGEDNE 731
           VFEFARN DDE S+LMK+RR Q+API  KAK+R+ELLE ++  G  H++EDE+L   DNE
Sbjct: 663 VFEFARNADDETSMLMKKRRFQVAPITEKAKKRKELLELQKAAGFSHAMEDELL--NDNE 720

Query: 732 -VGYSVPDEVLKEFEDADVLLEEQENIXXXXXXTFRDPTFYLSHFAPTSDIQDKQLQISS 790
            +  SVP+EVL+EFEDAD LLE+QE +      +FRDP F+LSH+AP   + + +L ++S
Sbjct: 721 LIKESVPEEVLQEFEDADKLLEDQEKLGRKKSKSFRDPNFFLSHYAPQGGLHENELNLTS 780

Query: 791 GFTNDASNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKYIIGESGQKIPAS 850
           GFT DA+ AA D+  DDKVQVHKQ ATVKWD K+KKY+N+QG DNKKYI+GESGQKIPAS
Sbjct: 781 GFTTDAAQAACDINGDDKVQVHKQNATVKWDSKKKKYINSQGADNKKYIVGESGQKIPAS 840

Query: 851 FRSGKFQDWSKARKIAPLKVGARESTIPSNLLADPT----SPSERTVGGKFKHKTQKAPK 906
           FRSGK+ +WSKAR + P+KVGARES   +N+L +P     +  +RTVGGKFKHK  KAPK
Sbjct: 841 FRSGKYAEWSKARNLQPIKVGARESPTAANMLRNPAQNHPTDGQRTVGGKFKHKQVKAPK 900

Query: 907 LPDKHRDDYAFQKKKVEAALERGVRVKGYNGPGM-KQEIKSVDXXXXXXXXXXXXXXXNA 965
           LPDKHRDDY  QKKKV+ AL++G+ VKGYN  G  K E++S+                NA
Sbjct: 901 LPDKHRDDYHKQKKKVKEALDKGINVKGYNTRGAPKNELQSIAQIRKQRQTSEKKHAKNA 960

Query: 966 RPTKRRKH 973
           RP+K+RK+
Sbjct: 961 RPSKKRKY 968

>TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.159
           YDL031W
          Length = 929

 Score =  936 bits (2420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/933 (54%), Positives = 627/933 (67%), Gaps = 52/933 (5%)

Query: 51  AEVQDVIEFSSDXXXXXXXXXXXXXXXXXXAGPIVDSKFPSLELSDDEKKATNESDDDLN 110
            EVQD IE+S +                  +     + FP L    D        DDD+N
Sbjct: 38  TEVQDEIEYSDNQEEEVKEDKRTDKENNTKS----KNDFPQL----DGNVEVESDDDDIN 89

Query: 111 DYFNTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMA 170
           DYF TT     K KKGSFASFG ++ ++ NI+KKG++QPTPIQRKTIPLILQKRDIVGMA
Sbjct: 90  DYFATTHLDTKKFKKGSFASFGFNRFIMNNINKKGYKQPTPIQRKTIPLILQKRDIVGMA 149

Query: 171 RTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILL 230
           RTGSGKTAAF+LPMIEKLKTHS+KIGVR VILSPSRE+AIQTHRVFKEFSK ++LRS+LL
Sbjct: 150 RTGSGKTAAFLLPMIEKLKTHSSKIGVRGVILSPSREIAIQTHRVFKEFSKNTELRSVLL 209

Query: 231 TGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQ 290
           TGGDSLEDQFGMMM NPDVVIATPGRFLHLKVEM LDLKSVEY+VFDEADRLFEMGF+EQ
Sbjct: 210 TGGDSLEDQFGMMMSNPDVVIATPGRFLHLKVEMKLDLKSVEYIVFDEADRLFEMGFEEQ 269

Query: 291 LNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           LNELL A P NRQ+LLFSATLP+SLV+FAKAGL NPVLV+LD E+KIS+NLEMLF+S KK
Sbjct: 270 LNELLAALPDNRQSLLFSATLPNSLVEFAKAGLKNPVLVKLDQESKISDNLEMLFLSCKK 329

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
           +ERE+NLL+LLQ+ I +PVA+  ++K+ +  +                        +   
Sbjct: 330 EERESNLLFLLQDVIGVPVASTEEMKRFQTDSREVEEKEEKEKEKGKEKEKRAKYYK--- 386

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
            ++E+P E+ATI+FVPTRHHVEY++QLL  CGYLVSY+YG L+QHAR+ QL  F  G+T 
Sbjct: 387 -SDEIPHEQATIIFVPTRHHVEYISQLLMKCGYLVSYLYGTLDQHARRNQLRQFCFGITR 445

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXX 530
           ILVVTDVAARGVDIPLL NVINYSLPGSSKIF+HRVGRTARAGNRGWA+SIVS       
Sbjct: 446 ILVVTDVAARGVDIPLLPNVINYSLPGSSKIFVHRVGRTARAGNRGWAYSIVSESELPYL 505

Query: 531 XXXXXXXGKKILLTPMYESSCQILRKKAESEGNNNFTDPKVSYTTRMVLGACPRSEIDGM 590
                  GKK++ T M E                  +  K+SY   MVLG+ PR +++  
Sbjct: 506 VELGTFLGKKVITTGMVEKL--------------GVSFDKISYNKWMVLGSGPRVDVESF 551

Query: 591 GDLYSNMIKSDFELNTVKGVALKAEKLYFRTRTPASAESMKRSKEILRSGWDEQNIYFGK 650
           GDLY N+   +F+L   K    KAEKLY RTR  AS +S+KRSKE++   WD QN+ FG+
Sbjct: 552 GDLYKNVYDQEFDLQMSKKTCEKAEKLYLRTRGGASNDSVKRSKELILQKWDGQNVKFGQ 611

Query: 651 NAEKEKLDFLAKLQHRNNKETVFEFARNPDDEMSVLMKRRRRQIAPIQRKAKERQELLEK 710
           + E+ KL+ L K   R NKETVFEF +N +DEMS LM RR + +  I+RKAK R+E+ E+
Sbjct: 612 DLERAKLELLNKFALRKNKETVFEFGKNGEDEMSTLMNRRWKVVKGIERKAKRRREMKEE 671

Query: 711 ERMIGLRHSIEDEILKGEDNEVGYSVPDEVLKE-------FEDADVLLEEQENIXXXXXX 763
           E          +E L           P + L +       FED D +L  Q         
Sbjct: 672 EEGGVEEELQFEEELGSGSGPGPGQGPGQDLVDAGNYNGVFEDGDAILNGQ----TKKRK 727

Query: 764 TFRDPTFYLSHFAPTSDIQDKQLQISSGFTNDASNAAFDLANDDKVQVHKQ-TATVKWDK 822
           TF+D  F+LSH+A    ++++  ++  GF N AS A++DL ND+K+QVHKQ +ATVKWD+
Sbjct: 728 TFKDERFFLSHYADPKKVENE--EVVDGFINAASEASYDLNNDEKIQVHKQSSATVKWDR 785

Query: 823 KRKKYVNTQGLDNKKYIIGESGQKIPASFRSGKFQDWSKARKIAP---LKVGARESTIPS 879
           KRKKYVN QG+DNKKYIIGESG+KIPA+FRSGK+++W+KAR I     ++VGARES    
Sbjct: 786 KRKKYVNLQGIDNKKYIIGESGRKIPATFRSGKYEEWAKARNINTRNVMRVGARESE--- 842

Query: 880 NLLADPTSPSERTVGGKFKHKTQKAPKLPDKHRDDYAFQKKKVEAALERGVRVKGYNGPG 939
                         GG+FKHK  K PK+PDK+RDDY  QK+K E A+ERGV +KG    G
Sbjct: 843 ---GSVVGGGRGGGGGRFKHKLDKKPKMPDKYRDDYKKQKEKNERAVERGV-MKGKR--G 896

Query: 940 MKQEIKSVDXXXXXXXXXXXXXXXNARPTKRRK 972
            K E+K+V                N RP + R+
Sbjct: 897 YKDELKNVAEIRKNRVEKEKRRAKNGRPGRERR 929

>TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {ON}
           Anc_5.208 YLL008W
          Length = 740

 Score =  249 bits (637), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 158/436 (36%), Positives = 235/436 (53%), Gaps = 59/436 (13%)

Query: 93  ELSDDEKKATNESDDDLNDYFNTTADA--AAKHKKGSFASFGLSKLVLINISKKGFRQPT 150
           E S+DE     +S +++  ++   A++  A K     F S  LS+ VL  +   G+ +P+
Sbjct: 189 EHSEDE-----DSPEEMAKFYAPEAESEQATKQVHNDFNSLSLSRPVLKGLGDLGYTRPS 243

Query: 151 PIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIG-VRAVILSPSRELA 209
           PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    AKI   R ++L+P+RELA
Sbjct: 244 PIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKIASTRVIVLTPTRELA 303

Query: 210 IQTHRVFKEFSK-GSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLD 267
           IQ   V K+  K  S L   L  GG +L  Q   +   PD+V+ATPGRF+ H++   + +
Sbjct: 304 IQVSDVAKKLGKYVSGLTFGLAVGGLNLRQQEQSLKARPDIVVATPGRFIDHIRNSASFN 363

Query: 268 LKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPV 327
           + SVE +V DEADR+ E GFQE+LNE+L   P+ RQTLLFSAT+ S +       L  PV
Sbjct: 364 VDSVEVLVIDEADRMLEEGFQEELNEILSLLPSKRQTLLFSATMNSKIKQLVSLTLKRPV 423

Query: 328 LVRLDAETKISENLEMLFISI-KKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXX 386
            V +D   + +  L   F+ I K+D  + ++L+ L             IKKL        
Sbjct: 424 RVMIDPPKQAASKLTQEFVRIRKRDHLKPSVLFHL-------------IKKL-------- 462

Query: 387 XXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVS 446
                                      +   +K  +VFV  +     +  +L   G  V 
Sbjct: 463 ---------------------------DGTGQKRMVVFVARKEMAHRLRIILGLLGISVG 495

Query: 447 YIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRV 506
            ++G+L+Q  R Q +  F++    ILV TD+A+RG+DIP +  VINY +P + ++++HRV
Sbjct: 496 ELHGSLSQEQRLQSVNQFKSLEVPILVCTDLASRGLDIPKIEVVINYDMPKNYEVYLHRV 555

Query: 507 GRTARAGNRGWAFSIV 522
           GRTARAG  G + S+V
Sbjct: 556 GRTARAGREGRSVSLV 571

>CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {ON}
           highly similar to uniprot|P32892 Saccharomyces
           cerevisiae YLL008w DRS1 RNA helicase of the DEAD box
           family
          Length = 725

 Score =  248 bits (632), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 151/433 (34%), Positives = 236/433 (54%), Gaps = 54/433 (12%)

Query: 96  DDEKKATNESDDDLNDYF--NTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQ 153
           D E+K   ++ +++  ++   + ++ A K    +F    LS+ V+  +S  G+ +P+PIQ
Sbjct: 174 DAEEKVEEDTAEEMQAFYAPESESENAKKEVHKTFNDLALSRPVMKGLSNLGYVKPSPIQ 233

Query: 154 RKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIG-VRAVILSPSRELAIQT 212
             TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    AK+   R ++L+P+RELAIQ 
Sbjct: 234 SATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKVASTRVIVLTPTRELAIQV 293

Query: 213 HRVFKEFSK-GSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKS 270
             V K+  +  S+L   L  GG +L  Q  M+   PD+VIATPGRF+ H++   + ++ S
Sbjct: 294 ADVGKKIGQFVSNLTFGLAVGGLNLRQQEQMLKTRPDIVIATPGRFIDHIRNSASFNVDS 353

Query: 271 VEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVR 330
           VE +V DEADR+ E GFQ++LNE++   P+ RQTLLFSAT+ S +       L  PV + 
Sbjct: 354 VEVLVIDEADRMLEDGFQDELNEIMSLLPSKRQTLLFSATMNSRIKQLISLSLKRPVRIM 413

Query: 331 LDAETKISENLEMLFISI-KKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXX 389
           +D   + +  L   F+ I K+D  + +LL+ L             I+KL           
Sbjct: 414 IDPPKQAATKLTQEFVRIRKRDHLKPSLLFNL-------------IRKLD---------- 450

Query: 390 XXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIY 449
                               PN      +K  +VFV  +     +  +L   G  V+ ++
Sbjct: 451 --------------------PNG-----QKRIVVFVARKDMAHKLRIILGLLGMAVAELH 485

Query: 450 GALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRT 509
           G+L Q  R   +  F++    +L+ TD+A+RG+DIP +  VINY +P S +I++HRVGRT
Sbjct: 486 GSLTQEQRLDSVNKFKSLQVPVLICTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRT 545

Query: 510 ARAGNRGWAFSIV 522
           ARAG  G + + V
Sbjct: 546 ARAGREGRSITFV 558

>NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {ON}
           Anc_5.208
          Length = 771

 Score =  247 bits (630), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 149/410 (36%), Positives = 223/410 (54%), Gaps = 52/410 (12%)

Query: 117 ADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGK 176
            D A K    SF +  LS+ VL  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGSGK
Sbjct: 240 GDDAKKQTHTSFNTLSLSRPVLKGLANLGYNKPSPIQSATIPIALLGKDIIAGAVTGSGK 299

Query: 177 TAAFVLPMIEKLKTHSAKIG-VRAVILSPSRELAIQTHRVFKEFSKGSD-LRSILLTGGD 234
           TAAF++P+IE+L    AK+   R ++L+P+RELAIQ   V K+  K  + L   L  GG 
Sbjct: 300 TAAFMIPIIERLLFKPAKVSSTRVIVLTPTRELAIQIADVAKKIGKFVNGLTFGLAVGGL 359

Query: 235 SLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNE 293
           +L  Q  ++   PD+VIATPGRF+ H++   + ++ SVE +V DEADR+ E GFQE+LNE
Sbjct: 360 NLRQQEQILKQRPDIVIATPGRFIDHVRNSASFNVDSVEILVMDEADRMLEEGFQEELNE 419

Query: 294 LLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIK-KDE 352
           ++   PT RQT+LFSAT+ S +       L  PV + ++   + +  L   F+ I+ +D 
Sbjct: 420 IMQLLPTKRQTMLFSATMNSKIKQLINLSLKKPVRIMINPPKQAASKLTQEFVRIRTRDH 479

Query: 353 REANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNA 412
            +  LL+ L             IKKL +                                
Sbjct: 480 LKPALLFNL-------------IKKLDEY------------------------------- 495

Query: 413 NEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSIL 472
               S+K  +VFV  +     +  +L   G  V+ ++G+L Q  R + +  F++    +L
Sbjct: 496 ----SQKRMVVFVARKETAHKLRIILGLLGMNVAELHGSLTQEQRLESVTKFKSLEIPVL 551

Query: 473 VVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           + TD+A+RG+DIP +  VINY +P S  I++HRVGRTARAG  G + S+V
Sbjct: 552 ICTDLASRGLDIPKIEVVINYDMPKSYDIYLHRVGRTARAGREGRSVSLV 601

>KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {ON}
           Anc_5.208 YLL008W
          Length = 754

 Score =  246 bits (629), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 145/410 (35%), Positives = 223/410 (54%), Gaps = 52/410 (12%)

Query: 117 ADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGK 176
           AD A K    +F S  LS+ VL  ++  G+ +P+PIQ  TIP+ LQ +D++  A TGSGK
Sbjct: 230 ADDAKKQTHETFNSLSLSRPVLKGLAHLGYTKPSPIQSATIPVALQGKDVIAGAVTGSGK 289

Query: 177 TAAFVLPMIEKLKTHSAKIGV-RAVILSPSRELAIQTHRVFKEFSK-GSDLRSILLTGGD 234
           TAAF++P+IE+L    +K+ + R ++L+P+RELAIQ   V K+  +  S L   L  GG 
Sbjct: 290 TAAFMIPIIERLLFKPSKVAMTRVIVLTPTRELAIQISDVAKKIGQFVSGLTFGLAVGGL 349

Query: 235 SLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNE 293
           +L  Q   +   PD+VIATPGRF+ H++   + ++ SVE +V DEADR+ E GFQ++L E
Sbjct: 350 NLRQQEQALKARPDIVIATPGRFIDHIRNSASFNVDSVEILVLDEADRMLEEGFQDELKE 409

Query: 294 LLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISI-KKDE 352
           ++   P+ RQ LLFSAT+ S +       L  PV + +D   + +  L   F+ I K+D 
Sbjct: 410 IMTMLPSKRQNLLFSATMNSKIKSLVSLSLRRPVRIMIDPPKQAASKLTQEFVRIRKRDN 469

Query: 353 REANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNA 412
            +  LL+ L             I+KL                                  
Sbjct: 470 LKPALLFNL-------------IRKLDSN------------------------------- 485

Query: 413 NEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSIL 472
               ++K  +VFV  +     +  +L   G  V+ ++G+L Q  R + +  F++    +L
Sbjct: 486 ----AQKRIVVFVARKETAHRLRIILGLLGMAVAELHGSLTQEQRLESVTRFKSLDVPVL 541

Query: 473 VVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           + TD+A+RG+DIP +  VINY +P S +I++HRVGRTARAG  G + ++V
Sbjct: 542 ICTDLASRGLDIPKIEVVINYDMPKSHEIYLHRVGRTARAGREGRSVTLV 591

>NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {ON}
           Anc_5.208
          Length = 748

 Score =  246 bits (627), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 150/412 (36%), Positives = 223/412 (54%), Gaps = 52/412 (12%)

Query: 115 TTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGS 174
           +  D A K    +F S  LS+ VL  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 215 SEGDDAKKQTYANFNSLSLSRPVLKGLATLGYTKPSPIQSATIPVALSGKDIIAGAVTGS 274

Query: 175 GKTAAFVLPMIEKLKTHSAKIG-VRAVILSPSRELAIQTHRVFKEFSKG-SDLRSILLTG 232
           GKTAAF++P+IE+L   SAKI   R ++L+P+RELAIQ   V K+  K  + +   L  G
Sbjct: 275 GKTAAFMIPVIERLLFKSAKIAATRVIVLTPTRELAIQISDVGKKIGKFINGITFGLAVG 334

Query: 233 GDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQL 291
           G +L  Q   +   PD+VIATPGRF+ H++   + ++ SVE +V DEADR+ E GFQE+L
Sbjct: 335 GLNLRQQEQELKARPDIVIATPGRFIDHIRNSASFNVDSVEILVIDEADRMLEEGFQEEL 394

Query: 292 NELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIK-K 350
           NE++   P  RQTLLFSAT+ S +       L  PV + +D   + +  L   F+ I+ +
Sbjct: 395 NEIMQLLPNKRQTLLFSATMNSKIKQLVSLSLRKPVRIMIDPPKQAASRLTQEFVRIRAR 454

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
           D  +  LL+ L             IKKL                                
Sbjct: 455 DHLKPALLFNL-------------IKKL-------------------------------- 469

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
              +   +K  +VFV  +     +  +L   G  V+ ++G+L+Q  R + +  F++    
Sbjct: 470 ---DGYGQKRMVVFVSRKEMAHRLRIILGLLGMNVAELHGSLSQEQRLESVTKFKSLEIP 526

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           +L+ TD+A+RG+DIP +  VINY +P S +I++HRVGRTARAG  G + S V
Sbjct: 527 VLICTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVSFV 578

>ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 750

 Score =  244 bits (624), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 148/413 (35%), Positives = 224/413 (54%), Gaps = 54/413 (13%)

Query: 115 TTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGS 174
           + ++ A K    +F S  LS+ VL  +   G+  P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 226 SESEEAKKKVFNNFNSLSLSRPVLKALGDLGYATPSPIQGATIPIALLGKDIIAGAVTGS 285

Query: 175 GKTAAFVLPMIEKLKTHSAKIG-VRAVILSPSRELAIQTHRVFKEFSKGSD-LRSILLTG 232
           GKTAAF++P+IE+L    AK+   R ++L+P+RELAIQ   V K+  K  + L   +  G
Sbjct: 286 GKTAAFMIPIIERLIYKPAKVASTRVIVLAPTRELAIQVADVGKKLGKYVNGLTFGIAVG 345

Query: 233 GDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQL 291
           G +L  Q  ++   PD+VIATPGRF+ H++   + ++ SVE +V DEADR+ E GFQ+++
Sbjct: 346 GLNLRQQEQILKTRPDIVIATPGRFIDHIRNSSSFNVDSVEVLVIDEADRMLEEGFQDEI 405

Query: 292 NELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKD 351
           NE++   P+ RQT+LFSAT+ S +       L  PV V  D   +    L+  F+ I+K 
Sbjct: 406 NEIMHLLPSKRQTMLFSATMNSKIKQLVSLSLKRPVRVMTDPPQQAVSKLQQEFVRIRKR 465

Query: 352 E--REANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRL 409
           +  + + L YL              IKKL                               
Sbjct: 466 DHLKPSTLFYL--------------IKKL------------------------------- 480

Query: 410 PNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLT 469
               +  ++K  +VFV  +  V  +  +L   G  V+ ++G+LNQ  R Q +  F++   
Sbjct: 481 ----DGAAQKRMVVFVSKKEMVHRLRIILGLLGMAVAELHGSLNQEQRLQSINKFKSLEV 536

Query: 470 SILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
            +L+ TD+A+RG+DIP +  VINY +P S +I++HRVGRTARAG  G + S V
Sbjct: 537 PVLICTDLASRGLDIPKIEVVINYDMPKSFEIYLHRVGRTARAGREGRSVSFV 589

>YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}
           DRS1Nucleolar DEAD-box protein required for ribosome
           assembly and function, including synthesis of 60S
           ribosomal subunits; constituent of 66S pre-ribosomal
           particles
          Length = 752

 Score =  244 bits (623), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 153/415 (36%), Positives = 222/415 (53%), Gaps = 58/415 (13%)

Query: 115 TTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGS 174
           T  D A K    +F S  LS+ VL  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 220 TEGDEAKKQMYENFNSLSLSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGS 279

Query: 175 GKTAAFVLPMIEKLKTHSAKIG-VRAVILSPSRELAIQTHRVFKEFSK-GSDLRSILLTG 232
           GKTAAF++P+IE+L    AKI   R ++L P+RELAIQ   V K+ ++  S +   L  G
Sbjct: 280 GKTAAFMIPIIERLLYKPAKIASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVG 339

Query: 233 GDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQL 291
           G +L  Q  M+   PD+VIATPGRF+ H++   + ++ SVE +V DEADR+ E GFQ++L
Sbjct: 340 GLNLRQQEQMLKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDEL 399

Query: 292 NELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISI-KK 350
           NE++   P+NRQ LLFSAT+ S +       L  PV + +D   K +  L   F+ I K+
Sbjct: 400 NEIMGLLPSNRQNLLFSATMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKR 459

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
           D  +  LL+ L             I+KL                                
Sbjct: 460 DHLKPALLFNL-------------IRKL-------------------------------- 474

Query: 411 NANEMPSEKATIVFVP---TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAG 467
              +   +K  +VFV    T H +  +  LL   G  V  ++G+L Q  R   +  F+  
Sbjct: 475 ---DPTGQKRIVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNL 528

Query: 468 LTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
              +L+ TD+A+RG+DIP +  VINY +P S +I++HRVGRTARAG  G + + V
Sbjct: 529 EVPVLICTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 583

>Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON}
           (137204..139462) [2259 nt, 753 aa]
          Length = 752

 Score =  243 bits (621), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 148/400 (37%), Positives = 218/400 (54%), Gaps = 52/400 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F S  LS+ VL  +S  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P+IE
Sbjct: 232 TFNSLTLSRPVLKGLSDLGYTKPSPIQSATIPIGLSGKDIIAGAVTGSGKTAAFMIPIIE 291

Query: 187 KLKTHSAKIG-VRAVILSPSRELAIQTHRVFKEFSK-GSDLRSILLTGGDSLEDQFGMMM 244
           +L    AK+   R ++L+P+RELAIQ   V K+  K  S L   L  GG +L  Q   + 
Sbjct: 292 RLLYKPAKVASTRVIVLTPTRELAIQIADVGKKIGKYVSGLTFGLAVGGLNLRQQEQELK 351

Query: 245 GNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
             PD+VIATPGRF+ H++   + ++ SVE +V DEADR+ E GFQE+LNE+L   P+ RQ
Sbjct: 352 TRPDIVIATPGRFIDHVRNSSSFNVDSVEVLVMDEADRMLEEGFQEELNEILTLLPSKRQ 411

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISI-KKDEREANLLYLLQ 362
           TLLFSAT+ S +       L  PV + ++   + +  L   F+ I K+D  +  LL+ L 
Sbjct: 412 TLLFSATMNSRIKSLISLSLRKPVRIMINPPKQAAARLTQEFVRIRKRDHLKPALLFYL- 470

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
                       I+KL                                   +   +K  +
Sbjct: 471 ------------IRKL-----------------------------------DGTGQKRIV 483

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           VFV  +     +  +L   G  V  ++G+L Q  R Q + NF++    +L+ TD+A+RG+
Sbjct: 484 VFVARKEMAHKLRIILGLLGMKVGELHGSLTQEQRLQSVNNFKSLEVPVLICTDLASRGL 543

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           DIP +  VIN+ +P S +I++HRVGRTARAG  G + + V
Sbjct: 544 DIPKIEVVINFDMPKSYEIYLHRVGRTARAGREGRSVTFV 583

>Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W
           (REAL)
          Length = 735

 Score =  243 bits (620), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 153/415 (36%), Positives = 222/415 (53%), Gaps = 58/415 (13%)

Query: 115 TTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGS 174
           T  D A K    +F S  LS+ VL  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 203 TEGDEAKKQLYDNFNSLSLSRPVLKGLASLGYAKPSPIQSATIPIALLGKDIIAGAVTGS 262

Query: 175 GKTAAFVLPMIEKLKTHSAKIG-VRAVILSPSRELAIQTHRVFKEFSK-GSDLRSILLTG 232
           GKTAAF++P+IE+L    AKI   R ++L P+RELAIQ   V K+ ++  S +   L  G
Sbjct: 263 GKTAAFMIPIIERLLYKPAKIASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVG 322

Query: 233 GDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQL 291
           G +L  Q  M+   PD+VIATPGRF+ H++   + ++ SVE +V DEADR+ E GFQ++L
Sbjct: 323 GLNLRQQEQMLKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDEL 382

Query: 292 NELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISI-KK 350
           NE++   P+NRQ LLFSAT+ S +       L  PV + +D   K +  L   F+ I K+
Sbjct: 383 NEIMGLLPSNRQNLLFSATMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKR 442

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
           D  +  LL+ L             I+KL                                
Sbjct: 443 DHLKPALLFNL-------------IRKL-------------------------------- 457

Query: 411 NANEMPSEKATIVFVP---TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAG 467
              +   +K  +VFV    T H +  +  LL   G  V  ++G+L Q  R   +  F+  
Sbjct: 458 ---DPVGQKRIVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNL 511

Query: 468 LTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
              +L+ TD+A+RG+DIP +  VINY +P S +I++HRVGRTARAG  G + + V
Sbjct: 512 EVPVLICTDLASRGLDIPKIEVVINYDMPKSHEIYLHRVGRTARAGREGRSVTFV 566

>TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5.208
           YLL008W
          Length = 755

 Score =  242 bits (618), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 150/407 (36%), Positives = 219/407 (53%), Gaps = 52/407 (12%)

Query: 120 AAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAA 179
           A K    +F +  LS+ VL  +S  G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAA
Sbjct: 214 AKKQVHTNFNTLSLSRPVLKGLSDLGYTKPSPIQSATIPIGLLGKDIIAGAVTGSGKTAA 273

Query: 180 FVLPMIEKLKTHSAKIG-VRAVILSPSRELAIQTHRVFKEFSKGSD-LRSILLTGGDSLE 237
           F++P+IE+L    A I   R ++L+P+RELAIQ   V K   K  + L   L  GG +L 
Sbjct: 274 FMIPIIERLLYKPANIASTRVIVLTPTRELAIQVSDVGKRIGKYVNGLTFGLAVGGLNLR 333

Query: 238 DQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLV 296
            Q   +   PDVVIATPGRF+ H++   + ++ SVE +V DEADR+ E GFQE+LNE++ 
Sbjct: 334 QQEQELKTRPDVVIATPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEDGFQEELNEIMS 393

Query: 297 AFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISI-KKDEREA 355
             PT RQTLLFSAT+ S +       L  PV + ++   + +  L   F+ I K+D  + 
Sbjct: 394 LLPTKRQTLLFSATMNSKIKQLISLSLRRPVRIMINPPKQAAARLTQEFVRIRKRDLLKP 453

Query: 356 NLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEM 415
            LLY L             I+KL                                   + 
Sbjct: 454 ALLYYL-------------IRKL-----------------------------------DS 465

Query: 416 PSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVT 475
            S+K  +VFV  +     +  ++   G  V+ ++G+L Q  R Q +  F++    +L+ T
Sbjct: 466 SSQKRIVVFVSRKEMAHRLRIIMGLLGMKVAELHGSLTQEQRLQSVNQFKSLEVPVLICT 525

Query: 476 DVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           D+A+RG+DIP +  VINY +P S +I++HRVGRTARAG  G + + V
Sbjct: 526 DLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 572

>KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa]
           {ON} Anc_5.208 YLL008W
          Length = 739

 Score =  242 bits (617), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 154/427 (36%), Positives = 228/427 (53%), Gaps = 58/427 (13%)

Query: 104 ESDDDLNDYF--NTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLIL 161
           +S + + +YF     A+ A K    +F +  LS+ VL  +S  GF +P+PIQ  TIP+ L
Sbjct: 190 DSAEAVAEYFAPEEEAEDAKKQTHTTFNTLNLSRPVLKGLSSLGFTKPSPIQSATIPIAL 249

Query: 162 QKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIG-VRAVILSPSRELAIQTHRVFKE-- 218
             +DIV  A TGSGKTAAF++P+IE+L    AK+   R VIL+P+RELAIQ   V K+  
Sbjct: 250 LGKDIVAGAVTGSGKTAAFMIPIIERLLYKPAKVASTRVVILTPTRELAIQISDVAKKIG 309

Query: 219 -FSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVF 276
            F  G  L   L  GG +L  Q  ++   PD+VIATPGRF+ H++   +  +  VE +V 
Sbjct: 310 HFVNG--LTFGLAVGGLNLRQQEQILKSRPDIVIATPGRFIDHVRNSASFSVDRVEILVL 367

Query: 277 DEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETK 336
           DEADR+ E GFQ++L+E++   PT RQ LLFSAT+ S +       L  PV + +D   +
Sbjct: 368 DEADRMLEEGFQDELSEIMTLLPTRRQNLLFSATMNSKIKQLVSLSLKKPVRIMIDPPKQ 427

Query: 337 ISENLEMLFISI-KKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXX 395
            ++ L   F+ I K+D  +  LLY L             I+KL                 
Sbjct: 428 AADRLVQEFVRIRKRDHLKPALLYNL-------------IRKL----------------- 457

Query: 396 XXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQH 455
                             +   +K  +VFV  +     +  +L   G  V+ ++G+L+Q 
Sbjct: 458 ------------------DSTGQKRIVVFVSRKEVAHRLRIILGLLGMGVAELHGSLSQE 499

Query: 456 ARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNR 515
            R   +  F++    +L+ TD+A+RG+DIP +  VINY +P S +I++HRVGRTARAG  
Sbjct: 500 QRLDSVNKFKSLDVPVLICTDLASRGLDIPKIEIVINYDMPKSYEIYLHRVGRTARAGRE 559

Query: 516 GWAFSIV 522
           G + + V
Sbjct: 560 GRSVTFV 566

>KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} similar
           to uniprot|P32892 Saccharomyces cerevisiae YLL008W DRS1
           Nucleolar DEAD-box protein required for ribosome
           assembly and function
          Length = 748

 Score =  241 bits (614), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 150/404 (37%), Positives = 214/404 (52%), Gaps = 54/404 (13%)

Query: 123 HKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVL 182
           HK  +F S  LS+ VL  +   G+  P+PIQ   IP+ L  +DI+  A TGSGKTAAF++
Sbjct: 232 HK--TFNSLSLSRPVLKGLGSLGYTSPSPIQSAAIPIALLGKDIIAGAVTGSGKTAAFMI 289

Query: 183 PMIEKLKTHSAKIG-VRAVILSPSRELAIQTHRVFKEFSKGSD-LRSILLTGGDSLEDQF 240
           P+IE+L    A I   R V+L+P+RELAIQ   V K   K  + L   L  GG +L  Q 
Sbjct: 290 PIIERLLYKPAHIASTRVVVLTPTRELAIQVADVGKNIGKFVNGLTFGLAVGGLNLRQQE 349

Query: 241 GMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFP 299
             +   PD+VIATPGRF+ HL+   +  + SVE +V DEADR+ E GFQE+L E++   P
Sbjct: 350 QALKTRPDIVIATPGRFIDHLRNSASFSVDSVEILVIDEADRMLEEGFQEELQEIMSLIP 409

Query: 300 TNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISI-KKDEREANLL 358
           + RQTLLFSAT+ S +       L  PV + +D   + ++ L   FI I K+D  +  LL
Sbjct: 410 SKRQTLLFSATMNSKIKQLISLSLKKPVRIMIDPPKQAADKLTQEFIRIRKRDHLKPALL 469

Query: 359 YLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSE 418
           Y L                                             R+L N     S+
Sbjct: 470 YQL--------------------------------------------IRKLDNT----SQ 481

Query: 419 KATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVA 478
           K  +VFV  +     +  +L   G  V  ++G+L Q  R Q + NF++    +L+ TD+A
Sbjct: 482 KRIVVFVARKETAHKLRIVLGLLGMQVGELHGSLTQEQRLQSVNNFKSLQVPVLICTDLA 541

Query: 479 ARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           +RG+DIP +  VIN+ +P + +I++HRVGRTARAG  G + + V
Sbjct: 542 SRGLDIPKIEVVINFDMPKTYEIYLHRVGRTARAGREGRSVTFV 585

>Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W
           (REAL)
          Length = 758

 Score =  240 bits (612), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 148/433 (34%), Positives = 229/433 (52%), Gaps = 54/433 (12%)

Query: 96  DDEKKATNESDDDLNDYF--NTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQ 153
           DDE    ++S++   D++   T  + A K    +F S  LS+ VL  ++  G+  P+PIQ
Sbjct: 205 DDEVAEEDDSEEAKADFYAPETEGNEAKKQMYDNFNSLSLSRPVLKGLANLGYVTPSPIQ 264

Query: 154 RKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIG-VRAVILSPSRELAIQT 212
             TIP+ L  +DI+  A TGSGKTAAF++P+IE+L    AKI   R ++L P+RELA+Q 
Sbjct: 265 SATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKIASTRVIVLLPTRELALQV 324

Query: 213 HRVFKEFSK-GSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKS 270
             V K+ ++    +   L  GG +L  Q  M+   PD+VIATPGRF+ H++   + ++ S
Sbjct: 325 ADVGKQIARFVPSITFGLAVGGLNLRQQEQMLKSRPDIVIATPGRFIDHIRNSASFNVDS 384

Query: 271 VEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVR 330
           VE +V DEADR+ E GFQ++LNE++   P++RQ LLFSAT+ S +       L  PV + 
Sbjct: 385 VEILVMDEADRMLEEGFQDELNEIMGLLPSSRQNLLFSATMNSKIKSLVSLSLKRPVRIM 444

Query: 331 LDAETKISENLEMLFISI-KKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXX 389
           +D   K +  L   F+ I K+D  +  L++ L             I+KL           
Sbjct: 445 IDPPKKAATKLTQEFVRIRKRDHLKPALIFNL-------------IRKLDPM-------- 483

Query: 390 XXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIY 449
                                      ++K  +VFV  +     +  ++   G  V  ++
Sbjct: 484 ---------------------------AQKRIVVFVARKESAHRLRIIMGLLGMSVGELH 516

Query: 450 GALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRT 509
           G+L Q  R   +  F+     +L+ TD+A+RG+DIP +  VINY +P S ++++HRVGRT
Sbjct: 517 GSLTQEQRLDSVSKFKNLEVPVLICTDLASRGLDIPKIEVVINYDMPKSHEVYLHRVGRT 576

Query: 510 ARAGNRGWAFSIV 522
           ARAG  G + + V
Sbjct: 577 ARAGREGRSVTFV 589

>TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON}
           Anc_5.208 YLL008W
          Length = 757

 Score =  239 bits (610), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 144/410 (35%), Positives = 217/410 (52%), Gaps = 52/410 (12%)

Query: 117 ADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGK 176
            D A K    +F +  LS+ VL  ++  G+ +P+PIQ   IP+ L  +DI+  A TGSGK
Sbjct: 227 GDEAKKQVHNTFNTLSLSRPVLKGLAALGYSKPSPIQSAAIPIALLGKDIIAGAVTGSGK 286

Query: 177 TAAFVLPMIEKLKTHSAKI-GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSI-LLTGGD 234
           TAAF++P+IE+L    AK+   R ++L+P+RELAIQ   V K+  K  +  +  L  GG 
Sbjct: 287 TAAFMIPIIERLLYKPAKVTSTRVIVLTPTRELAIQVSDVGKKVGKFVNGVTFGLAVGGL 346

Query: 235 SLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNE 293
           +L  Q   +   PD+V+ATPGRF+ H++   + ++ SVE +V DEADR+ E GFQ++LNE
Sbjct: 347 NLRQQEQQLKSRPDIVVATPGRFIDHIRNSASFNVDSVEILVIDEADRMLEDGFQDELNE 406

Query: 294 LLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISI-KKDE 352
           ++   P+ RQTLLFSAT+ S +       L  PV + +D   + +  L   F+ I K+D 
Sbjct: 407 IMSLLPSKRQTLLFSATMNSKIKQLISLSLKKPVRIMIDPPKQAAAKLVQEFVRIRKRDN 466

Query: 353 REANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNA 412
            +  LLY L                                             R+L  A
Sbjct: 467 LKPALLYTL--------------------------------------------IRKLDGA 482

Query: 413 NEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSIL 472
                +K  +VFV  +     +  +L   G  V  ++G+L Q  R   +  F++    +L
Sbjct: 483 ----GQKRIVVFVARKETAHKLRIILGLLGQSVGELHGSLTQEQRLDSVNKFKSLEVPVL 538

Query: 473 VVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           + TD+A+RG+DIP +  VINY +P S +I++HRVGRTARAG  G + + V
Sbjct: 539 LCTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFV 588

>AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL008W
           (DRS1)
          Length = 734

 Score =  236 bits (603), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 150/440 (34%), Positives = 231/440 (52%), Gaps = 55/440 (12%)

Query: 91  SLELSDDEKKATNESDDDLNDYFNTTADAAAKHKK---GSFASFGLSKLVLINISKKGFR 147
            +E  D++++A  E   +    F   ++   + K     +F S  LS+ VL  ++  G+ 
Sbjct: 181 GVEFGDEQEEAREEDTAEEMAQFYAPSNEGEEAKNVVHSTFNSLSLSRPVLKGLAALGYT 240

Query: 148 QPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIG-VRAVILSPSR 206
           +P+PIQ  TIP+ L  +D++  A TGSGKTAAF++P+IE+L    AKI   R ++L+P+R
Sbjct: 241 KPSPIQGATIPIALLGKDVIAGAVTGSGKTAAFMIPIIERLLYKPAKIASTRVLVLTPTR 300

Query: 207 ELAIQTHRVFKEFSK-GSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEM 264
           ELAIQ   V K+  K  S L   L  GG +L  Q   +   PD+VIATPGR + H++   
Sbjct: 301 ELAIQVADVGKKLGKFVSGLTFGLAVGGLNLRQQEQALKLRPDIVIATPGRIIDHIRNSA 360

Query: 265 NLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLS 324
           +  + SVE +V DEADR+ E GFQ++LNE++   P+ RQTLLFSAT+ S +       L 
Sbjct: 361 SFSVDSVEVLVIDEADRMLEDGFQDELNEIMSLIPSKRQTLLFSATMNSRIKQLISLSLK 420

Query: 325 NPVLVRLDAETKISENLEMLFISIKKDER-EANLLYLLQEAIKMPVATESQIKKLKQQNX 383
            PV + +D   + +  L   F+ ++K E  +  LLY L             ++KL     
Sbjct: 421 KPVRIMIDPPKQAANKLTQEFVRLRKREHLKPALLYHL-------------LRKL----- 462

Query: 384 XXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGY 443
                                         +   +K  +VFV  +     +  +L   G 
Sbjct: 463 ------------------------------DSTGQKRIVVFVARKEVAHRLRVILGLLGM 492

Query: 444 LVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFI 503
               ++G+L Q  R Q + NF++    +LV TD+A+RG+DIP +  VINY +P + +I++
Sbjct: 493 KAGELHGSLTQEQRLQSVNNFKSLDVPVLVCTDLASRGLDIPKIEVVINYDMPKTYEIYL 552

Query: 504 HRVGRTARAGNRGWAFSIVS 523
           HRVGRTARAG  G + ++V 
Sbjct: 553 HRVGRTARAGREGKSVTLVG 572

>SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]
           {ON} similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 737

 Score =  235 bits (599), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 144/410 (35%), Positives = 220/410 (53%), Gaps = 52/410 (12%)

Query: 117 ADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGK 176
            + A  +   SF S  LS+ VL  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGK
Sbjct: 214 GEEAKNNTHTSFNSLSLSRPVLKGLGALGYVKPSPIQGATIPIALLGKDIIAGAVTGSGK 273

Query: 177 TAAFVLPMIEKLKTHSAKIG-VRAVILSPSRELAIQTHRVFKEFSKGSD-LRSILLTGGD 234
           TAA+++P+IE+L    A++   R V+L+P+RELAIQ   V K+  K  + L   L  GG 
Sbjct: 274 TAAYMIPIIERLLYKPAQVASTRVVVLAPTRELAIQVADVGKKIGKFVNGLTFGLAVGGL 333

Query: 235 SLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNE 293
           +L  Q   +   PD+VIATPGRF+ H++   +  + SVE +V DEADR+ E GF ++LNE
Sbjct: 334 NLRQQEQTLKLRPDIVIATPGRFIDHIRNSASFSVDSVEVLVIDEADRMLEEGFHDELNE 393

Query: 294 LLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISI-KKDE 352
           ++   P+ RQTLLFSAT+ S +       L  PV + +D   + +  L   F+ I K+D 
Sbjct: 394 IMSLIPSKRQTLLFSATMNSKIKQLVSLSLKKPVRIMIDPPKQAAAKLTQEFVRIRKRDH 453

Query: 353 REANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNA 412
            +  LL+ L             I+K+ +                                
Sbjct: 454 LKPALLFHL-------------IRKIDE-------------------------------- 468

Query: 413 NEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSIL 472
               S+K  +VFV  +     +  +L   G  V+ ++G+L Q  R Q + +F++    +L
Sbjct: 469 ---TSQKRIVVFVSRKEMAHRLRIILGLLGMKVAELHGSLTQEQRLQSVNSFKSLDVPVL 525

Query: 473 VVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           + TD+A+RG+DIP +  VIN+ +P + +I++HRVGRTARAG  G + S V
Sbjct: 526 ICTDLASRGLDIPKIEVVINFDMPKTYEIYLHRVGRTARAGREGRSVSFV 575

>Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W
           (REAL)
          Length = 744

 Score =  235 bits (599), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 148/415 (35%), Positives = 221/415 (53%), Gaps = 58/415 (13%)

Query: 115 TTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGS 174
           T A+ A K    +F S  LS+ VL  ++  G+ +P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 212 TEANDAKKQMYDNFNSLSLSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGS 271

Query: 175 GKTAAFVLPMIEKLKTHSAKIG-VRAVILSPSRELAIQTHRVFKEFSK-GSDLRSILLTG 232
           GKTAAF++P+IE+L     KI   R ++L P+RELA+Q   V K+ ++  S +   L  G
Sbjct: 272 GKTAAFMIPIIERLLYKPGKIASTRVIVLLPTRELALQVADVGKQIARFVSGITFGLAVG 331

Query: 233 GDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQL 291
           G +L  Q  ++   PD+VIATPGRF+ H++   + ++ SVE +V DEADR+ E GFQ++L
Sbjct: 332 GLNLRQQEQLLKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDEL 391

Query: 292 NELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISI-KK 350
           NE++   P+NRQ LLFSAT+ S +       L  PV + +D   + +  L   F+ I K+
Sbjct: 392 NEIMGLLPSNRQNLLFSATMNSKIKSLVSLSLRRPVRIMIDPPKQAATKLTQEFVRIRKR 451

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
           D  +  LL+ L             I+KL                                
Sbjct: 452 DHLKPALLFNL-------------IRKLDPM----------------------------- 469

Query: 411 NANEMPSEKATIVFVP---TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAG 467
                  +K  +VFV    T H +  +  LL   G  V  ++G+L Q  R   +  F+  
Sbjct: 470 ------GQKRIVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNL 520

Query: 468 LTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
              +LV TD+A+RG+DIP +  V+NY +P S +I++HRVGRTARA   G + ++V
Sbjct: 521 EVPVLVCTDLASRGLDIPKIEVVVNYDMPKSYEIYLHRVGRTARADREGRSVTLV 575

>KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 739

 Score =  234 bits (597), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 144/407 (35%), Positives = 218/407 (53%), Gaps = 52/407 (12%)

Query: 120 AAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAA 179
           A K    +F S  LS+ VL  +    + +P+PIQ  TIP+ L  +DI+  A TGSGKTAA
Sbjct: 217 AKKTVHTNFNSLSLSRPVLKGLGALNYVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAA 276

Query: 180 FVLPMIEKLKTHSAKIG-VRAVILSPSRELAIQTHRVFKEFSKGSDLRSI-LLTGGDSLE 237
           +++P+IE+L    A+I   R ++L+P+RELAIQ   V  + +K  +  S  L  GG +L 
Sbjct: 277 YMIPIIERLLYKPAQIASTRVIVLTPTRELAIQVSDVGAKLAKFVNGISFGLAVGGLNLR 336

Query: 238 DQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLV 296
            Q   +   PD+VIATPGR + H++   + ++ SVE +V DEADR+ E GFQ++LNE++ 
Sbjct: 337 QQEQTLRSRPDIVIATPGRLIDHIRNSASFNVDSVEILVIDEADRMLEEGFQDELNEIMS 396

Query: 297 AFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISI-KKDEREA 355
             P+ RQTLLFSAT+ S +       L  PV + +D   + +  L   F+ + K+DE + 
Sbjct: 397 LIPSKRQTLLFSATMNSKINQLISLSLKKPVKIMIDPPRQAAAKLTQEFVRVRKRDELKP 456

Query: 356 NLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEM 415
            LL+ L             I+KL                                     
Sbjct: 457 ALLFHL-------------IRKLDDL---------------------------------- 469

Query: 416 PSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVT 475
            S+K  +VFV  +     +  +L   G  V+ ++G+L+Q  R Q +  F++    +L+ T
Sbjct: 470 -SQKRVVVFVARKEVAHKLRIILGLLGMKVAELHGSLSQEQRLQAVNGFKSLQVPVLICT 528

Query: 476 DVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           D+A+RG+DIP +  VINY +P +  I++HRVGRTARAG  G + S V
Sbjct: 529 DLASRGLDIPKIEFVINYDMPKTYDIYLHRVGRTARAGREGRSISFV 575

>NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337
          Length = 504

 Score =  227 bits (578), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 149/420 (35%), Positives = 211/420 (50%), Gaps = 59/420 (14%)

Query: 127 SFASFGLSKLV--LINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLP 183
           +F +F    LV  LI   K   + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P
Sbjct: 82  TFETFSELNLVPELIQACKNLNYSKPTPIQSKSIPPALKGHDIIGLAQTGSGKTAAFAIP 141

Query: 184 MIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           ++  L  H  +    A IL+P+RELA Q    F        +RS+ + GG ++ DQ   +
Sbjct: 142 ILNSL-WHDQQ-PYYACILAPTRELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDL 199

Query: 244 MGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-N 301
           M  P V+IATPGR + HL+      L+ ++Y+V DEADRL +M F   L+ +L   PT  
Sbjct: 200 MRKPHVIIATPGRLMDHLENTKGFSLRKLKYLVMDEADRLLDMEFGPVLDRILKILPTQG 259

Query: 302 RQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLL 361
           R T LFSAT+ S +    +A L+NPV   +  + +  + L    I +    +   L+YLL
Sbjct: 260 RTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTFLIYLL 319

Query: 362 QEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKAT 421
            E I                                                     K+T
Sbjct: 320 NEYIG----------------------------------------------------KST 327

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           I+F  T+ + E ++ L     +  + ++G LNQ+ R   L  F+AG  +ILV TDVAARG
Sbjct: 328 IIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKTILVATDVAARG 387

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKI 541
           +DIP +  VINY +P  SK +IHRVGRTARAG  G + S+VS              GKK+
Sbjct: 388 LDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKL 447

>KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 487

 Score =  226 bits (576), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 143/398 (35%), Positives = 202/398 (50%), Gaps = 56/398 (14%)

Query: 146 FRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPS 205
           + +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 87  YNKPTPIQSKAIPPALKGSDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACILAPT 144

Query: 206 RELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEM 264
           RELA Q    F        +RS  + GG S+ DQ   +M  P ++IATPGR + HL+   
Sbjct: 145 RELAQQIKETFDSLGSLMGVRSTCIVGGMSMMDQARDLMRKPHIIIATPGRLMDHLENTK 204

Query: 265 NLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQTLLFSATLPSSLVDFAKAGL 323
             +L+ ++Y+V DEADRL +M F   L+ +L   PT  R T LFSAT+ S +    +A L
Sbjct: 205 GFNLRKLKYLVMDEADRLLDMEFGPVLDRILNIIPTQGRTTYLFSATMTSKIDKLQRASL 264

Query: 324 SNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNX 383
           +NPV   +  + +  + L    + +    +   L+YLL E I                  
Sbjct: 265 TNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFIG----------------- 307

Query: 384 XXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGY 443
                                              K+TIVF  T+ + E ++ L     +
Sbjct: 308 -----------------------------------KSTIVFTRTKANAERISNLCNLLEF 332

Query: 444 LVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFI 503
             + ++G LNQ+ R   L  F+AG  SILV TDVAARG+DIP +  VINY +P  SK +I
Sbjct: 333 SATALHGDLNQNQRTGALDLFKAGKRSILVATDVAARGLDIPSVDIVINYDIPVDSKSYI 392

Query: 504 HRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKI 541
           HRVGRTARAG  G + S+VS              GKK+
Sbjct: 393 HRVGRTARAGRSGKSISLVSQYDLELILRIEDVLGKKL 430

>TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {ON}
           Anc_5.337 YHR065C
          Length = 498

 Score =  226 bits (576), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 154/450 (34%), Positives = 219/450 (48%), Gaps = 63/450 (14%)

Query: 101 ATNESDDDLND----YFNTTADAAAKHKKGSFASFGLSKLV--LINISKK-GFRQPTPIQ 153
           + NESD++  +       T AD      + +F SF    LV  LI       F +PTPIQ
Sbjct: 43  SMNESDEETGNTKRQVIRTEADIEENTSEKTFTSFNELDLVPELIQACHNLNFSKPTPIQ 102

Query: 154 RKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTH 213
            K+IP  L+  DI+G+A+TGSGKTAAF +P++ KL          A IL+P+RELA Q  
Sbjct: 103 SKSIPPALEGHDIIGLAQTGSGKTAAFAIPILNKLWEDQQP--YYACILAPTRELAQQIK 160

Query: 214 RVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVE 272
             F        +RS+ + GG ++ DQ   +M  P ++IATPGR + HL+      L+ ++
Sbjct: 161 ETFDSLGSLMGVRSVCIVGGMNMMDQSRELMRKPHIIIATPGRLMDHLENTKGFSLRKLK 220

Query: 273 YVVFDEADRLFEMGFQEQLNELLVAFPT-NRQTLLFSATLPSSLVDFAKAGLSNPVLVRL 331
           ++V DEADRL +M F   L+ +L   PT +R T LFSAT+ S +    +A L+NPV   +
Sbjct: 221 FLVMDEADRLLDMEFGPVLDRILKIIPTQDRTTYLFSATMTSKIEKLQRASLTNPVKCAV 280

Query: 332 DAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXX 391
             + +  E L    + +    +   L+YLL E I                          
Sbjct: 281 SNKYQTVETLVQTLMVVPGGLKNTYLIYLLNEFIG------------------------- 315

Query: 392 XXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGA 451
                                      K+ IVF  T+ + E ++ L     +  + ++G 
Sbjct: 316 ---------------------------KSIIVFTRTKANAERLSALSNLLEFSSTALHGD 348

Query: 452 LNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTAR 511
           LNQ+ R   L  F+AG   ILV  DVAARG+DIP +  VINY +P  SK +IHRVGRTAR
Sbjct: 349 LNQNQRTGALDLFKAGKRQILVAIDVAARGLDIPSVDIVINYDIPVDSKSYIHRVGRTAR 408

Query: 512 AGNRGWAFSIVSXXXXXXXXXXXXXXGKKI 541
           AG  G + S+VS              GKK+
Sbjct: 409 AGRSGKSISLVSQYDLELILRIEDVLGKKL 438

>Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}
           similar to Ashbya gossypii AAL041C
          Length = 486

 Score =  224 bits (572), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 143/398 (35%), Positives = 200/398 (50%), Gaps = 56/398 (14%)

Query: 146 FRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPS 205
           F +PTPIQ K IP  LQ  DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 86  FTKPTPIQSKAIPPALQGNDIIGLAQTGSGKTAAFAIPILNQL-WHDQQ-PYYACILAPT 143

Query: 206 RELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEM 264
           RELA Q    F        +RS  + GG ++ DQ   +M  P ++IATPGR + HL+   
Sbjct: 144 RELAQQIKETFDSLGSLMGVRSTCIMGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTK 203

Query: 265 NLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQTLLFSATLPSSLVDFAKAGL 323
              L+ + ++V DEADRL +M F   L+ +L   PT  R T LFSAT+ S +    +A L
Sbjct: 204 GFSLRKLRFLVIDEADRLLDMEFGAVLDRILKNIPTKGRTTYLFSATMTSKIDKLQRASL 263

Query: 324 SNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNX 383
           +NPV   +  + +  + L    + +    +   L+YLL E I                  
Sbjct: 264 TNPVKCSVSNKYQTVDTLIQTLMVVPGGLKNTYLIYLLNEFIG----------------- 306

Query: 384 XXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGY 443
                                              K+TIVF  T+ + E ++ L     +
Sbjct: 307 -----------------------------------KSTIVFTRTKANAERISGLCNLLEF 331

Query: 444 LVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFI 503
             + ++G LNQ+ R   L  F+AG  SILV TDVAARG+DIP +  VINY +P  SK +I
Sbjct: 332 SATALHGDLNQNQRTGALDLFKAGRRSILVATDVAARGLDIPSVDIVINYDIPVDSKSYI 391

Query: 504 HRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKI 541
           HRVGRTARAG  G + S+VS              GKK+
Sbjct: 392 HRVGRTARAGRSGKSISLVSQYDLELILRIEDVLGKKL 429

>Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008W
           (DRS1) - putative ATP dependent RNA helicase [contig 94]
           FULL
          Length = 731

 Score =  230 bits (587), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 139/401 (34%), Positives = 217/401 (54%), Gaps = 54/401 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F S  LS+ VL  +    + +P+PIQ  TIP+ L  +DI+  A TGSGKTAA+++P+IE
Sbjct: 216 NFNSLSLSRPVLKGLGALNYVKPSPIQSATIPIALTGKDIIAGAVTGSGKTAAYMIPIIE 275

Query: 187 KLKTHSAKIG-VRAVILSPSRELAIQTHRVFKEFSKGSD-LRSILLTGGDSLEDQFGMMM 244
           +L    A++   R ++L+P+RELAIQ   V  + +K  + +   L  GG +L  Q   + 
Sbjct: 276 RLLYKPAQVSSTRVIVLAPTRELAIQVSDVGTKLAKYVNGINFGLAVGGLNLRQQEQALR 335

Query: 245 GNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
             PDVVIATPGR + H++   + ++ SVE +V DEADR+ E GFQ++LNE++   P+ RQ
Sbjct: 336 ARPDVVIATPGRLIDHIRNSASFNVDSVEILVIDEADRMLEDGFQDELNEIMSLIPSKRQ 395

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK--DEREANLLYLL 361
           TLLFSAT+ S +       L  PV + +D   + +  L   F+ ++K  D + A L +L+
Sbjct: 396 TLLFSATMNSKINQLISLSLKKPVRIMIDPPKQAAAKLVQEFVRVRKRDDLKPALLFHLI 455

Query: 362 QEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKAT 421
                                                        R+L +A    S+K  
Sbjct: 456 ---------------------------------------------RKLDDA----SQKRV 466

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           +VFV  +     +  +L   G  V+ ++G+L+Q  R Q +  F++    +L+ TD+A+RG
Sbjct: 467 VVFVARKEMAHKLRIILGLLGMKVAELHGSLSQEQRLQAVNGFKSLQIPVLICTDLASRG 526

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           +DIP +  VIN+ +P +  I++HRVGRTARAG  G + S V
Sbjct: 527 LDIPKIEFVINFDMPKTYDIYLHRVGRTARAGREGRSISFV 567

>NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337
          Length = 502

 Score =  224 bits (572), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 145/417 (34%), Positives = 207/417 (49%), Gaps = 56/417 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF+   L   +L       + +PTPIQ ++IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 83  SFSELDLVPELLQACKNLNYTKPTPIQSRSIPPALKGNDIIGLAQTGSGKTAAFAIPILN 142

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
            L  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +M  
Sbjct: 143 SL-WHDQQ-PYYACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 200

Query: 247 PDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQT 304
           P ++IATPGR + HL+      L+ ++Y+V DEADRL +M F   L+ +L   PT  R T
Sbjct: 201 PHIIIATPGRLMDHLENTKGFSLRKLKYLVMDEADRLLDMEFGPVLDRILKILPTQGRTT 260

Query: 305 LLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEA 364
            LFSAT+ S +    +A L+NPV   +  + +  + L    I +    ++  L+YLL E 
Sbjct: 261 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLIVVPGGLKDTYLVYLLNEF 320

Query: 365 IKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVF 424
           I                                                     K TI+F
Sbjct: 321 IG----------------------------------------------------KTTIIF 328

Query: 425 VPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDI 484
             T+ + E ++ L     +  + ++G LNQ+ R   L  F+AG  SILV TDVAARG+DI
Sbjct: 329 TRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKSILVATDVAARGLDI 388

Query: 485 PLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKI 541
           P +  VINY +P  SK +IHRVGRTARAG  G + S+VS              GKK+
Sbjct: 389 PSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKL 445

>KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {ON}
           Anc_5.337 YHR065C
          Length = 494

 Score =  223 bits (569), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 139/398 (34%), Positives = 203/398 (51%), Gaps = 56/398 (14%)

Query: 146 FRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPS 205
           + +PTPIQ ++IP  L+ +DI+G+A+TGSGKTAAF +P++  L  H  +    A ILSP+
Sbjct: 94  YSKPTPIQSRSIPPALKGKDIIGLAQTGSGKTAAFAIPILNSL-WHDQQ-PYYACILSPT 151

Query: 206 RELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEM 264
           RELA Q    F        +RS+ + GG ++ DQ   +M  P ++I TPGR + HL+   
Sbjct: 152 RELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDLMRKPHIIIGTPGRLMDHLENTR 211

Query: 265 NLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQTLLFSATLPSSLVDFAKAGL 323
              L++++Y+V DEADRL +M F   L+ +L   PT  R T LFSAT+ S +    +A L
Sbjct: 212 GFSLRNLKYLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSKIDKLQRASL 271

Query: 324 SNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNX 383
           +NPV   +  + +  + L    + +    ++  L+YLL E I                  
Sbjct: 272 TNPVKCAVSTKYQTVDTLVQTLMVVPGGVKDTYLVYLLNEFIG----------------- 314

Query: 384 XXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGY 443
                                              K+ I+F  T+ + E ++ L     +
Sbjct: 315 -----------------------------------KSMIIFTRTKANAERISGLANLLQF 339

Query: 444 LVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFI 503
             + ++G LNQ+ R   L  F+AG  SILV TDVAARG+DIP +  VINY +P  SK +I
Sbjct: 340 SATALHGDLNQNQRTGALDLFKAGRRSILVATDVAARGLDIPSVDVVINYDIPVDSKSYI 399

Query: 504 HRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKI 541
           HRVGRTARAG  G + S+VS              GKK+
Sbjct: 400 HRVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKL 437

>ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q75EW9 Ashbya gossypii
           AAL041C RRP3 ATP-dependent rRNA helicase RRP3 and
           similar to YHR065C uniprot|P38712 Saccharomyces
           cerevisiae YHR065C RRP3 Required for maturation of the
           35S primary transcript of pre-rRNA and is required for
           cleavages leading to mature 18S RNA RRP3 is a DEAD box
           gene homologous to eIF- 4a which encodes an
           RNA-dependent ATPase possessing helicase activity which
           is not specific for RNA
          Length = 494

 Score =  223 bits (568), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 151/441 (34%), Positives = 213/441 (48%), Gaps = 71/441 (16%)

Query: 118 DAAAKHKKG------------SFASFGLSKLV--LINISKK-GFRQPTPIQRKTIPLILQ 162
           D + KHKK                SF    LV  LI   K   F +PTPIQ + IP  L+
Sbjct: 49  DESKKHKKAKVQEEEPEYQGEDLQSFNDLNLVPELIEACKNLNFDKPTPIQARAIPPALE 108

Query: 163 KRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKG 222
            RDI+G+A+TGSGKTAAF +P++ +L     K    A +L+P+RELA QT   F      
Sbjct: 109 GRDIIGLAQTGSGKTAAFAIPILNRL--WEDKQPYYACVLAPTRELAQQTKETFDSLGAL 166

Query: 223 SDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADR 281
             +RS  + GG ++ DQ   +M  P ++IATPGR + HL+      L+ + ++V DEADR
Sbjct: 167 MGVRSTCIVGGMNMMDQARELMRKPHIIIATPGRLMDHLENTKGFSLRKLRFLVMDEADR 226

Query: 282 LFEMGFQEQLNELLVAFPT-NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISEN 340
           L +M F   L+++L   PT +R T LFSAT+ S +    +A L+ PV   +  + +  + 
Sbjct: 227 LLDMEFGPVLDKILKVIPTQDRTTYLFSATMTSKIDKLQRASLTEPVKCAVSNKYQTVDT 286

Query: 341 LEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXX 400
           L    + +    +   L+YLL E I   V                               
Sbjct: 287 LVQTLMVVPSGLKNTYLIYLLNENIGKTV------------------------------- 315

Query: 401 XXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQ 460
                                I+F  T+ + E ++ L     +  + ++G LNQ+ R   
Sbjct: 316 ---------------------IIFTRTKANAERLSALCNLLEFNATALHGDLNQNQRTGA 354

Query: 461 LYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFS 520
           L  F+AG  SILV TDVAARG+DIP +  VINY +P  SK +IHRVGRTARAG  G + S
Sbjct: 355 LDLFKAGRRSILVATDVAARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSIS 414

Query: 521 IVSXXXXXXXXXXXXXXGKKI 541
           +VS              GKK+
Sbjct: 415 LVSQYDLELILRIEEVLGKKL 435

>Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {ON}
           complement(18157..19677) [1521 nt, 507 aa]
          Length = 506

 Score =  223 bits (568), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 145/417 (34%), Positives = 206/417 (49%), Gaps = 56/417 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF+   L   ++       F +PTPIQ ++IP  LQ  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 87  SFSDLDLVPELIEACKNLNFAKPTPIQARSIPPALQGHDIIGLAQTGSGKTAAFAIPILN 146

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
           +L  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +M  
Sbjct: 147 RL-WHDQQ-PYYACILAPTRELAQQIKETFDSLGSLMGVRSACIVGGMNMMDQARDLMRK 204

Query: 247 PDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQT 304
           P ++IATPGR + HL+      L+ ++++V DEADRL +M F   L+ +L   PT  R T
Sbjct: 205 PHIIIATPGRLMDHLENTRGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 264

Query: 305 LLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEA 364
            LFSAT+ S +    +A L+NPV   +  + +  + L    I +    +   L+YL+ E 
Sbjct: 265 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTYLIYLMNEF 324

Query: 365 IKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVF 424
           I                                                     K  IVF
Sbjct: 325 IG----------------------------------------------------KTIIVF 332

Query: 425 VPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDI 484
             T+ + E +T L     +  + ++G LNQ+ R   L  F+AG  SILV TDVAARG+DI
Sbjct: 333 TRTKANAERITTLANLLEFSATALHGDLNQNQRTGSLDLFKAGRRSILVATDVAARGLDI 392

Query: 485 PLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKI 541
           P +  VINY +P  SK +IHRVGRTARAG  G + S+VS              GKK+
Sbjct: 393 PSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLGKKL 449

>TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.337
           YHR065C
          Length = 501

 Score =  222 bits (565), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 143/417 (34%), Positives = 205/417 (49%), Gaps = 56/417 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF+   +   +L       F +PTPIQ K IP  L+ +DI+G+A+TGSGKTAAF LP++ 
Sbjct: 82  SFSGLNIVPELLQACKNLNFTKPTPIQAKAIPPALEGKDIIGLAQTGSGKTAAFALPILN 141

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
           +L    +     A ILSP+RELA Q    F         R+  + GG ++ DQ   +M  
Sbjct: 142 RLWHDQSP--YYACILSPTRELAQQIKETFDSLGTIMGARTTCIVGGMNMMDQARDLMRK 199

Query: 247 PDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQT 304
           P ++IATPGR + HL+      L+ ++++V DEADRL +M F   L+ +L   PT  R T
Sbjct: 200 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 259

Query: 305 LLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEA 364
            LFSAT+ S +    +A L++PV   +  + +  + L    + +    +   L+YLL E 
Sbjct: 260 YLFSATMTSKIDKLQRASLTDPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEF 319

Query: 365 IKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVF 424
           I                                                     K TI+F
Sbjct: 320 IG----------------------------------------------------KTTIIF 327

Query: 425 VPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDI 484
             T+ + E ++ L     +  + ++G LNQ+ R   L  F+AG  SILV TDVAARG+DI
Sbjct: 328 TRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRRSILVATDVAARGLDI 387

Query: 485 PLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKI 541
           P +  VINY +P  SK +IHRVGRTARAG  G + S+VS              GKK+
Sbjct: 388 PSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKL 444

>SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 505

 Score =  221 bits (564), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 150/430 (34%), Positives = 211/430 (49%), Gaps = 59/430 (13%)

Query: 117 ADAAAKHKKGSFASFGLSKLV--LINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTG 173
           AD      + +F SF    LV  LI   K  GF +PTPIQ K IP  L+  DI+G+A+TG
Sbjct: 73  ADEEIDEGEQTFDSFSDLNLVPELIEACKNLGFSKPTPIQAKAIPPALEGSDIIGLAQTG 132

Query: 174 SGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGG 233
           SGKTAAF +P++ +L  H  +    A IL+P+RELA Q    F        +R+  + GG
Sbjct: 133 SGKTAAFAIPILNRL-WHDQQ-PYYACILAPTRELAQQIKETFDSLGALMGVRATCIVGG 190

Query: 234 DSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLN 292
            ++ DQ   +M  P ++IATPGR + HL+      L+ + ++V DEADRL +M F   L+
Sbjct: 191 MNMMDQARDLMRKPHIIIATPGRLMDHLENTRGFSLRKLRFLVMDEADRLLDMEFGPVLD 250

Query: 293 ELLVAFPT-NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKD 351
            +L   PT  R T LFSAT+ S +    +A L+NPV   +  + +  + L    + +   
Sbjct: 251 RILKIIPTQGRTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGG 310

Query: 352 EREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPN 411
            +   L+YLL E I   V                                          
Sbjct: 311 LKNTFLIYLLNEFIGKTV------------------------------------------ 328

Query: 412 ANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSI 471
                     IVF  T+ + E ++ L     +  + ++G LNQ+ R   L  F+AG  SI
Sbjct: 329 ----------IVFTRTKANAERISTLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSI 378

Query: 472 LVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXX 531
           LV TDVAARG+DIP +  V+NY +P  SK +IHRVGRTARAG  G + S+VS        
Sbjct: 379 LVATDVAARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELIL 438

Query: 532 XXXXXXGKKI 541
                 GKK+
Sbjct: 439 RIEDVLGKKL 448

>YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}
           RRP3Protein involved in rRNA processing; required for
           maturation of the 35S primary transcript of pre-rRNA and
           for cleavage leading to mature 18S rRNA; homologous to
           eIF-4a, which is a DEAD box RNA-dependent ATPase with
           helicase activity
          Length = 501

 Score =  221 bits (563), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 147/420 (35%), Positives = 208/420 (49%), Gaps = 59/420 (14%)

Query: 127 SFASFGLSKLV--LINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLP 183
           SF SF    LV  LI   K   + +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P
Sbjct: 79  SFESFSELNLVPELIQACKNLNYSKPTPIQSKAIPPALEGHDIIGLAQTGSGKTAAFAIP 138

Query: 184 MIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           ++ +L  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +
Sbjct: 139 ILNRL-WHDQE-PYYACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDL 196

Query: 244 MGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTN- 301
           M  P ++IATPGR + HL+      L+ ++++V DEADRL +M F   L+ +L   PT  
Sbjct: 197 MRKPHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQE 256

Query: 302 RQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLL 361
           R T LFSAT+ S +    +A L+NPV   +  + +  + L    + +    +   L+YLL
Sbjct: 257 RTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLL 316

Query: 362 QEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKAT 421
            E I                                                     K  
Sbjct: 317 NEFIG----------------------------------------------------KTM 324

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           I+F  T+ + E ++ L     +  + ++G LNQ+ R   L  F+AG  SILV TDVAARG
Sbjct: 325 IIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGSLDLFKAGKRSILVATDVAARG 384

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKI 541
           +DIP +  V+NY +P  SK +IHRVGRTARAG  G + S+VS              GKK+
Sbjct: 385 LDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKL 444

>Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  221 bits (563), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 146/413 (35%), Positives = 211/413 (51%), Gaps = 59/413 (14%)

Query: 116 TADAAAKHKKGSFASFGLSKLV--LINISKK-GFRQPTPIQRKTIPLILQKRDIVGMART 172
           TA+    ++  SF SF    LV  LI   K   + +PTPIQ K+IP  L+  DI+G+A+T
Sbjct: 70  TAENDNANEGESFESFNELNLVPELIQACKNLNYSKPTPIQSKSIPPALKGHDIIGLAQT 129

Query: 173 GSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTG 232
           GSGKTAAF +P++ +L  H  +    A IL+P+RELA Q    F        +RS  + G
Sbjct: 130 GSGKTAAFAIPILNRL-WHDQE-PYYACILAPTRELAQQIKEAFDSLGSLMGVRSTCIVG 187

Query: 233 GDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQL 291
           G ++ DQ   +M  P ++IATPGR + HL+      L+ ++++V DEADRL +M F   L
Sbjct: 188 GMNMMDQARDLMRKPHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVL 247

Query: 292 NELLVAFPTN-RQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           + +L   PT  R T LFSAT+ S +    +A L+NPV   +  + +  + L    + +  
Sbjct: 248 DRILKIIPTQERTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQALMVVPG 307

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
             +   L+YLL E+I                                             
Sbjct: 308 GLKNTYLIYLLNESIG-------------------------------------------- 323

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
                   K  I+F  T+ + E ++ L     +  + ++G LNQ+ R   L  F+AG  S
Sbjct: 324 --------KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRS 375

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           ILV TDVAARG+DIP +  V+NY +P  SK +IHRVGRTARAG  G + S+VS
Sbjct: 376 ILVATDVAARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 428

>Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON}
           YHR065C (REAL)
          Length = 501

 Score =  220 bits (561), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 146/420 (34%), Positives = 209/420 (49%), Gaps = 59/420 (14%)

Query: 127 SFASFGLSKLV--LINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLP 183
           SF +F    LV  LI   K   + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P
Sbjct: 79  SFETFSELNLVPELIQACKNLNYSKPTPIQSKSIPPALEGHDIIGLAQTGSGKTAAFAIP 138

Query: 184 MIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           ++ +L  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +
Sbjct: 139 ILNRL-WHDQE-PYYACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDL 196

Query: 244 MGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTN- 301
           M  P ++IATPGR + HL+      L+ ++++V DEADRL +M F   L+ +L   PT  
Sbjct: 197 MRKPHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQE 256

Query: 302 RQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLL 361
           R T LFSAT+ S +    +A L+NPV   +  + +  + L    + +    +   L+YLL
Sbjct: 257 RTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLL 316

Query: 362 QEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKAT 421
            E I                                                     K  
Sbjct: 317 NEFIG----------------------------------------------------KTM 324

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           I+F  T+ + E ++ L     +  + ++G LNQ+ R   L  F+AG  SILV TDVAARG
Sbjct: 325 IIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRSILVATDVAARG 384

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKI 541
           +DIP +  V+NY +P  SK +IHRVGRTARAG  G + S+VS              GKK+
Sbjct: 385 LDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKL 444

>AAL041C Chr1 complement(270739..272202) [1464 bp, 487 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR065C
           (RRP3)
          Length = 487

 Score =  219 bits (557), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 143/399 (35%), Positives = 200/399 (50%), Gaps = 57/399 (14%)

Query: 146 FRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPS 205
           F +PTPIQ K IP  LQ +DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+
Sbjct: 86  FTKPTPIQSKAIPPALQGKDIIGLAQTGSGKTAAFAIPILNRL-WHDQQ-PYYACILAPT 143

Query: 206 RELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKV-E 263
           RELA Q    F        +R+  + GG ++ DQ   +M  P ++IATPGR + HL+V +
Sbjct: 144 RELAQQIKETFDSLGSLMGVRTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLEVHK 203

Query: 264 MNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTN-RQTLLFSATLPSSLVDFAKAG 322
               L+  +++V DEADRL  M F   L+ +L   PT  R T LFSAT+ S +    +A 
Sbjct: 204 RGFALRKQQFLVMDEADRLLNMKFGPVLDRILKNIPTKVRTTYLFSATMTSKIDKLQRAS 263

Query: 323 LSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQN 382
           L+N V   +  + +  + L    I +    +   L+YLL E I                 
Sbjct: 264 LTNTVKCAVSNKYQTVDTLVQTLIVVPGGLKNTFLIYLLNEFIG---------------- 307

Query: 383 XXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCG 442
                                               K TIVF  T+ + E ++ L     
Sbjct: 308 ------------------------------------KTTIVFTRTKANAERISGLCNLLE 331

Query: 443 YLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIF 502
           +  + ++G LNQ+ R   L  F+AG  SILV TDVAARG+DIP +  VINY +P  SK +
Sbjct: 332 FSATALHGDLNQNQRTGALDLFKAGKKSILVATDVAARGLDIPSVDLVINYDIPVDSKSY 391

Query: 503 IHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKI 541
           IHRVGRTARAG  G + S+VS              GKK+
Sbjct: 392 IHRVGRTARAGRSGKSVSLVSQYDLELILRIEEVLGKKL 430

>CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065c RRP3
          Length = 493

 Score =  218 bits (556), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 141/417 (33%), Positives = 203/417 (48%), Gaps = 56/417 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SFA   L   ++       F +PTPIQ + IP  L   D++G+A+TGSGKTAAF +P++ 
Sbjct: 74  SFAQLNLVPELIQACQNLNFTKPTPIQARAIPPALAGSDVIGLAQTGSGKTAAFAIPILN 133

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
           KL          A +L+P+RELA Q    F        +R+  + GG ++ DQ   +M  
Sbjct: 134 KLWEDQQP--YYACVLAPTRELAQQIKETFDSLGSLMGVRTTCIVGGMNMMDQARDLMRK 191

Query: 247 PDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQT 304
           P ++IATPGR + HL+      LK+++++V DEADRL +M F   L+ +L   PT  R T
Sbjct: 192 PHIIIATPGRLMDHLENTKGFSLKNLKFLVMDEADRLLDMEFGPVLDRILKIIPTKGRTT 251

Query: 305 LLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEA 364
            LFSAT+ S +    +A L+NPV   +  + +  + L    + +    +   L+YLL E 
Sbjct: 252 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEF 311

Query: 365 IKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVF 424
           I                                                     K  I+F
Sbjct: 312 IG----------------------------------------------------KTVIIF 319

Query: 425 VPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDI 484
             T+ + E ++ L     +  + ++G LNQ+ R   L  F+AG  SILV TDVAARG+DI
Sbjct: 320 TRTKANAERLSGLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVAARGLDI 379

Query: 485 PLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKI 541
           P +  VINY +P  SK +IHRVGRTARAG  G + S+VS              GKK+
Sbjct: 380 PSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLGKKL 436

>TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {ON}
           Anc_5.337 YHR065C
          Length = 506

 Score =  218 bits (556), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 141/420 (33%), Positives = 210/420 (50%), Gaps = 59/420 (14%)

Query: 127 SFASFGLSKLV--LINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLP 183
           +F+SF   KLV  L+   K   + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P
Sbjct: 84  TFSSFSELKLVPELVEACKNLNYEKPTPIQSRAIPPALEGKDIIGLAQTGSGKTAAFAIP 143

Query: 184 MIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           ++ KL          A I++P+RELA Q    F        +RS+ + GG ++ DQ   +
Sbjct: 144 ILNKLWEDQQP--YYACIMAPTRELAQQIKEQFDSLGALMGVRSVCIVGGMNMMDQARDL 201

Query: 244 MGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-N 301
           M  P ++IATPGR + HL+      L+ ++++V DEADRL ++ F   L+ +L   PT  
Sbjct: 202 MRKPHIIIATPGRLMDHLENTRGFSLRKLKFLVMDEADRLLDLEFGPVLDRILKILPTQG 261

Query: 302 RQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLL 361
           R T LFSAT+ S +    +A L+NPV   +  + +  + L    + +    +   L+YL+
Sbjct: 262 RTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLIQTLMVVPGGLKNTYLIYLI 321

Query: 362 QEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKAT 421
            E +                                                     K+ 
Sbjct: 322 NEFVG----------------------------------------------------KSI 329

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           I+F  T+ + E ++ L     +    ++G LNQ+ R   L  F+AG  SIL+ TDVAARG
Sbjct: 330 IIFTRTKANAERLSLLSNTLEFDAIALHGDLNQNQRTGALDLFKAGKKSILIATDVAARG 389

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKI 541
           +DIP +  VINY +P  SK +IHRVGRTARAG  G + S+VS              GKK+
Sbjct: 390 LDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLGKKL 449

>Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065C
           (RRP3) - RRP3 is a DEAD box gene homologous to eIF-4a
           which encodes an RNA-dependent ATPase possessing
           helicase activity which is not specific for RNA [contig
           104] FULL
          Length = 500

 Score =  216 bits (551), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 140/401 (34%), Positives = 205/401 (51%), Gaps = 59/401 (14%)

Query: 128 FASFGLSKLV--LINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPM 184
           F SF   KLV  LI   +   + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P+
Sbjct: 78  FESFSELKLVPELIEACENLKYSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFAIPI 137

Query: 185 IEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMM 244
           + +L  H  +    A +L+P+RELA Q    F        +R+  + GG ++ DQ   +M
Sbjct: 138 LNQL-WHDQQ-PYYACVLAPTRELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQARDLM 195

Query: 245 GNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NR 302
             P ++IATPGR + HL+      ++ ++Y+V DEADRL +M F   L+ +L   PT  R
Sbjct: 196 RKPHIIIATPGRLMDHLENTKGFSMRKLKYLVMDEADRLLDMEFGPVLDRILKIIPTQGR 255

Query: 303 QTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQ 362
            T LFSAT+ S +    +A L+NPV   +  + +  + L    + +    +   L+YLL 
Sbjct: 256 TTYLFSATMTSKIDKLQRASLTNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNTFLIYLLN 315

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
           E +   V                                                    I
Sbjct: 316 EFLGKTV----------------------------------------------------I 323

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           +F  T+ + E ++ L     +  + ++G LNQ+ R   L  F+AG  SILV TDVAARG+
Sbjct: 324 IFTRTKANAERISTLCNLLEFSSTALHGDLNQNQRTGALDLFKAGRRSILVATDVAARGL 383

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           DIP +  VINY +P  SK +IHRVGRTARAG  G + S+VS
Sbjct: 384 DIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 424

>Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  215 bits (548), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 144/420 (34%), Positives = 208/420 (49%), Gaps = 59/420 (14%)

Query: 127 SFASFGLSKLV--LINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLP 183
           SF +F    LV  L+   K   + +PTPIQ K+IP  L   DI+G+A+TGSGKTAAF +P
Sbjct: 81  SFETFNELNLVPELLQACKNLNYSKPTPIQSKSIPPALAGHDIIGLAQTGSGKTAAFAIP 140

Query: 184 MIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           ++ +L  H  +    A IL+P+RELA Q    F        +RS  + GG ++ DQ   +
Sbjct: 141 ILNRL-WHDQE-PYYACILAPTRELAQQIKEAFDSLGSLMGVRSTCIVGGMNMMDQARDL 198

Query: 244 MGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTN- 301
           M  P ++IATPGR + HL+      L+ ++++V DEADRL +M F   L+ +L   PT  
Sbjct: 199 MRKPHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQE 258

Query: 302 RQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLL 361
           R T LFSAT+ S +    +A L+NPV   +  + +  + L    + +    +   L+YLL
Sbjct: 259 RTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLL 318

Query: 362 QEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKAT 421
            E I                                                     K  
Sbjct: 319 NEFIG----------------------------------------------------KTM 326

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           I+F  T+ + E ++ L     +  + ++G LNQ+ R   L  F+AG  +ILV TDVAARG
Sbjct: 327 IIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRAILVATDVAARG 386

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXGKKI 541
           +DIP +  V+NY +P  SK +IHRVGRTARAG  G + S+VS              GKK+
Sbjct: 387 LDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSVSLVSQYDLELILRIEEVLGKKL 446

>NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148
          Length = 888

 Score =  213 bits (543), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 124/405 (30%), Positives = 222/405 (54%), Gaps = 42/405 (10%)

Query: 128 FASFGLSKLVLINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           ++  GL+  V+  I+K  GFR  TPIQ + IP I+   D++G+++TGSGKT +++LP+I 
Sbjct: 288 WSQLGLNTDVMDLITKDFGFRSLTPIQSQAIPAIMDGHDVIGISKTGSGKTISYLLPLIR 347

Query: 187 KLKTHSA----KIGVRAVILSPSRELAIQTHR-VFKEFSKGSDLRSILLTGGDSLEDQFG 241
            +K  +     + G   +IL+P+RELA+Q H+ + K  S  + + SI  TGG  L+ Q  
Sbjct: 348 HIKAQNPLMKNETGPLGLILAPTRELALQIHQEIIKFISTDTAITSICCTGGSELKQQIN 407

Query: 242 MMMGNPDVVIATPGRFLHLKVEMN---LDLKSVEYVVFDEADRLFEMGFQEQLNELLVAF 298
            +     +V+ATPGR + L    N   + +K V +V+ DEADRLF++GF+ Q+ +++   
Sbjct: 408 SLKKGVHIVVATPGRLIDLLTLNNGRLMSIKRVTFVIMDEADRLFDLGFEPQITQIMKTI 467

Query: 299 PTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLF-ISIKKDEREANL 357
             ++Q +LFSAT P+ L +FA   L +P+ + +++++ ++E ++  F I    +E+   L
Sbjct: 468 RPDKQCVLFSATFPNKLRNFAMRILRDPLSITINSQSLVNERVQQRFHICANDEEKFDEL 527

Query: 358 LYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPS 417
           L +++E    P+ T    K+ ++++                                 P 
Sbjct: 528 LAMIEENSSEPIETTDLGKEEEEEH--------------------------------TPQ 555

Query: 418 EKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDV 477
           ++ TI+FV ++   +++   L+N GY    I+   +   R Q L NF++   SILV T+V
Sbjct: 556 DRKTIIFVASQQICDFIGTKLENEGYQPFSIHAGKSYQERVQNLENFKSTKNSILVATEV 615

Query: 478 AARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
            +RG++I  ++ VI ++   +   ++H  GRTAR  + G A S++
Sbjct: 616 LSRGLNITEVSLVIIFNAVKTFAQYVHTTGRTARGNHSGVAISLI 660

>CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [1635
           bp, 544 aa] {ON} highly similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112w DBP2 ATP-dependent RNA
           helicase of DEAD box family
          Length = 544

 Score =  206 bits (523), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 126/401 (31%), Positives = 200/401 (49%), Gaps = 53/401 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F   G    VL  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 TFDEAGFPDYVLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 170

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      S   G   ++L+P+RELA+Q  +   +F K S +R+  + GG     Q   +
Sbjct: 171 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIREL 230

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
           +   ++VIATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 231 IRGAEIVIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLLQ 362
           TL++SAT P  +   A+  L++P+ V++ + E   S N+  L   + + E+   L+  L 
Sbjct: 291 TLMWSATWPKEVQQLARDYLNDPIQVQIGSLELAASHNITQLVEVVSEFEKRDRLVKHLD 350

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
                   T SQ K                                         E   +
Sbjct: 351 --------TASQDK-----------------------------------------ESKIL 361

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           +F  T+   + +T  L+  G+    I+G  +Q  R   L  FR G + I+V TDVAARG+
Sbjct: 362 IFASTKRTCDEITSYLRQDGWPALAIHGDKDQRERDWVLNEFRTGNSPIMVATDVAARGI 421

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           D+  +  V+NY +PG+ + ++HR+GRT RAG  G A S  +
Sbjct: 422 DVKGINFVVNYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 462

>ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [1623
           bp, 540 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 540

 Score =  204 bits (519), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 127/402 (31%), Positives = 206/402 (51%), Gaps = 55/402 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF   G    VL  +  +GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 SFDEAGFPDYVLKEVKAEGFAAPTGIQCQGWPMALSGRDMVGVAATGSGKTLSYCLPAIV 170

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      +   G   ++L+P+RELA+Q  +   +F + S +R+  + GG     Q   +
Sbjct: 171 HINAQPLLAPGDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPRGQQIRDL 230

Query: 244 MGNPDVVIATPGRFLHLKVEMN-LDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNR 302
               ++VIATPGR + + +E+N  +LK V Y+V DEADR+ +MGF+ Q+ +++     +R
Sbjct: 231 ARGAEIVIATPGRLIDM-LEINKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDR 289

Query: 303 QTLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLL 361
           QTL++SAT P  +   A+  L++P+ V++ + E   S  ++ +   I + E+   L   L
Sbjct: 290 QTLMWSATWPKEVKQLARDYLTDPIQVQIGSLELSASHTIKQVVEVISEFEKRDRLSKHL 349

Query: 362 QEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKAT 421
           +      +A+E Q  K+                                           
Sbjct: 350 E------IASEDQDSKV------------------------------------------- 360

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           +VF  T+   + +TQ L+  G+    I+G  +Q  R   L  F+ G + I+V TDVAARG
Sbjct: 361 LVFASTKRTCDDITQYLRQDGWSALAIHGDKDQRERDWVLEEFKNGRSPIMVATDVAARG 420

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +D+  +  VINY +PG+ + ++HR+GRT RAG +G A S  +
Sbjct: 421 IDVKGINYVINYDMPGNIEDYVHRIGRTGRAGAKGTAISFFT 462

>KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632
           bp, 543 aa] {ON} Anc_2.164 YNL112W
          Length = 543

 Score =  204 bits (518), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 126/401 (31%), Positives = 201/401 (50%), Gaps = 53/401 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F   G    VL  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 NFEEAGFPDYVLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 170

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      S   G   ++LSP+RELA+Q  +   +F   S +R+  + GG     Q   +
Sbjct: 171 HINAQPLLSPGDGPIVLVLSPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKGQQIRDL 230

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
           +   ++VIATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 231 VRGAEIVIATPGRLIDMMEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLLQ 362
           TL++SAT P  +   A   L++P+ V++ + E   S N+  L   +   E+   L   L+
Sbjct: 291 TLMWSATWPKEVRQLAADYLNDPIQVQVGSLELSASHNITQLVEVLSDFEKRDRLSKHLE 350

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
                 +A+E +  K+                                           +
Sbjct: 351 ------IASEDKDSKI-------------------------------------------L 361

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           VF  T+   + +T+ L+  G+    I+G  +Q  R   L  FR G + I+V TDVAARG+
Sbjct: 362 VFASTKRTCDDITKYLRADGWPALAIHGDKDQKERDWVLNEFRCGRSPIMVATDVAARGI 421

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           D+  +  VINY +PG+ + ++HR+GRT RAG +G A S  +
Sbjct: 422 DVKGINFVINYDMPGNIEDYVHRIGRTGRAGAKGTAISFFT 462

>NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686
           bp, 561 aa] {ON} 
          Length = 561

 Score =  204 bits (518), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 126/401 (31%), Positives = 201/401 (50%), Gaps = 53/401 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF   G    VL  +  +GF  PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 119 SFDEAGFPDYVLKEVKAEGFDAPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 178

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      S   G   ++L+P+RELA+Q  +   +F   S +R+  + GG     Q   +
Sbjct: 179 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDL 238

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
               ++VIATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 239 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 298

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLLQ 362
           TL++SAT P  +   A   L++P+ V++ + E   S N+  L   + + E+   LL  L+
Sbjct: 299 TLMWSATWPKEVQQLASDYLNDPIQVQVGSLELSASHNIAQLVEVLSEFEKRDRLLKHLE 358

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
                  A+E +                                           E   +
Sbjct: 359 ------TASEDK-------------------------------------------ESKIL 369

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           +F  T+   + +T++L+  G+    I+G  +Q  R   L  FRAG + I+V TDVAARG+
Sbjct: 370 IFASTKRMCDEITKMLREDGWPALAIHGDKDQRERDWVLGEFRAGNSPIMVATDVAARGI 429

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           D+  +  VINY +PG+ + ++HR+GRT RAG +G A S  +
Sbjct: 430 DVKGINFVINYDMPGNIEDYVHRIGRTGRAGAKGTAISFFT 470

>TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 540
           aa] {ON} Anc_2.164 YNL112W
          Length = 540

 Score =  202 bits (513), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 125/401 (31%), Positives = 200/401 (49%), Gaps = 53/401 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F   G    VL  +  +GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 NFDEAGFPDYVLNEVKAEGFANPTAIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      +   G   ++LSP+RELA+Q  +   +F K S +R+  + GG     Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLSPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPKGQQIRDL 233

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
               ++VIATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLLQ 362
           TL++SAT P  + + A+  L++P+ V++ + E   S  +  L   I   E+   ++  L+
Sbjct: 294 TLMWSATWPKEVQNLARDYLNDPIQVQIGSLELAASHTITQLVEVITDFEKRDRMVKHLE 353

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
                 VA++ +                                           E   +
Sbjct: 354 ------VASQDK-------------------------------------------ESKIL 364

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           VF  T+   + +T+ L+  G+    I+G  +Q  R   L  FR G + I+V TDVAARG+
Sbjct: 365 VFASTKRTCDEITKYLREDGWPALAIHGDKDQRERDWVLAEFREGRSPIMVATDVAARGI 424

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           D+  +  VINY +PG+ + ++HR+GRT RAG  G A S  +
Sbjct: 425 DVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 465

>TDEL0G01420 Chr7 (287165..288703) [1539 bp, 512 aa] {ON} Anc_6.204
           YGL078C
          Length = 512

 Score =  201 bits (511), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 128/382 (33%), Positives = 198/382 (51%), Gaps = 52/382 (13%)

Query: 146 FRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKI-GVRAVILSP 204
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I KL T   K  GV+ +++SP
Sbjct: 120 FPKPTPIQSVSWPYLLAGKDVIGVAETGSGKTFAFGVPAINKLVTEDGKKKGVQVLVISP 179

Query: 205 SRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEM 264
           +RELA Q +       + +DL    + GG    +Q    +    VV+ATPGR L L  E 
Sbjct: 180 TRELASQIYDNMILLIEKADLECCCVYGGVPKYEQ-REKLKKAQVVVATPGRLLDLMQEG 238

Query: 265 NLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQTLLFSATLPSSLVDFAKAGL 323
           ++DL +V Y+V DEADR+ E GF+E +  ++ +  T +RQTL+F+AT P  + + A   +
Sbjct: 239 SVDLSNVSYLVLDEADRMLEKGFEEDIKNIIRSTNTSSRQTLMFTATWPKEVRELASTFM 298

Query: 324 SNPVLVRLDAETKISEN--LEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQ 381
           S+PV V +    ++S N  +  +   I + ++E  LL LL++    P   E         
Sbjct: 299 SDPVKVSIGNRDELSANKRITQVVEVIDQFQKERKLLELLKKYQSGPKKDEK-------- 350

Query: 382 NXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNC 441
                                                   ++F   +     V + LK  
Sbjct: 351 ---------------------------------------VLIFALYKKEATRVERNLKYN 371

Query: 442 GYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKI 501
           GY V+ I+G L+Q  R Q L  F+ G +++L+ TDVAARG+DIP +  VIN + P + + 
Sbjct: 372 GYNVAAIHGDLSQQQRSQALNEFKTGASNLLLATDVAARGLDIPNVKTVINLTFPLTVED 431

Query: 502 FIHRVGRTARAGNRGWAFSIVS 523
           ++HR+GRT RAG  G A ++ +
Sbjct: 432 YVHRIGRTGRAGQTGTAHTLFT 453

>ZYRO0G08580g Chr7 complement(695127..696746) [1620 bp, 539 aa] {ON}
           similar to uniprot|P20447 Saccharomyces cerevisiae
           YGL078C DBP3 Putative ATP-dependent RNA helicase of the
           DEAD-box family involved in ribosomal biogenesis
          Length = 539

 Score =  201 bits (512), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 130/402 (32%), Positives = 210/402 (52%), Gaps = 55/402 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF+   L   +   ISK  F +PTPIQ  + P +L  RD++G+A TGSGKT AF +P I+
Sbjct: 129 SFSHLSLKPEIQSEISK--FPKPTPIQSVSWPYLLSGRDVIGVAETGSGKTFAFGVPAID 186

Query: 187 KLKTH--SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMM 244
           +L ++  + +  V+ +++SP+RELA QT+      +    L    + GG   ++Q   + 
Sbjct: 187 QLVSNGDAKRKSVKVLVISPTRELASQTYDNLIILTNKVGLECCCVYGGVPKQEQRNQLR 246

Query: 245 GNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQ 303
            N  VV+ATPGR L L  E ++DL  V+Y+V DEADR+ E GF+E +  ++    + +RQ
Sbjct: 247 -NSQVVVATPGRLLDLINEQSVDLSQVQYLVLDEADRMLEKGFEEDIKNIINQTNSRDRQ 305

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISEN--LEMLFISIKKDEREANLLYLL 361
           TL+F+AT P  + + A   + +PV V +    ++S N  +  +   I+  +++  LL LL
Sbjct: 306 TLMFTATWPKEVRELASTFMRDPVKVSIGNRDELSANKRITQIVEVIEPRQKDRKLLELL 365

Query: 362 QEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKAT 421
           ++        +S  KK                                        +   
Sbjct: 366 RKY-------QSGAKK----------------------------------------DDKV 378

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           ++F   +     V   LK  GY V+ I+G L+Q  R   L +F+AG +++L+ TDVAARG
Sbjct: 379 LIFALYKKEASRVENNLKYNGYDVAAIHGDLSQQQRTSALNDFKAGKSNLLLATDVAARG 438

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +DIP +  VIN + P + + ++HR+GRT RAG  G A ++ +
Sbjct: 439 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 480

>TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 aa]
           {ON} Anc_2.164 YNL112W
          Length = 549

 Score =  201 bits (512), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 124/401 (30%), Positives = 199/401 (49%), Gaps = 53/401 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF   G    VL  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 110 SFDEAGFPDYVLKEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPSIV 169

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      +   G   ++L+P+RELA+Q  +   +F K S +R+  + GG     Q   +
Sbjct: 170 HINAQPLLAPGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRDL 229

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
               ++VIATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 230 ARGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 289

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLLQ 362
           TL++SAT P  +   A   L +P+ V++ + E   S N++ +   I   E+   L     
Sbjct: 290 TLMWSATWPKEVKQLASDYLHDPIQVQIGSLELAASHNIKQVVEVITDFEKRDRL----- 344

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
               M +A++ +                                           E   +
Sbjct: 345 -TKHMDIASQDK-------------------------------------------ESKIL 360

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           VF  T+   + +T+ L++ G+    I+G  +Q  R   L  FR G + I+V TDVAARG+
Sbjct: 361 VFASTKRTCDEITKYLRDDGWPALAIHGDKDQRERDWVLNEFRTGRSPIMVATDVAARGI 420

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           D+  +  VINY +PG+ + ++HR+GRT RAG  G A S  +
Sbjct: 421 DVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 461

>KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [1656
           bp, 551 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 551

 Score =  201 bits (511), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 124/401 (30%), Positives = 199/401 (49%), Gaps = 53/401 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F   G  + VL  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 112 TFDEAGFPEYVLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 171

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      S   G   ++L+P+RELA+Q      +F K S +R+  + GG     Q   +
Sbjct: 172 HINAQPLLSPGDGPIVLVLAPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIREL 231

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
               ++VIATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 232 TRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 291

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLLQ 362
           TL++SAT P  +   A+  L +P+ V + + E   S N+  +   +   E+   LL  L+
Sbjct: 292 TLMWSATWPKEVQQLARDYLHDPIQVNVGSLELAASHNIAQIVEVVSDMEKRDRLLKHLE 351

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
                  A+E +  K+                                           +
Sbjct: 352 ------TASEDKDSKI-------------------------------------------L 362

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           +F  T+   + +T+ L+  G+    I+G   Q+ R   L  FR G + I+V TDVAARG+
Sbjct: 363 IFASTKRTCDEITRYLRQDGWPALAIHGDKAQNERDWVLQEFRTGNSPIMVATDVAARGI 422

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           D+  +  VINY +PG+ + ++HR+GRT RAG  G A S  +
Sbjct: 423 DVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 463

>NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 aa]
           {ON} Anc_2.164
          Length = 556

 Score =  201 bits (511), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 124/401 (30%), Positives = 201/401 (50%), Gaps = 53/401 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F   G    VL  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 116 TFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 175

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      +   G   ++L+P+RELA+Q  +   +F   S +R+  + GG     Q   +
Sbjct: 176 HINAQPLLAPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDL 235

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
               ++VIATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 236 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 295

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLLQ 362
           TL++SAT P  +   A   L++P+ V++ + E   S N+  L   + + E+   LL  L+
Sbjct: 296 TLMWSATWPKEVKQLASDYLNDPIQVQIGSLELSASHNITQLVEVVSEFEKRDRLLKHLE 355

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
                  A++ Q  K+                                           +
Sbjct: 356 ------TASQDQESKI-------------------------------------------L 366

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           +F  T+   + VT+ L+  G+    I+G  +Q  R   L  FR+G + I+V TDVAARG+
Sbjct: 367 IFASTKRTCDEVTKYLREDGWPALAIHGDKDQRERDWVLEEFRSGRSPIMVATDVAARGI 426

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           D+  +  VINY +PG+ + ++HR+GRT RAG  G A S  +
Sbjct: 427 DVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 467

>KLLA0F01034g Chr6 (93422..95305) [1884 bp, 627 aa] {ON} similar to
           uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
          Length = 627

 Score =  201 bits (511), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 129/408 (31%), Positives = 205/408 (50%), Gaps = 69/408 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI-E 186
           F S  L  L+L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 161 FHSPPLDPLLLDNIKLARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLSE 220

Query: 187 KLKTHSA------------KIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234
              +  A            K+   AVIL+P+RELA Q +   K+F+  S ++ +++ GG 
Sbjct: 221 SFSSGPASTPEAAGNSYIKKVYPTAVILAPTRELATQIYDEAKKFTYRSWVKPMVVYGGA 280

Query: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294
           S+++Q   M    ++++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 281 SIDNQIKQMRYGCNLLVATPGRLTDLLERRYISLANVKYLVLDEADRMLDMGFEPQIRRI 340

Query: 295 LVA--FPT--NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           +     P+  NRQTL+FSAT PS +   A   L + V + +      SEN+    + ++ 
Sbjct: 341 VEGSDMPSVDNRQTLMFSATFPSEIQHLASDFLKDYVFLSVGRVGSTSENITQKILYVED 400

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
            ++   LL LL  +                                              
Sbjct: 401 FDKNDTLLDLLAAS---------------------------------------------- 414

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
                 +E  T++FV T+   + +T  L   G+  + I+G   Q  R++ L  F+ G  +
Sbjct: 415 ------NEGLTLIFVETKRAADSLTDFLIMEGFKATAIHGDRTQGERERALSAFKTGRAT 468

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWA 518
           ILV T VAARG+DIP + +VIN+ LP     ++HR+GRT RAGN G A
Sbjct: 469 ILVATAVAARGLDIPNVTHVINFDLPNDIDDYVHRIGRTGRAGNTGVA 516

>Skud_15.370 Chr15 (661915..663744) [1830 bp, 609 aa] {ON} YOR204W
           (REAL)
          Length = 609

 Score =  201 bits (510), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 129/431 (29%), Positives = 213/431 (49%), Gaps = 72/431 (16%)

Query: 108 DLNDYFNTTADAAAKHKKGSFASFG---LSKLVLINISKKGFRQPTPIQRKTIPLILQKR 164
           + ++Y +   DA+ K      A F    L  L+L NI    F +PTP+Q+ ++P++   R
Sbjct: 125 NFDNYDDIPVDASGKDVPEPIAEFTSPPLDSLLLENIKLARFTKPTPVQKYSVPIVANGR 184

Query: 165 DIVGMARTGSGKTAAFVLPMI-EKLKT------------HSAKIGVRAVILSPSRELAIQ 211
           D++  A+TGSGKT  F+ P++ E  KT            +  K    AVI++P+RELA Q
Sbjct: 185 DLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQKKAYPTAVIMAPTRELATQ 244

Query: 212 THRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSV 271
                K+F+  S +++ ++ GG  + +Q   +    D+++ATPGR   L     + L +V
Sbjct: 245 IFDESKKFTYRSWVKACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERGKISLSNV 304

Query: 272 EYVVFDEADRLFEMGFQEQLNELL----VAFPTNRQTLLFSATLPSSLVDFAKAGLSNPV 327
           +Y+V DEADR+ +MGF+ Q+  ++    +     RQTL+FSAT P+ +   A+  LS+ +
Sbjct: 305 KYLVLDEADRMLDMGFEPQIRHIVEDCDMTPVGARQTLMFSATFPADIQHLARDFLSDYI 364

Query: 328 LVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXX 387
            + +      SEN+    + ++  ++++ LL LL  +                       
Sbjct: 365 FLSVGRVGSTSENITQKVLYVENQDKKSALLDLLSAS----------------------- 401

Query: 388 XXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSY 447
                                        ++  T++FV T+   + +T  L    +  + 
Sbjct: 402 -----------------------------TDGLTLIFVETKRMADQLTDFLIMQNFRATA 432

Query: 448 IYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVG 507
           I+G   Q  R++ L  FR+G  S+LV T VAARG+DIP + +VINY LP     ++HR+G
Sbjct: 433 IHGDRTQSERERALAAFRSGTASLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIG 492

Query: 508 RTARAGNRGWA 518
           RT RAGN G A
Sbjct: 493 RTGRAGNTGVA 503

>Smik_15.390 Chr15 (672576..674405) [1830 bp, 609 aa] {ON} YOR204W
           (REAL)
          Length = 609

 Score =  201 bits (510), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 129/431 (29%), Positives = 215/431 (49%), Gaps = 72/431 (16%)

Query: 108 DLNDYFNTTADAAAK---HKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKR 164
           + ++Y +   DA+ K        F S  L +L+L NI    F +PTP+Q+ ++P++   R
Sbjct: 125 NFDNYDDIPVDASGKDVPEPITEFTSPPLDELLLENIKLARFTKPTPVQKYSVPIVANGR 184

Query: 165 DIVGMARTGSGKTAAFVLPMI-EKLKT------------HSAKIGVRAVILSPSRELAIQ 211
           D++  A+TGSGKT  F+ P++ E  KT            +  K    AVI++P+RELA Q
Sbjct: 185 DLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQ 244

Query: 212 THRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSV 271
                K+F+  S +++ ++ GG  + +Q   +    D+++ATPGR   L     + L +V
Sbjct: 245 IFDEAKKFTYRSWVKACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERGKISLVNV 304

Query: 272 EYVVFDEADRLFEMGFQEQLNELL----VAFPTNRQTLLFSATLPSSLVDFAKAGLSNPV 327
           +Y+V DEADR+ +MGF+ Q+  ++    +    +RQTL+FSAT P+ +   A+  LS+ +
Sbjct: 305 KYLVLDEADRMLDMGFEPQIRHIVEDCDMTPVGDRQTLMFSATFPADIQHLARDFLSDYI 364

Query: 328 LVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXX 387
            + +      SEN+    + ++  ++++ LL LL  +                       
Sbjct: 365 FLSVGRVGSTSENITQKVLYVENQDKKSALLDLLSAS----------------------- 401

Query: 388 XXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSY 447
                                        ++  T++FV T+   + +T  L    +  + 
Sbjct: 402 -----------------------------TDGLTLIFVETKRMADQLTDFLIMQNFRATA 432

Query: 448 IYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVG 507
           I+G   Q  R++ L  FR+G  S+LV T VAARG+DIP + +VINY LP     ++HR+G
Sbjct: 433 IHGDRTQSERERALAAFRSGAASLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIG 492

Query: 508 RTARAGNRGWA 518
           RT RAGN G A
Sbjct: 493 RTGRAGNTGLA 503

>Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON}
           YGL078C (REAL)
          Length = 518

 Score =  198 bits (504), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 129/400 (32%), Positives = 199/400 (49%), Gaps = 53/400 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF    L   +   ISK  F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 110 SFDHLSLDSSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 167

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
            L     K G++ +++SP+RELA Q +      +    L+   + GG   ++Q   +  +
Sbjct: 168 HLMNDQKKRGIQVLVISPTRELASQIYDNLIILTDKVGLQCCCVYGGVPKDEQRNQLKKS 227

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAF-PTNRQTL 305
             VV+ATPGR L L  E ++DL  V Y+V DE DR+ E GF+E +  ++     + RQTL
Sbjct: 228 -QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEGDRMLEKGFEEDIKNIIRETDASKRQTL 286

Query: 306 LFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDER--EANLLYLLQE 363
           +F+AT P  + + A + + NP+ V +    +++ N ++  I    D R  E  LL LL++
Sbjct: 287 MFTATWPKEVRELASSFMKNPIRVSIGNTDQLTANKKITQIVEVVDPRGKERKLLELLKK 346

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
               P   E                                                 ++
Sbjct: 347 YHSGPKKNEK-----------------------------------------------VLI 359

Query: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483
           F   +     V + LK  GY V+ I+G L+Q  R Q L  F++G +++L+ TDVAARG+D
Sbjct: 360 FALYKKEATRVERNLKYNGYNVAAIHGDLSQQQRTQALSEFKSGKSNLLLATDVAARGLD 419

Query: 484 IPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           IP +  VIN + P + + ++HR+GRT RAG  G A ++ +
Sbjct: 420 IPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 459

>Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 aa]
           {ON} YNL112W (REAL)
          Length = 547

 Score =  199 bits (506), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 125/401 (31%), Positives = 196/401 (48%), Gaps = 53/401 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F   G    VL  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 TFDEAGFPDYVLSEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      +   G   ++L+P+RELA+Q      +F   S +R+  + GG     Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL 233

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
               ++VIATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLLQ 362
           TL++SAT P  +   A   L++P+ V++ + E   S N+  +   +   E+   L   L+
Sbjct: 294 TLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLE 353

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
            A               Q N                                   E  T+
Sbjct: 354 TA--------------SQDN-----------------------------------EYKTL 364

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           VF  T+   + +T+ L+  G+    I+G  +Q  R   L  FR G + I+V TDVAARG+
Sbjct: 365 VFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGI 424

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           D+  +  VINY +PG+ + ++HR+GRT RAG  G A S  +
Sbjct: 425 DVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 465

>Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 bp,
           560 aa] {ON} similar to Ashbya gossypii AFL221C
          Length = 560

 Score =  199 bits (507), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 125/401 (31%), Positives = 197/401 (49%), Gaps = 53/401 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F   G  + VL  + ++GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 124 TFDEAGFPEYVLKEVKEEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 183

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      S   G   ++L+P+RELA+Q  +   +F   S +R+  + GG     Q   +
Sbjct: 184 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKSQQIRDL 243

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
               +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 244 QRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 303

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLLQ 362
           TL++SAT P  +   A+  L +P+ V + + E   S  +  +   I   E+   L+  L 
Sbjct: 304 TLMWSATWPKEVQQLARDYLHDPIQVNIGSLELAASHTITQIVEVISDFEKRDRLVKHLD 363

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
            A K P   ES+I                                              I
Sbjct: 364 IASKDP---ESKI----------------------------------------------I 374

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           +F  T+   + +T  L+  G+    I+G   Q  R   L  FR G + I+V TDVAARG+
Sbjct: 375 IFASTKRTCDDITSYLRQDGWPALAIHGDKQQQERDWVLNEFRCGRSPIMVATDVAARGI 434

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           D+  +  VINY +PG+ + ++HR+GRT RAG  G A S  +
Sbjct: 435 DVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 475

>YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa]
           {ON}  DBP2Essential ATP-dependent RNA helicase of the
           DEAD-box protein family, involved in nonsense-mediated
           mRNA decay and rRNA processing
          Length = 546

 Score =  199 bits (505), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 124/401 (30%), Positives = 196/401 (48%), Gaps = 53/401 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F   G    VL  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 TFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      +   G   ++L+P+RELA+Q      +F   S +R+  + GG     Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL 233

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
               ++VIATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLLQ 362
           TL++SAT P  +   A   L++P+ V++ + E   S N+  +   +   E+   L   L+
Sbjct: 294 TLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLE 353

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
            A               Q N                                   E  T+
Sbjct: 354 TA--------------SQDN-----------------------------------EYKTL 364

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           +F  T+   + +T+ L+  G+    I+G  +Q  R   L  FR G + I+V TDVAARG+
Sbjct: 365 IFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGI 424

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           D+  +  VINY +PG+ + ++HR+GRT RAG  G A S  +
Sbjct: 425 DVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT 465

>YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}
           DBP3RNA-Dependent ATPase, member of DExD/H-box family;
           involved in cleavage of site A3 within the ITS1 spacer
           during rRNA processing; not essential for growth, but
           deletion causes severe slow-growth phenotype
          Length = 523

 Score =  198 bits (503), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 129/400 (32%), Positives = 199/400 (49%), Gaps = 53/400 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF    L   +   ISK  F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 115 SFDYLSLDSSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 172

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
            L     K G++ +++SP+RELA Q +      +    ++   + GG   ++Q  + +  
Sbjct: 173 HLMNDQKKRGIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQ-RIQLKK 231

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAF-PTNRQTL 305
             VV+ATPGR L L  E ++DL  V Y+V DEADR+ E GF+E +  ++     + RQTL
Sbjct: 232 SQVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTL 291

Query: 306 LFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDER--EANLLYLLQE 363
           +F+AT P  + + A   ++NP+ V +    +++ N  +  I    D R  E  LL LL++
Sbjct: 292 MFTATWPKEVRELASTFMNNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLKK 351

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
               P   E                                                 ++
Sbjct: 352 YHSGPKKNEK-----------------------------------------------VLI 364

Query: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483
           F   +     V + LK  GY V+ I+G L+Q  R Q L  F++G +++L+ TDVAARG+D
Sbjct: 365 FALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLD 424

Query: 484 IPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           IP +  VIN + P + + ++HR+GRT RAG  G A ++ +
Sbjct: 425 IPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 464

>Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {ON}
           YBR237W (PRP5) - 1:1 [contig 238] PARTIAL
          Length = 688

 Score =  201 bits (512), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 123/386 (31%), Positives = 205/386 (53%), Gaps = 51/386 (13%)

Query: 146 FRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKT----HSAKIGVRAVI 201
           F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LPM+ ++K        + G   +I
Sbjct: 128 FESPTPIQAQAIPAIMTGRDVIGISKTGSGKTVSFLLPMLRQIKALRPLAREESGPLGLI 187

Query: 202 LSPSRELAIQTHRVFKEFSKGSD-LRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHL 260
           L+P+RELA+Q H    +F KG+  LRSI  TGG  L+ Q   +    ++V+ATPGRF+ L
Sbjct: 188 LAPTRELAVQIHEESMKFLKGNTRLRSICCTGGSELKQQINDLKKGVEIVVATPGRFIDL 247

Query: 261 KVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLV 316
            + +N    ++ + + +VV DEADRLF++GF+ Q+ E++     ++Q +LFSAT PS L 
Sbjct: 248 -LTLNSGKLINTERITFVVMDEADRLFDLGFEPQITEIMKTVRPDKQCVLFSATFPSKLK 306

Query: 317 DFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIK 376
            FA   L  PV + +++++ I+EN+E      + DE + N L    E +K  +  E++  
Sbjct: 307 SFASRILHTPVSITINSKSLINENIEQKLQIHENDEEKFNSLL---EVLKAQINREAE-- 361

Query: 377 KLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQ 436
                                              +++   EK TI+FV ++   + +  
Sbjct: 362 -----------------------------------SHDDKDEK-TIIFVSSQQICDLIYL 385

Query: 437 LLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLP 496
            L +  Y    I+     H R   L  F+     IL+ T+V +RG+++P ++ V+ Y+  
Sbjct: 386 KLLDHNYTTYAIHAGKPYHERASNLEKFKNTRNGILLCTEVLSRGLNVPEVSLVVIYNAV 445

Query: 497 GSSKIFIHRVGRTARAGNRGWAFSIV 522
            +   ++H  GRTAR   +G A S++
Sbjct: 446 KTFAQYVHTTGRTARGDKKGTAISLL 471

>KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129)
           [1665 bp, 554 aa] {ON} similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112W DBP2 Essential
           ATP-dependent RNA helicase of the DEAD-box protein
           family involved in nonsense-mediated mRNA decay and rRNA
           processing
          Length = 554

 Score =  198 bits (503), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 125/405 (30%), Positives = 201/405 (49%), Gaps = 61/405 (15%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF   G    VL  + ++GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 114 SFDEAGFPSYVLDEVKQEGFAKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 173

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      S   G   ++L+P+RELA+Q  +   +F   S +R+  + GG     Q   +
Sbjct: 174 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGASSRIRNTCVYGGVPKSQQIRDL 233

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
               +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 234 QRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVR-----LDAETKISENLEMLFISIKKDEREANLL 358
           TL++SAT P  +   A   L +P+ V+     L A   I++ +E+L    K+D       
Sbjct: 294 TLMWSATWPKEVKQLASDYLHDPIQVQIGSLELSASHTITQIVEVLTDFEKRD------- 346

Query: 359 YLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSE 418
              + A  +  A++ Q  K+                                        
Sbjct: 347 ---RLAKHLETASQDQDSKI---------------------------------------- 363

Query: 419 KATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVA 478
              I+F  T+   + +T  L+  G+    I+G   Q+ R   L  FR+G + I+V TDVA
Sbjct: 364 ---IIFASTKRTCDEITSYLRTEGWPALAIHGDKAQNERDWVLAEFRSGRSPIMVATDVA 420

Query: 479 ARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           ARG+D+  +  VINY +PG+ + ++HR+GRT RAG+ G A S  +
Sbjct: 421 ARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGSTGTAISFFT 465

>Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON}
           YGL078C (REAL)
          Length = 522

 Score =  197 bits (501), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 129/400 (32%), Positives = 199/400 (49%), Gaps = 53/400 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF    L   +   ISK  F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 114 SFDYLSLDPSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 171

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
            L     K G++ +++SP+RELA Q +      +    ++   + GG   ++Q   +  +
Sbjct: 172 HLMNDQKKRGIQVLVISPTRELASQIYDNLIILTDKVGMQCCCVYGGVPKDEQRNQLKKS 231

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL-VAFPTNRQTL 305
             VV+ATPGR L L  E ++DL  V Y+V DEADR+ E GF+E +  ++     + RQTL
Sbjct: 232 -QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETNVSKRQTL 290

Query: 306 LFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDER--EANLLYLLQE 363
           +F+AT P  + + A   + NP+ V +    +++ N ++  I    D R  E  LL LL++
Sbjct: 291 MFTATWPKEVRELASTFMKNPIKVSIGNTDQLTANKKITQIVEVVDPRAKERKLLELLKK 350

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
               P   E                                                 ++
Sbjct: 351 YHSGPKKNEK-----------------------------------------------VLI 363

Query: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483
           F   +     V + LK  GY V+ I+G L+Q  R Q L  F++G +++L+ TDVAARG+D
Sbjct: 364 FALYKKEAARVERNLKYNGYSVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLD 423

Query: 484 IPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           IP +  VIN + P + + ++HR+GRT RAG  G A ++ +
Sbjct: 424 IPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 463

>Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON}
           YGL078C (REAL)
          Length = 516

 Score =  197 bits (500), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 129/400 (32%), Positives = 198/400 (49%), Gaps = 53/400 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF    L+  +   ISK  F  PTPIQ    P +L  +D+VG+A TGSGKT AF +P I 
Sbjct: 108 SFDYLSLNPSIQAEISK--FPTPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 165

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
            L     K G++ +++SP+RELA Q +      +    ++   + GG   ++Q   +   
Sbjct: 166 HLMNDQGKRGIQVLVISPTRELASQIYDNLIILTDKVGMQCCCVYGGVPKDEQRNQLK-R 224

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAF-PTNRQTL 305
             VV+ATPGR L L  E ++DL  V Y+V DEADR+ E GF+E +  ++     + RQTL
Sbjct: 225 SQVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIRNIIRETDASKRQTL 284

Query: 306 LFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDER--EANLLYLLQE 363
           +F+AT P  + + A   + NP+ V +    +++ N ++  I    D R  E  LL LL++
Sbjct: 285 MFTATWPKEVRELASTFMKNPIKVSIGNTDQLTANKKITQIVEVVDPRGKERKLLELLKK 344

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
               P   E                                                 ++
Sbjct: 345 YHSGPKKNEK-----------------------------------------------VLI 357

Query: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483
           F   +     V + LK  GY V+ I+G L+Q  R Q L  F++G +++L+ TDVAARG+D
Sbjct: 358 FALYKKEATRVERNLKYNGYDVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLD 417

Query: 484 IPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           IP +  VIN + P + + ++HR+GRT RAG  G A ++ +
Sbjct: 418 IPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 457

>CAGL0H03377g Chr8 complement(313755..315377) [1623 bp, 540 aa] {ON}
           highly similar to uniprot|P20447 Saccharomyces
           cerevisiae YGL078c DBP3
          Length = 540

 Score =  197 bits (501), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 133/401 (33%), Positives = 207/401 (51%), Gaps = 54/401 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F    L K V   I+K  F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I 
Sbjct: 131 AFNQISLDKEVQNEIAK--FPKPTPIQAVSWPYLLSGKDVIGVAETGSGKTFAFGVPAIN 188

Query: 187 KLKTHSAKI-GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMG 245
            L T S+K  G++ +++SP+RELA Q +      ++   +   ++ GG   +DQ    + 
Sbjct: 189 NLLTSSSKPKGIKVLVISPTRELASQIYDNLVLLTQKVGIDCCVVYGGVPKDDQ-RRQIA 247

Query: 246 NPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQT 304
             +VV+ATPGR L L  E ++DL  V+Y+V DEADR+ E GF+E +  ++    + +RQT
Sbjct: 248 KSNVVVATPGRLLDLIEEGSVDLSPVDYMVLDEADRMLEKGFEEDIKRIIGQTKSKDRQT 307

Query: 305 LLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDER--EANLLYLLQ 362
           L+F+AT P  + + A   +  PV V +    ++S N  +  I    D R  E  LL LL+
Sbjct: 308 LMFTATWPKEVRELASTFMKEPVKVSIGNRDELSANKRITQIVEVVDPRSKERKLLDLLK 367

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
                           K Q+                           P  N+       +
Sbjct: 368 ----------------KYQSG--------------------------PKKND-----KVL 380

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           +F   +     V + L   GY V+ I+G L+Q  R Q L  F++G +++L+ TDVAARG+
Sbjct: 381 IFALYKKEASRVERNLNYNGYKVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGL 440

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           DIP +  VIN + P + + ++HR+GRT RAG  G A ++ +
Sbjct: 441 DIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 481

>TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.148
           YBR237W
          Length = 889

 Score =  203 bits (517), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 125/407 (30%), Positives = 210/407 (51%), Gaps = 46/407 (11%)

Query: 127 SFASFGLSKLVLINISK-KGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI 185
           ++A  GLS L +  I++   F  PTPIQ + IP I+  +DI+G+++TGSGKT A++LP++
Sbjct: 290 NWAQLGLSSLTMNYITQILKFETPTPIQAQAIPAIMSGKDIIGISKTGSGKTIAYILPLL 349

Query: 186 EKLKTHSA----KIGVRAVILSPSRELAIQTHRVFKEFSKGSD--LRSILLTGGDSLEDQ 239
             ++        + G  A++L+P+RELAIQ +     F    +  L SI   GG  L  Q
Sbjct: 350 RHVRAQKPLSRNETGPIALVLAPTRELAIQINDEINNFLSNDNYQLNSICCAGGSDLRGQ 409

Query: 240 FGMMMGNPDVVIATPGRFL---HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLV 296
             ++     +++ATPGR++    L     L+ K + ++V DEADRLF++GF+ Q+++++ 
Sbjct: 410 INIIKKGVSIIVATPGRYIDLLTLNGGNLLNTKRISFIVMDEADRLFDLGFEPQISQIMK 469

Query: 297 AFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKD-EREA 355
               ++  +LFSAT P  L  FA   L++P+ + +D+E  I+EN+E  F   K D E+  
Sbjct: 470 TIRPDKHGVLFSATFPKKLRSFALKALNSPITITIDSENMINENIEQKFKICKSDNEKFN 529

Query: 356 NLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEM 415
           NLL +L +     + + +    +  +N                                 
Sbjct: 530 NLLDILNKHDYENIQSSASRDGISNEN--------------------------------- 556

Query: 416 PSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVT 475
             +K  I+FV ++   E +   L+N G+    I+     + R Q L NFR    SIL+ T
Sbjct: 557 --DKKIIIFVSSQQISELIYNKLENNGFSPFLIHAGKPYNERVQNLENFRRAKNSILLCT 614

Query: 476 DVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           +V +RG+++P  + VI Y+   +   ++H  GRT R   RG A S++
Sbjct: 615 EVLSRGLNVPETSLVIIYNAVKAFAQYVHTTGRTGRGIYRGVAISLL 661

>SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 843

 Score =  202 bits (515), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 126/406 (31%), Positives = 216/406 (53%), Gaps = 45/406 (11%)

Query: 128 FASFGLSKLVLINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           ++  GL+  ++  I+K+  F  PTPIQ + IP I+  RD+VG+++TGSGKT +F+LP++ 
Sbjct: 252 WSQLGLTTDIMDLITKEFKFVTPTPIQAQAIPAIMSGRDVVGISKTGSGKTVSFLLPLLR 311

Query: 187 KLKTH----SAKIGVRAVILSPSRELAIQTHRVFKEFSKGS-DLRSILLTGGDSLEDQFG 241
           ++K        + G   +IL+P+RELA+Q +    +F+ GS  +RSI  TGG  L+ Q  
Sbjct: 312 QIKAQRPLSKTETGPMGLILAPTRELAVQIYEEVVKFTTGSGSIRSICCTGGSELKQQIN 371

Query: 242 MMMGNPDVVIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLVA 297
            +    +VV+ATPGRF+ L + +N    L  + + +VV DEADRLF++GF+ Q+ +++ A
Sbjct: 372 DLKKGVEVVVATPGRFIDL-LTLNSGRLLSTERITFVVMDEADRLFDLGFEPQITQIMKA 430

Query: 298 FPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEM-LFISIKKDEREAN 356
              ++Q +LFSAT P+ L +FA   L  P+ + +++++ I+EN+E  L I    +E+ A 
Sbjct: 431 VRPDKQCVLFSATFPNKLKNFALKILQKPISITINSKSLINENIEQRLKIFQTDNEKFAA 490

Query: 357 LLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMP 416
           +L +L+                                            RR        
Sbjct: 491 MLEVLE------------------------SRNMRDEEAGDDEDNEDDDGRR-------- 518

Query: 417 SEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTD 476
            ++ TIVFV ++   + +   L   GY+   I+     + R   L  F+     IL+ T+
Sbjct: 519 -DEKTIVFVSSQQICDLIYNRLLEHGYVTYAIHAGKPYNERASNLEKFKNTPNGILLCTE 577

Query: 477 VAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           V +RG+++P ++ VI Y+   +   ++H  GRTAR  N+G A +++
Sbjct: 578 VLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGTNKGVALTML 623

>YOR204W Chr15 (722911..724725) [1815 bp, 604 aa] {ON}
           DED1ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA
           helicase, required for translation initiation of all
           yeast mRNAs; mutations in human DEAD-box DBY are a
           frequent cause of male infertility
          Length = 604

 Score =  198 bits (504), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 128/431 (29%), Positives = 213/431 (49%), Gaps = 72/431 (16%)

Query: 108 DLNDYFNTTADAAAK---HKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKR 164
           + ++Y +   DA+ K        F S  L  L+L NI    F +PTP+Q+ ++P++   R
Sbjct: 121 NFDNYDDIPVDASGKDVPEPITEFTSPPLDGLLLENIKLARFTKPTPVQKYSVPIVANGR 180

Query: 165 DIVGMARTGSGKTAAFVLPMI-EKLKT------------HSAKIGVRAVILSPSRELAIQ 211
           D++  A+TGSGKT  F+ P++ E  KT            +  K    AVI++P+RELA Q
Sbjct: 181 DLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQ 240

Query: 212 THRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSV 271
                K+F+  S +++ ++ GG  + +Q   +    D+++ATPGR   L     + L +V
Sbjct: 241 IFDEAKKFTYRSWVKACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERGKISLANV 300

Query: 272 EYVVFDEADRLFEMGFQEQLNELL----VAFPTNRQTLLFSATLPSSLVDFAKAGLSNPV 327
           +Y+V DEADR+ +MGF+ Q+  ++    +     RQTL+FSAT P+ +   A+  LS+ +
Sbjct: 301 KYLVLDEADRMLDMGFEPQIRHIVEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYI 360

Query: 328 LVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXX 387
            + +      SEN+    + ++  ++++ LL LL  +                       
Sbjct: 361 FLSVGRVGSTSENITQKVLYVENQDKKSALLDLLSAS----------------------- 397

Query: 388 XXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSY 447
                                        ++  T++FV T+   + +T  L    +  + 
Sbjct: 398 -----------------------------TDGLTLIFVETKRMADQLTDFLIMQNFRATA 428

Query: 448 IYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVG 507
           I+G   Q  R++ L  FR+G  ++LV T VAARG+DIP + +VINY LP     ++HR+G
Sbjct: 429 IHGDRTQSERERALAAFRSGAATLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIG 488

Query: 508 RTARAGNRGWA 518
           RT RAGN G A
Sbjct: 489 RTGRAGNTGLA 499

>Kwal_56.24005 s56 complement(809954..811555) [1602 bp, 533 aa] {ON}
           YGL078C (DBP3) - ATP-dependent RNA helicase CA3 of the
           DEAD/DEAH box family [contig 168] FULL
          Length = 533

 Score =  197 bits (500), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 131/404 (32%), Positives = 204/404 (50%), Gaps = 60/404 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F    LS  +   ISK  F +PTPIQ  + P +L  +D+VG+A TGSGKT AF +P + 
Sbjct: 124 AFDHISLSPEIQHEISK--FPKPTPIQSVSWPYLLSGKDVVGVAETGSGKTFAFGVPAVN 181

Query: 187 KLKTHSA-KIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMG 245
            L +  A K G++ +++SP+RELA QT+      +K + +    + GG   ++Q   +  
Sbjct: 182 NLMSADAKKKGIQVLVISPTRELASQTYDNLISLTKKAGVNCCCVYGGVPKDEQRAQLK- 240

Query: 246 NPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQT 304
              VV+ATPGR L L  E +  L +V+Y+V DEADR+ E GF+E +  ++ +  +  RQT
Sbjct: 241 KAHVVVATPGRLLDLIEEGSARLSNVDYLVLDEADRMLEKGFEEDIKRIIGSTKSAGRQT 300

Query: 305 LLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFI-----SIKKDEREANLLY 359
           L+F+AT P  + + A   ++NPV V +    ++S N  +  I       KKD +   LL 
Sbjct: 301 LMFTATWPKEVRELASTFMNNPVKVSIGNRDELSANKRITQIVEVIDPFKKDRKLLELLK 360

Query: 360 LLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEK 419
             Q   +              QN                                     
Sbjct: 361 KYQSGAR--------------QNDK----------------------------------- 371

Query: 420 ATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAA 479
             ++F   +     V + LK  GY V+ I+G L+Q  R Q L  F++G +++L+ TDVAA
Sbjct: 372 -VLIFALYKKEAARVERNLKYNGYSVAAIHGDLSQQQRTQALNEFKSGASNLLLATDVAA 430

Query: 480 RGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           RG+DIP +  VIN + P + + ++HR+GRT RAG  G A ++ +
Sbjct: 431 RGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGLTGTAHTLFT 474

>NCAS0B01730 Chr2 complement(286249..288105) [1857 bp, 618 aa] {ON}
           Anc_8.614
          Length = 618

 Score =  198 bits (503), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 125/410 (30%), Positives = 204/410 (49%), Gaps = 70/410 (17%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI- 185
           +F S  L +L+L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ 
Sbjct: 146 AFTSPPLDELLLENIKLARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLS 205

Query: 186 EKLKT-------------HSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTG 232
           E  KT             +  K    AVI++P+RELA Q     K+F   S ++  ++ G
Sbjct: 206 ESFKTGPTVVDNAQSHGYYQKKAYPTAVIMAPTRELATQIFDEAKKFCYRSWVQPCVVYG 265

Query: 233 GDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLN 292
           G  + +Q   M    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+ 
Sbjct: 266 GSPIGNQMREMDRGCDLLVATPGRLSDLIDRGKISLSNVKYLVLDEADRMLDMGFEPQIR 325

Query: 293 ELLVAFPTN----RQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISI 348
            ++          RQTL+FSAT P+ +   A+  L++ + + +      SEN+    + +
Sbjct: 326 AIVEGADMTPVGERQTLMFSATFPADIQHLARDFLADYIFLSVGRVGSTSENITQRVLYV 385

Query: 349 KKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRR 408
           +  ++++ LL LL  +                                            
Sbjct: 386 ENQDKKSALLDLLSAS-------------------------------------------- 401

Query: 409 LPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGL 468
                   ++  T++FV T+   + +T  L    +  + I+G   Q  R++ L  FR+G 
Sbjct: 402 --------NDGLTLIFVETKRMADQLTDFLIMQDFRATAIHGDRTQQERERALAAFRSGR 453

Query: 469 TSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWA 518
            ++LV T VAARG+DIP + +VINY LPG    ++HR+GRT RAGN G A
Sbjct: 454 ANLLVATAVAARGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGVA 503

>Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 aa]
           {ON} YNL112W (REAL)
          Length = 543

 Score =  196 bits (498), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 125/401 (31%), Positives = 197/401 (49%), Gaps = 53/401 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F   G    VL  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 115 TFDEAGFPDYVLSEVKAEGFAKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 174

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      +   G   ++LSP+RELA+Q      +F + S +R+  + GG     Q   +
Sbjct: 175 HINAQPLLAPGDGPIVLVLSPTRELAVQIQTECSKFGQSSRIRNTCVYGGVPKSQQIRDL 234

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
               ++VIATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 235 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 294

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLLQ 362
           TL++SAT P  +   A   L++P+ V++ + E   S  +  L   +   E+   L   L+
Sbjct: 295 TLMWSATWPKEVKQLAADYLNDPIQVQVGSLELAASHTITQLVEVVSDFEKRDRLNKHLE 354

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
                   T SQ  + K                                         T+
Sbjct: 355 --------TASQDDEYK-----------------------------------------TL 365

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           +F  T+   + +T+ L+  G+    I+G  +Q  R   L  FR G + I+V TDVAARG+
Sbjct: 366 IFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGGSPIMVATDVAARGI 425

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           D+  +  VINY +PG+ + ++HR+GRT RAG  G A S  +
Sbjct: 426 DVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAVSFFT 466

>TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {ON}
           Anc_6.148 YBR237W
          Length = 847

 Score =  201 bits (512), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 119/387 (30%), Positives = 206/387 (53%), Gaps = 46/387 (11%)

Query: 146 FRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTH----SAKIGVRAVI 201
           +  PTPIQ + IP I+  RD++G++RTGSGKT +++LP++ ++K      + + G   +I
Sbjct: 278 YDSPTPIQSQAIPAIMSGRDVIGISRTGSGKTISYLLPLLRQIKAQRPLATNETGPLGLI 337

Query: 202 LSPSRELAIQTHRVFKEFSKGS-DLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHL 260
           L+P+RELA+Q H   + F+K    + S+  TGG  L+ Q  M+    ++V+ATPGRF+ L
Sbjct: 338 LAPTRELALQIHEEVELFTKNDLAVNSLCCTGGSELKQQINMLKRGTEIVVATPGRFIDL 397

Query: 261 KVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLV 316
            + +N    L  K + +VV DEADRLF++GF+ Q+ +++     ++Q +LFSAT P+ L 
Sbjct: 398 -LTLNTGKLLTTKRITFVVLDEADRLFDLGFEPQITQIMKTIRPDKQCVLFSATFPNKLR 456

Query: 317 DFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREAN-LLYLLQEAIKMPVATESQI 375
            FA   L  P+ + ++++  ++EN++  F     DE +   LL +L + +K     E   
Sbjct: 457 SFAMRVLRLPLSITINSKNLVNENVKQRFEIFPTDENKYRALLSILDKRMKEEDENEESE 516

Query: 376 KKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVT 435
                                               A++  ++   I+FV ++   +++ 
Sbjct: 517 L-----------------------------------ADDEVNDDKAIIFVSSQQICDFLG 541

Query: 436 QLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSL 495
             L+N GY +  I+       R   L NFR    SIL+ T+V +RG+++P ++ VI Y+ 
Sbjct: 542 TRLENEGYSIHTIHAGKPYQERVNNLQNFRHTRNSILLCTEVLSRGLNVPEVSLVIIYNA 601

Query: 496 PGSSKIFIHRVGRTARAGNRGWAFSIV 522
             +   ++H  GRTAR  N G A +++
Sbjct: 602 VKTFAQYVHTAGRTARGTNSGEAITLL 628

>AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR237W
           (PRP5)
          Length = 816

 Score =  201 bits (511), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 122/406 (30%), Positives = 218/406 (53%), Gaps = 60/406 (14%)

Query: 128 FASFGLSKLVLINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           ++  GL+  ++  ++++  F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LP++ 
Sbjct: 238 WSQLGLNSGIMNLLTRELEFTVPTPIQAQAIPAIMSGRDVIGISKTGSGKTVSFILPLLR 297

Query: 187 KLKTHSA----KIGVRAVILSPSRELAIQTHRVFKEFSKGS-DLRSILLTGGDSLEDQFG 241
           ++K        + G   +ILSP+RELA+Q H    +F+ G   +RS+  TGG  L+ Q  
Sbjct: 298 QIKAQRPLGGDETGPLGLILSPTRELALQIHEEVTKFTSGDPSIRSLCCTGGSELKRQIN 357

Query: 242 MMMGNPDVVIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLVA 297
            +    ++VIATPGRF+ L + +N    ++ K + +VV DEADRLF++GF+ Q+N+++  
Sbjct: 358 DIKRGVEIVIATPGRFIDL-LSLNSGNLINPKRIVFVVMDEADRLFDLGFEPQVNQIMKC 416

Query: 298 FPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEM-LFISIKKDEREAN 356
              ++Q +LFSAT P+ L  FA   L +PV + +++++ I+EN+E  + I   ++++  +
Sbjct: 417 IRPDKQCVLFSATFPNKLKSFASKILHDPVYITVNSKSLINENIEQKVEIFSNEEDKFKS 476

Query: 357 LLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMP 416
           L++ L                L QQN                                  
Sbjct: 477 LIHWL---------------ALTQQNL--------------------------------- 488

Query: 417 SEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTD 476
           +++ TIVFV ++   + +   L+  G+    I+       R   L  F+     IL+ T+
Sbjct: 489 NDEKTIVFVSSQQICDILYNRLEANGFTTFAIHAGKIYTERAWNLKCFKETANGILICTE 548

Query: 477 VAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           V +RG+++P ++ VI Y+   +   ++H  GRTAR  N+G A +++
Sbjct: 549 VLSRGLNVPEVSLVIIYNAAKTFAQYVHTTGRTARGSNKGTALTLL 594

>ZYRO0F10934g Chr6 (890412..892223) [1812 bp, 603 aa] {ON} similar
           to uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
           mutations in human DEAD-box DBY are a frequent cause of
           male infertility
          Length = 603

 Score =  197 bits (500), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 129/413 (31%), Positives = 206/413 (49%), Gaps = 69/413 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI-E 186
           F S  L +L+L NI    F +PTP+Q+ +IP++  KRD++  A+TGSGKT  F+ P++ E
Sbjct: 135 FTSPPLDELLLENIKFAHFVKPTPVQKYSIPIVANKRDLMACAQTGSGKTGGFLFPVLSE 194

Query: 187 KLKTHSAKI--GVR----------AVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234
              T  ++I    R          AV+L+P+RELA Q     K+F+  S +R  ++ GG 
Sbjct: 195 SFFTGPSEIPEAARSSYMRKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRPTVVYGGS 254

Query: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294
            +  Q   +    D+++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 255 DVGSQMRDLDRGCDLLVATPGRLNDLLERGKISLAKVKYLVLDEADRMLDMGFEPQIRNI 314

Query: 295 L--VAFPT--NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           +     P    RQTL+FSAT P  +   A+  LS+ + + +      SEN+    + ++ 
Sbjct: 315 VEGCDMPGVDQRQTLMFSATFPVDIQHLARDFLSDYIFLSVGRVGSTSENITQRVLYVED 374

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
           +++++ LL LL  +                                              
Sbjct: 375 EDKKSALLDLLSAS---------------------------------------------- 388

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
                 S   T++FV T+   + +T  L    +  + I+G   Q  R++ L +F+ G   
Sbjct: 389 ------SGGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALGSFKTGKAD 442

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +LV T VAARG+DIP + +VINY LPG    ++HR+GRT RAGN G A + ++
Sbjct: 443 LLVATAVAARGLDIPNVTHVINYDLPGDVDDYVHRIGRTGRAGNTGLATAFLN 495

>NCAS0E03920 Chr5 complement(769305..770618) [1314 bp, 437 aa] {ON} 
          Length = 437

 Score =  192 bits (487), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 131/412 (31%), Positives = 188/412 (45%), Gaps = 64/412 (15%)

Query: 124 KKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLP 183
           K  +F S GLS+ +   +      QPT IQ+  IP IL+ RD +G A+TGSGKT AF  P
Sbjct: 5   KNATFKSLGLSRWLQEALQAMKINQPTAIQKACIPEILKGRDCIGGAKTGSGKTVAFAAP 64

Query: 184 MIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           M+ K     +  G+  V+L+P+RELA+Q    F       ++R  L+ GG+S+ DQ   +
Sbjct: 65  MLTKWSEDPS--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVALVVGGESIVDQAIQL 122

Query: 244 MGNPDVVIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLVAFP 299
              P  +IATPGR  H  +    D    LK  +++V DEAD L    F   L   + A P
Sbjct: 123 QKKPHFIIATPGRLAHHIMSSGEDTIGGLKRAKFLVLDEADSLLTDTFASDLATCIGALP 182

Query: 300 T--NRQTLLFSATLPSSLVDFAKAGL--SNPVLVRLDAET----KISENLEMLFISIKKD 351
           +   RQTLLF+AT+   +     A +    P L     E+     I   L+  +I + + 
Sbjct: 183 SKDKRQTLLFTATITDQVRALEDAPIQEGKPPLFTYQVESVDKVAIPSTLKTEYILVPEH 242

Query: 352 EREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPN 411
            +EA L  LL                                                  
Sbjct: 243 VKEAYLYQLL-------------------------------------------------- 252

Query: 412 ANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSI 471
             E   + + I+FV      E + + L +    V+ ++  + Q  R   L+ FRA +  +
Sbjct: 253 TCETYKDSSAIIFVNRTMTAEILRRTLYHLEVRVASLHSQMPQQERTNSLHRFRANVARV 312

Query: 472 LVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           L+ TDVA+RG+DIP +  VINY +P     FIHR GRTARAG  G A S V+
Sbjct: 313 LIATDVASRGLDIPTVELVINYDIPADPDTFIHRAGRTARAGRSGDAISFVT 364

>TPHA0B02850 Chr2 complement(650888..652774) [1887 bp, 628 aa] {ON}
           Anc_8.614 YOR204W
          Length = 628

 Score =  196 bits (499), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 127/411 (30%), Positives = 207/411 (50%), Gaps = 69/411 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI-- 185
           F S  L  L+L NI    F +PTP+Q+ ++P++ Q RD++  A+TGSGKT  F+ P++  
Sbjct: 157 FTSPPLDSLLLENIHLARFTKPTPVQKYSVPIVAQGRDLMACAQTGSGKTGGFLFPVLSQ 216

Query: 186 ----------EKLKTHSAKIG-VRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234
                     E LK    + G   A++L+P+RELA Q +   K+F+  S +R +++ GG 
Sbjct: 217 SFKNGPAPVPEDLKRSFLRKGNPTALVLAPTRELATQIYDEAKKFTYRSWVRPVVIYGGS 276

Query: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294
            +  Q   +    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 277 DVGTQIRELERGCDLLVATPGRLNDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIRHI 336

Query: 295 L--VAFP--TNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           +     P   NRQTL+FSAT P  +   A+  L++ + + +      SEN+    + ++ 
Sbjct: 337 VDGCDMPDANNRQTLMFSATFPDDIQHLARDFLNDYIFLSVGRVGSTSENITQRILYVED 396

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
            ++++ LL L        +A E+                                     
Sbjct: 397 MDKKSALLDL--------LAAEN------------------------------------- 411

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
                  +  T++FV T+   + +T  L    ++ + I+G   Q  R++ L  F+ G  +
Sbjct: 412 -------DGLTLIFVETKRMADELTDFLIMQDFMATAIHGDRTQIERERALAAFKGGRAN 464

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSI 521
           +LV T VAARG+DIP + +VINY LP     ++HR+GRT RAGN G A S 
Sbjct: 465 VLVATAVAARGLDIPNVTHVINYDLPTDIDDYVHRIGRTGRAGNTGVATSF 515

>NDAI0E01590 Chr5 complement(315658..317484) [1827 bp, 608 aa] {ON} 
          Length = 608

 Score =  196 bits (497), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 126/407 (30%), Positives = 203/407 (49%), Gaps = 68/407 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI-E 186
           F S  L +L+L NI    F +PTP+Q+ +IP++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 137 FTSPPLDELLLENIQLARFTKPTPVQKYSIPIVAAGRDLMACAQTGSGKTGGFLFPVLSE 196

Query: 187 KLKT-----------HSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDS 235
             KT           +  K    AV+++P+RELA Q     K+F   S ++  +  GG  
Sbjct: 197 SFKTGPTATHDQGSYYQKKAFPTAVVMAPTRELATQIFDEAKKFCYRSWVQPCVAYGGAP 256

Query: 236 LEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL 295
           + +Q   M    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  ++
Sbjct: 257 IGNQMREMDRGCDLLVATPGRLSDLIDRGKISLSNVKYLVLDEADRMLDMGFEPQIRAIV 316

Query: 296 VAFPTN----RQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKD 351
                     RQTL+FSAT P+ +   A+  L++ + + +      SEN+    + ++  
Sbjct: 317 EGADMTPVGERQTLMFSATFPADIQHLARDFLADYIFLSVGRVGSTSENITQRVLYVENQ 376

Query: 352 EREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPN 411
           ++++ LL LL        A+E  +                                    
Sbjct: 377 DKKSALLDLLS-------ASEDGL------------------------------------ 393

Query: 412 ANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSI 471
                    T++FV T+   + +T  L    +  + I+G   Q  R++ L  F++G  ++
Sbjct: 394 ---------TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALAAFKSGAATL 444

Query: 472 LVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWA 518
           LV T VAARG+DIP + +VINY LPG    ++HR+GRT RAGN G A
Sbjct: 445 LVATAVAARGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGIA 491

>TDEL0A05590 Chr1 (980392..982185) [1794 bp, 597 aa] {ON} Anc_8.614
           YOR204W
          Length = 597

 Score =  195 bits (496), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 124/406 (30%), Positives = 203/406 (50%), Gaps = 69/406 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI-E 186
           F S  L +L+L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 142 FTSPPLDELLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 201

Query: 187 KLKTHSAKIGVRA------------VILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234
              T  ++I   A            V+L+P+RELA Q     K+F+  S +R+ ++ GG 
Sbjct: 202 SFSTGPSEIPENARGGYMRKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRATVVYGGA 261

Query: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294
            +  Q   +    D+++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 262 DVGSQMRELDRGCDLLVATPGRLNDLLERGKISLAKVKYLVLDEADRMLDMGFEPQIRHI 321

Query: 295 L--VAFPT--NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           +     P   +RQTL+FSAT P  +   A+  LS+ + + +      SEN+    + ++ 
Sbjct: 322 VEGCDMPGVEDRQTLMFSATFPVDIQHLARDFLSDYIFLSVGRVGSTSENITQHVLYVED 381

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
           +++++ LL L+  A                                              
Sbjct: 382 EDKKSALLDLISSA---------------------------------------------- 395

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
                 ++  T++FV T+   + +T  L    +  + I+G   Q  R++ L  FR+G  +
Sbjct: 396 ------TDGLTLIFVETKRMADQLTDFLIMQNFAATAIHGDRTQGERERALAAFRSGKAN 449

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRG 516
           +LV T VAARG+DIP + +VINY LP     ++HR+GRT RAGN G
Sbjct: 450 LLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTG 495

>TBLA0E04100 Chr5 (1032727..1035327) [2601 bp, 866 aa] {ON}
           Anc_8.614 YOR204W
          Length = 866

 Score =  199 bits (505), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 128/424 (30%), Positives = 212/424 (50%), Gaps = 78/424 (18%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F S  L  L++ NI    F +PTPIQ+ +IP++ Q RD++  A+TGSGKT AF+ P++ K
Sbjct: 359 FTSPPLDNLLVENIKLARFNKPTPIQKYSIPIVNQGRDLMACAQTGSGKTDAFLFPILSK 418

Query: 188 L------------------------KTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGS 223
                                    K  +  I    +IL+P+RELA Q     ++FS  S
Sbjct: 419 AFSLGPSINNNNDNDNDANQYNKISKYRAKNIKPIILILAPTRELANQIFEEARKFSYRS 478

Query: 224 DLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF 283
            +R  ++ GG ++  Q   +     +++ATPGR   L     + L +++Y++ DEADR+ 
Sbjct: 479 WIRPCVVYGGTNIFTQMKNLENGSQLLVATPGRLNDLMERGKISLSNIKYLILDEADRML 538

Query: 284 EMGFQEQLNELL----VAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISE 339
           +MGF+ Q+ +++    +   T+RQTL+FSAT PS++ + A   L++ + + +      ++
Sbjct: 539 DMGFELQIRQIVEHYDMPIATSRQTLMFSATFPSNIQNLAGDFLNDYIFLSVGKIGSTTD 598

Query: 340 NLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXX 399
           N+      ++++E++  LL LL          +S+  K KQ                   
Sbjct: 599 NIIQHIYYVRQEEKDNTLLDLL----------DSKNYKKKQ------------------- 629

Query: 400 XXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQ 459
                                T++FV T+   + +T LL   GY  + I+G   Q  R++
Sbjct: 630 ---------------------TLIFVETKRSADALTDLLIIEGYKATAIHGDRTQLERER 668

Query: 460 QLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAF 519
            L  F+    ++LV T VAARG+DIP +A+V+NY LP +   ++HR+GRT R GN G A 
Sbjct: 669 ALTAFKTKRANVLVATSVAARGLDIPNVAHVLNYDLPNNIDDYVHRIGRTGRVGNIGMAT 728

Query: 520 SIVS 523
           S  +
Sbjct: 729 SFFN 732

>SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [1725
           bp, 574 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 574

 Score =  194 bits (492), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 121/401 (30%), Positives = 194/401 (48%), Gaps = 53/401 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F   G    VL  +  +GF  PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 139 TFDEAGFPDYVLSEVKAQGFPSPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 198

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +          G   ++L+P+RELA+Q  +   +F K S +R+  + GG     Q   +
Sbjct: 199 HINAQPLLGPGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRDL 258

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
               ++ IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 259 QRGAEICIATPGRLIDMLEMGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 318

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLLQ 362
           TL++SAT P  +   A+  L + + V + + E   S N+  +   +   ++   L+    
Sbjct: 319 TLMWSATWPKEVQQLAQDYLHDYIQVNVGSLELAASHNITQVIEVVSDFDKRDRLVK--- 375

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
               M VA++                                            +E   +
Sbjct: 376 ---HMEVASQD-------------------------------------------AESKIL 389

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           VF  T+   + +T+ L+  G+    I+G   Q  R   L  FR+G + I+V TDVAARG+
Sbjct: 390 VFASTKRMCDEITKYLREDGWPALAIHGDKQQQERDWVLEEFRSGRSPIMVATDVAARGI 449

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           D+  +  VINY +PG+ + ++HR+GRT RAG  G A S  S
Sbjct: 450 DVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFS 490

>NDAI0B00900 Chr2 complement(209012..210322) [1311 bp, 436 aa] {ON}
           Anc_5.69
          Length = 436

 Score =  190 bits (483), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 133/412 (32%), Positives = 189/412 (45%), Gaps = 64/412 (15%)

Query: 124 KKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLP 183
           K+ +F S GLSK +  ++S     QPT IQ   IP IL+ RD +G A+TGSGKT AF  P
Sbjct: 5   KQETFKSLGLSKWLYESLSAMKITQPTAIQSACIPEILKGRDCIGGAKTGSGKTIAFAGP 64

Query: 184 MIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           M+ K        G+  V+L+P+RELA+Q    F       ++R  ++ GG S+ +Q   +
Sbjct: 65  MLTKWSEDPC--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVAIVVGGQSIVEQAIQL 122

Query: 244 MGNPDVVIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLVAFP 299
              P  +IATPGR  H  +    D    LK  +++V DEAD L    F   L   + A P
Sbjct: 123 QNKPHFIIATPGRLAHHIMNSGEDTVGGLKRTKFLVLDEADSLLTDSFAGDLATCIGALP 182

Query: 300 T--NRQTLLFSATLPSSL--VDFAKAGLSNPVLVRLDAET----KISENLEMLFISIKKD 351
               RQTLLF+AT+   +  ++ A A    P +     E+     I   L+  +I + + 
Sbjct: 183 PKHKRQTLLFTATITDQVRTLENAPAQDGKPSVFTYQVESVDKVAIPSTLKTEYILVPEH 242

Query: 352 EREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPN 411
            +EA L  LL                                                  
Sbjct: 243 VKEAYLYQLL-------------------------------------------------- 252

Query: 412 ANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSI 471
             E   + + I+FV      E + + L +    V+ ++  + Q  R   L+ FRA    +
Sbjct: 253 TCETYKDSSAIIFVNRAMTAEVLRRTLYHLDVRVASLHSYMPQQERTNSLHRFRANAARV 312

Query: 472 LVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           LV TDVAARG+DIP++  VINY +P     FIHR GRTARAG  G A S V+
Sbjct: 313 LVATDVAARGLDIPIVELVINYDIPSDPDTFIHRAGRTARAGRSGDAISFVT 364

>AFL080W Chr6 (288205..289812) [1608 bp, 535 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL078C (DBP3)
          Length = 535

 Score =  192 bits (489), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 132/404 (32%), Positives = 202/404 (50%), Gaps = 60/404 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF+   L   +   ISK  F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I 
Sbjct: 126 SFSHLNLHSAIQKEISK--FPKPTPIQAVSWPYLLAGKDVIGVAETGSGKTFAFGVPAIN 183

Query: 187 KLKTH-SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGG---DSLEDQFGM 242
            L +  S   GV+ +++SP+RELA Q +    + +    L    + GG   DS  +Q   
Sbjct: 184 SLMSEKSTPRGVKCLVISPTRELASQIYDNLVQLTDKVGLNCCCVYGGVQKDSQREQ--- 240

Query: 243 MMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTN- 301
            +    VV+ATPGR L L  E +  L  V+Y+V DEADR+ E GF+E +  ++    ++ 
Sbjct: 241 -LKKAQVVVATPGRLLDLIEEGSAKLAGVQYLVLDEADRMLEKGFEEDIKRIIKETKSDV 299

Query: 302 RQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISEN--LEMLFISIKKDEREANLLY 359
           RQTL+F+AT P  + + A   +  PV V +    ++S N  +  +   I   ++E  LL 
Sbjct: 300 RQTLMFTATWPKEVRELASTFMRAPVKVSIGNRDELSANKRITQVVEVIDPFKKEKRLLE 359

Query: 360 LLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEK 419
           LL++        +S  KK                                          
Sbjct: 360 LLKQ-------YQSGAKK----------------------------------------ND 372

Query: 420 ATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAA 479
             ++F   +     V + LK  GY V+ I+G L+Q  R Q L  F+AG  ++L+ TDVAA
Sbjct: 373 KVLIFALYKKEASRVERNLKYNGYNVAAIHGDLSQQQRTQALSEFKAGTANLLLATDVAA 432

Query: 480 RGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           RG+DIP +  VIN + P + + ++HR+GRT RAG  G A ++ +
Sbjct: 433 RGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGATGVAHTLFT 476

>ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} similar
           to uniprot|P21372 Saccharomyces cerevisiae YBR237W PRP5
           RNA helicase in the DEAD-box family
          Length = 831

 Score =  198 bits (503), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 125/395 (31%), Positives = 212/395 (53%), Gaps = 45/395 (11%)

Query: 137 VLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTH----S 192
           VLIN  K  F  PT IQ + IP I+  RD++G+++TGSGKT +++LP+I  +K      S
Sbjct: 254 VLINDLK--FENPTSIQAQAIPAIMCGRDVIGISKTGSGKTISYLLPLIRHIKAQRHLAS 311

Query: 193 AKIGVRAVILSPSRELAIQTHRVFKEFS-KGSDLRSILLTGGDSLEDQFGMMMGNPDVVI 251
            + G   ++L+P+RELAIQ +    +F+ K   + S+  TGG  L++Q   +    ++V+
Sbjct: 312 DESGPLGLVLAPTRELAIQINEEVTKFTAKDKSVNSVCCTGGSELKEQIRKLKKGIEIVV 371

Query: 252 ATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLF 307
           ATPGRF+ L + +N    L  + + +V+ DEADRLF+MGF+ Q+ +++     ++Q +LF
Sbjct: 372 ATPGRFIDL-LTLNTGKLLSTRRITFVIMDEADRLFDMGFEPQITQIMKTIRPDKQCVLF 430

Query: 308 SATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKM 367
           SAT P+ L +FA   L  P+ + +++++ ++EN+   F     DE + N L  + E    
Sbjct: 431 SATFPNKLRNFAMRVLHRPLSITINSKSLVNENVTQRFDIANSDEEKFNTLLRILEK--- 487

Query: 368 PVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPT 427
               ES      QQ+                            N +E   EKA I+FV +
Sbjct: 488 --HEESSNGVPMQQDW---------------------------NDSENKDEKA-IIFVSS 517

Query: 428 RHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLL 487
           +   + +   L+N GY +  I+       R   L NF++   SIL+ T+V +RG+++P +
Sbjct: 518 QQICDLLHIKLENEGYTIYSIHAGKPYQERLNNLENFKSTPNSILLCTEVLSRGLNVPEV 577

Query: 488 ANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           + V+ Y+   +   ++H  GRTAR  + G A +++
Sbjct: 578 SLVLIYNAVKTFAQYVHTTGRTARGTHTGVAMTLL 612

>Smik_6.318 Chr6 (498013..499854) [1842 bp, 613 aa] {ON} YPL119C
           (REAL)
          Length = 613

 Score =  194 bits (493), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 125/412 (30%), Positives = 202/412 (49%), Gaps = 71/412 (17%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI-- 185
           F S  L  L++ NI   GF +PTP+Q+ +IP++ + RD++  A+TGSGKT  F+ P+   
Sbjct: 152 FGSPPLDALLMENIKLAGFNKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTE 211

Query: 186 ----------EKLKTHSAKIGV-RAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234
                     EK ++  ++ G   A++L+P+RELA Q     ++F+  S +R  ++ GG 
Sbjct: 212 LFRFGPSPVPEKTQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGA 271

Query: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294
            + +Q   +    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  +
Sbjct: 272 PIGNQMREVDRGCDLLVATPGRLNDLLERGKISLANIKYLVLDEADRMLDMGFEPQIRHI 331

Query: 295 L--VAFPT--NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           +     P+  NRQTL+FSAT P  +   A+  L N + + +      SEN+    + +  
Sbjct: 332 VEGCDMPSVGNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDD 391

Query: 351 -DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRL 409
            D++ A L  L  E   +                                          
Sbjct: 392 LDKKSALLDLLSAEHTGL------------------------------------------ 409

Query: 410 PNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLT 469
                      T++FV T+   + +T  L    +  + I+G   Q  R++ L+ F+  + 
Sbjct: 410 -----------TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALFAFKTNVA 458

Query: 470 SILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSI 521
            ILV T VAARG+DIP + +VINY LP     ++HR+GRT RAGN G A S 
Sbjct: 459 DILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVASSF 510

>CAGL0L02915g Chr12 complement(342831..344684) [1854 bp, 617 aa]
           {ON} highly similar to uniprot|P06634 Saccharomyces
           cerevisiae YOR204w DED1 ATP-dependent RNA helicase
          Length = 617

 Score =  194 bits (492), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 125/408 (30%), Positives = 201/408 (49%), Gaps = 69/408 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI-E 186
           F S  L  L+L NI    F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F+ P++ E
Sbjct: 147 FTSPPLDSLLLENIKLARFTKPTPVQKYSVPIVSKGRDLMACAQTGSGKTGGFLFPVLSE 206

Query: 187 KLKTHSAKIGVR------------AVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234
              T  A+                AV+++P+RELA Q     K+F   S ++  ++ GG 
Sbjct: 207 SFLTGPAEKAANDGYSYQRKAFPTAVVMAPTRELATQIFDEAKKFCYRSWVKPCVVYGGA 266

Query: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294
            + +Q   M    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 267 PIGNQMREMDHGCDLLVATPGRLNDLLERGKVSLSNVKYLVLDEADRMLDMGFEPQIRHI 326

Query: 295 LVAF---PTN-RQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           +      PT  RQTL+FSAT P  +   A+  L + + + +      SEN+    + ++ 
Sbjct: 327 VEDCDMPPTGERQTLMFSATFPHDIQHLARDFLHDYIFLSVGRVGSTSENITQRILYVEN 386

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
            ++ + LL LL  +                                              
Sbjct: 387 RDKNSALLDLLAAS---------------------------------------------- 400

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
                 ++  T++FV T+   + +T  L    +  + I+G  +Q  R++ L  FR+G  +
Sbjct: 401 ------NDNLTLIFVETKRMADQLTDFLIMQNFSATAIHGDRSQAERERALAAFRSGRAN 454

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWA 518
           ILV T VAARG+DIP + +VINY LP     ++HR+GRT RAGN G A
Sbjct: 455 ILVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGVA 502

>Kpol_1033.40 s1033 complement(104203..105795) [1593 bp, 530 aa]
           {ON} complement(104203..105795) [1593 nt, 531 aa]
          Length = 530

 Score =  191 bits (486), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 135/429 (31%), Positives = 210/429 (48%), Gaps = 63/429 (14%)

Query: 108 DLNDYFNTTADAAAKHKKG------SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLIL 161
           +++++F T   A     K       SF+   L   +   ISK  F +PTPIQ  + P +L
Sbjct: 93  EIDEFFTTNEVAVEDESKLNLRPLLSFSHISLDSRIQAEISK--FPKPTPIQAVSWPYLL 150

Query: 162 QKRDIVGMARTGSGKTAAFVLPMIEKLKTHSA----KIGVRAVILSPSRELAIQTHRVFK 217
             +D++G+A TGSGKT AF +P I  + T S     K G++ +I+SP+RELA Q +    
Sbjct: 151 AGKDVIGVAETGSGKTFAFGVPAINNILTKSGSKPGKNGIQVLIISPTRELASQIYDNLV 210

Query: 218 EFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFD 277
             +    L    + GG   ++Q    +    VV+ATPGR L L  E   +L +V Y+V D
Sbjct: 211 ILTDKVGLECCCVYGGVPKDEQ-RTQLKRSQVVVATPGRLLDLIQEGAANLSNVNYLVLD 269

Query: 278 EADRLFEMGFQEQLNELLVAF-PTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETK 336
           EADR+ E GF+E +  ++     T RQTL+F+AT P  + + A   +++P+ V +    +
Sbjct: 270 EADRMLEKGFEEDIKNIIRETKSTGRQTLMFTATWPKEVRELASTFMNSPIKVSIGNTDE 329

Query: 337 ISEN--LEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXX 394
           +S N  +  +   I   ++E  LL LL++        +S  KK                 
Sbjct: 330 LSANKRITQIVEVIDPFKKERKLLELLKKY-------QSGSKK----------------- 365

Query: 395 XXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQ 454
                                  +   ++F   +     V + L   GY VS I+G L+Q
Sbjct: 366 -----------------------DDKVLIFALYKKEAARVERNLNYNGYKVSAIHGDLSQ 402

Query: 455 HARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGN 514
             R   L  F+ G +SIL+ TDVAARG+DIP +  VIN + P + + ++HR+GRT RAG 
Sbjct: 403 QQRTNALDEFKTGRSSILLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGK 462

Query: 515 RGWAFSIVS 523
            G A ++ +
Sbjct: 463 TGTAHTLFT 471

>YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA
           helicase in the DEAD-box family, necessary for
           prespliceosome formation, bridges U1 and U2 snRNPs and
           enables stable U2 snRNP association with intron RNA
          Length = 849

 Score =  197 bits (500), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 116/406 (28%), Positives = 222/406 (54%), Gaps = 44/406 (10%)

Query: 128 FASFGLSKLVLINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           ++  GLS   ++ I++K  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 257 WSQLGLSTDTMVLITEKLHFGSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLR 316

Query: 187 KLKTH----SAKIGVRAVILSPSRELAIQTHRVFKEFSKG-SDLRSILLTGGDSLEDQFG 241
           ++K        + G   +IL+P+RELA+Q H    +F++  + +RS+  TGG  ++ Q  
Sbjct: 317 QVKAQRPLSKHETGPMGLILAPTRELALQIHEEVTKFTEADTSIRSVCCTGGSEMKKQIT 376

Query: 242 MMMGNPDVVIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLVA 297
            +    ++V+ATPGRF+ + + +N    L  K + +VV DEADRLF++GF+ Q+ +++  
Sbjct: 377 DLKRGTEIVVATPGRFIDI-LTLNDGKLLSTKRITFVVMDEADRLFDLGFEPQITQIMKT 435

Query: 298 FPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLF-ISIKKDEREAN 356
              ++Q +LFSAT P+ L  FA   L +P+ + ++++  ++EN++  F I   +DE+  N
Sbjct: 436 VRPDKQCVLFSATFPNKLRSFAVRVLHSPISITINSKGMVNENVKQKFRICHSEDEKFDN 495

Query: 357 LLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMP 416
           L+ L+ E  +          +++ +N                            +  E+ 
Sbjct: 496 LVQLIHERSEF-------FDEVQSENDGQSS-----------------------DVEEVD 525

Query: 417 SEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTD 476
           ++   I+FV +++  +++++ L N G +   I+       R   L  F+    SIL+ T+
Sbjct: 526 AK--AIIFVSSQNICDFISKKLLNAGIVTCAIHAGKPYQERLMNLEKFKREKNSILLCTE 583

Query: 477 VAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           V +RG+++P ++ VI Y+   +   ++H  GRTAR    G A +++
Sbjct: 584 VLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 629

>TBLA0B04200 Chr2 complement(970057..971952) [1896 bp, 631 aa] {ON}
           Anc_8.614 YOR204W
          Length = 631

 Score =  193 bits (491), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 128/408 (31%), Positives = 202/408 (49%), Gaps = 69/408 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI-E 186
           F S  L+ L++ NI    F +PTP+Q+ +IP++ Q RD++  A+TGSGKT  F+ P++ E
Sbjct: 157 FTSPPLADLLMENIKLAHFTKPTPVQKYSIPIVEQGRDLMACAQTGSGKTGGFLFPVLSE 216

Query: 187 KLKTHSA------------KIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234
              T  A            K    AVIL+P+RELA Q     K+F+  S ++  ++ GG 
Sbjct: 217 SFSTGPADLPENTQSSYMRKAYPTAVILAPTRELATQIFDEAKKFTYRSWVKPCVVYGGA 276

Query: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294
            + +Q   +     +++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 277 DIRNQIRELERGCALLVATPGRLNDLLERGRISLANVKYLVLDEADRMLDMGFEPQIRHI 336

Query: 295 L--VAFPT--NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           +     P    RQTL+FSAT P  +   A+  LS+ + + +      SEN+    + ++ 
Sbjct: 337 VDGCDMPPAGERQTLMFSATFPDDIQHLARDFLSDYIFLSVGRVGSTSENITQHILYVED 396

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
            ++++ LL LL        A+ S +                                   
Sbjct: 397 MDKKSALLDLLS-------ASNSGL----------------------------------- 414

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
                     T++FV T+   + +T  L    +  + I+G   Q  R++ L+ FR G   
Sbjct: 415 ----------TLIFVETKRMADELTDFLIMQNFRATAIHGDRTQSERERALHAFRNGRAD 464

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWA 518
           +LV T VAARG+DIP + +VINY LP     ++HR+GRT RAGN G A
Sbjct: 465 LLVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGTA 512

>NDAI0I01150 Chr9 (278832..280403) [1572 bp, 523 aa] {ON} Anc_6.204
          Length = 523

 Score =  191 bits (484), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 122/387 (31%), Positives = 199/387 (51%), Gaps = 57/387 (14%)

Query: 146 FRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKL-KTHSAKI-----GVRA 199
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P I+ L KT+ +       G++ 
Sbjct: 126 FPKPTPIQAVSWPYLLSGKDVIGVAETGSGKTFAFGVPAIDYLVKTNQSNNKKNSGGIQV 185

Query: 200 VILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLH 259
           +++SP+RELA Q +      ++   L+   + GG   E Q  + +    VV+ATPGR L 
Sbjct: 186 LVISPTRELASQIYDNLIILTEKVGLQCCCVYGGVPKEAQ-RIQLKKSQVVVATPGRLLD 244

Query: 260 LKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL-VAFPTNRQTLLFSATLPSSLVDF 318
           L  E +++L +V+Y+V DEADR+ E GF+E +  ++    P  RQTL+F+AT P  + + 
Sbjct: 245 LIQEGSVNLSAVKYLVLDEADRMLEKGFEEDIKNIIRETSPKGRQTLMFTATWPKEVREL 304

Query: 319 AKAGLSNPVLVRLDAETKISEN--LEMLFISIKKDEREANLLYLLQEAIKMPVATESQIK 376
           A + ++ PV V +    +++ N  +  +   I    ++  LL LL++    P   +    
Sbjct: 305 ASSFMNEPVKVSIGNRDELTANKRITQIVEVIDPQRKDRKLLDLLKKYHSGPTKNDK--- 361

Query: 377 KLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQ 436
                                                        ++F   +     V +
Sbjct: 362 --------------------------------------------VLIFALYKKEAARVER 377

Query: 437 LLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLP 496
            LK  GY V+ I+G L+Q  R + L  F+AG T++L+ TDVAARG+DIP +  VIN + P
Sbjct: 378 NLKYNGYEVAAIHGDLSQEQRTRALGEFKAGKTNLLLATDVAARGLDIPNVKTVINLTFP 437

Query: 497 GSSKIFIHRVGRTARAGNRGWAFSIVS 523
            + + ++HR+GRT RAG  G A ++ +
Sbjct: 438 LTVEDYVHRIGRTGRAGQTGTAHTLFT 464

>KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 811

 Score =  196 bits (497), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 122/406 (30%), Positives = 211/406 (51%), Gaps = 56/406 (13%)

Query: 128 FASFGLSKLVLINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           ++  GL+  ++  I+K+  F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LP++ 
Sbjct: 234 WSQLGLTTDIMDLITKEFAFVSPTPIQAQAIPAIMAGRDVIGISKTGSGKTVSFLLPLLR 293

Query: 187 KLKT----HSAKIGVRAVILSPSRELAIQTHRVFKEF-SKGSDLRSILLTGGDSLEDQFG 241
           ++K      S + G   +IL+P+RELA+Q H   ++F +  S LRSI  TGG  L+ Q  
Sbjct: 294 QIKALRPLTSGETGPMGLILAPTRELAVQIHEETEKFLNPVSKLRSICCTGGSELKQQIK 353

Query: 242 MMMGNPDVVIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLVA 297
            +    ++V+ATPGRF+ L + +N    L+ + V +VV DEADRLF++GF+ Q+ E++  
Sbjct: 354 ELKKGVEIVVATPGRFIDL-LTLNSGKLLNTERVTFVVMDEADRLFDLGFEPQITEIMKT 412

Query: 298 FPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDERE-AN 356
              ++Q +LFSAT P+ L  FA   L  P+ + +++++ I+EN+E        DE +   
Sbjct: 413 IRPDKQCVLFSATFPTKLKSFASRILDRPISITINSKSLINENIEQQLRIYDNDESKFEG 472

Query: 357 LLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMP 416
           LL +L++  +M    E                                            
Sbjct: 473 LLDILRKQTQMSSDDE-------------------------------------------- 488

Query: 417 SEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTD 476
            ++  IVF+ ++   + +   L+   Y    I+     + R   L  F+     IL+ T+
Sbjct: 489 RDEKIIVFLSSQQICDLIYYRLQEQNYTTYAIHAGKPYNERASSLEKFKNTKNGILLCTE 548

Query: 477 VAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           V +RG+++P ++ VI Y+   +   ++H  GRTAR    G A +++
Sbjct: 549 VLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGDKHGTAVTLL 594

>SAKL0H08162g Chr8 complement(702292..704166) [1875 bp, 624 aa] {ON}
           similar to uniprot|P06634 Saccharomyces cerevisiae
           YOR204W DED1 ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box
           RNA helicase required for translation initiation of all
           yeast mRNAs mutations in human DEAD-box DBY are a
           frequent cause of male infertility
          Length = 624

 Score =  192 bits (489), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 124/408 (30%), Positives = 205/408 (50%), Gaps = 69/408 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F S  L++L+L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +
Sbjct: 153 FTSPPLNELLLDNIKSARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLSE 212

Query: 188 --------LKTHSAKIGVR-----AVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234
                   +   ++   +R     AV+L+P+RELA Q     K+F+  S ++  ++ GG 
Sbjct: 213 SFNNGPAPVPEQASSFYIRKAYPTAVVLAPTRELATQIFDEAKKFTYRSWVKPCVVYGGA 272

Query: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294
            +  Q   +    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 273 DIRSQIRELERGCDLLVATPGRLNDLLERGKISLCNVKYLVLDEADRMLDMGFEPQIRHI 332

Query: 295 L--VAFPT--NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           +     P+  NRQTL+FSAT P  +   A+  L + + + +      SEN+    + ++ 
Sbjct: 333 VQDCDMPSAENRQTLMFSATFPMDIQHLARDFLEDYIFLSVGRVGSTSENITQKVLYVED 392

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
            ++ + LL LL        AT+  +                                   
Sbjct: 393 ADKRSALLDLL-------AATDGGL----------------------------------- 410

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
                     T++FV T+   + +T  L       + I+G  +Q  R++ L  FR+G  +
Sbjct: 411 ----------TLIFVETKRMADALTDFLIMQELKATAIHGDRSQPERERALAAFRSGRAN 460

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWA 518
           +LV T VAARG+DIP + +VINY LP     ++HR+GRT RAGN G A
Sbjct: 461 LLVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVA 508

>Smik_8.253 Chr8 (419155..420468) [1314 bp, 437 aa] {ON} YHR169W
           (REAL)
          Length = 437

 Score =  187 bits (475), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 135/409 (33%), Positives = 185/409 (45%), Gaps = 66/409 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F S GLSK +  ++      QPT IQR  IP IL+ RD +G A+TGSGKT AF  PM+ K
Sbjct: 10  FKSLGLSKWLTESLKAMKITQPTAIQRACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTK 69

Query: 188 LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNP 247
                   G+  V+L+P+RELA+Q    F       ++R  ++ GG+S+  Q   +   P
Sbjct: 70  WSEDPC--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSVVVGGESIVQQALDLQRKP 127

Query: 248 DVVIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT--N 301
             +IATPGR  H  +    D    L   +Y+V DEAD L    F   L   + A P    
Sbjct: 128 HFIIATPGRLAHHIMSSGDDTVGGLMRTKYLVLDEADILLTSTFAGHLATCIGALPPKDK 187

Query: 302 RQTLLFSATLPS---SLVDFAKAGLSNPVLVRLDAET----KISENLEMLFISIKKDERE 354
           RQTLLF+AT+     SL D A A  + P L     E+     I   L+  +I + +  +E
Sbjct: 188 RQTLLFTATITDQVRSLQD-APAQEAKPPLFAYQVESVDNVAIPSTLKTEYILVPEHVKE 246

Query: 355 ANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANE 414
           A L  LL                                                    E
Sbjct: 247 AYLYQLL--------------------------------------------------TCE 256

Query: 415 MPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVV 474
               K  I+FV      E + + LK     V+ ++  + Q  R   L+ FRA    +L+ 
Sbjct: 257 EYENKTAIIFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARVLIA 316

Query: 475 TDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           TDVA+RG+DIP +  V+NY +P    +FIHR GRTARAG  G A S V+
Sbjct: 317 TDVASRGLDIPTVELVVNYDIPSDPDVFIHRAGRTARAGRNGDAISFVT 365

>Skud_8.233 Chr8 (413556..414869) [1314 bp, 437 aa] {ON} YHR169W
           (REAL)
          Length = 437

 Score =  187 bits (475), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 131/412 (31%), Positives = 184/412 (44%), Gaps = 64/412 (15%)

Query: 124 KKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLP 183
           K   F S GLSK +  ++      QPT IQ+  IP IL+ RD +G A+TGSGKT AF  P
Sbjct: 6   KTTDFKSLGLSKWLTESLKAMKITQPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGP 65

Query: 184 MIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           M+ K        G+  V+L+P+RELA+Q    F       ++R  ++ GG+S+  Q   +
Sbjct: 66  MLTKWSEDPC--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSVVVGGESIIQQALAL 123

Query: 244 MGNPDVVIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLVAFP 299
              P  +IATPGR  H  +    D    L   +Y+V DEAD L    F + L   + A P
Sbjct: 124 QRKPHFIIATPGRLAHHIMSSGEDTVGGLMRAKYLVLDEADILLTSTFADHLATCIGALP 183

Query: 300 T--NRQTLLFSATLPSSLVDFAKAGL--SNPVLVRLDAET----KISENLEMLFISIKKD 351
               RQTLLF+AT+   +     A +    P L     E+     I   L+  +I + + 
Sbjct: 184 AKDKRQTLLFTATITDQVRSLQDAPVQEGKPPLFAYQVESVDNVAIPSTLKTEYILVPEH 243

Query: 352 EREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPN 411
            +EA L  LL                                                  
Sbjct: 244 VKEAYLYQLL-------------------------------------------------- 253

Query: 412 ANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSI 471
             E    K  I+FV      E + + LK     V+ ++  + Q  R   L+ FRA    +
Sbjct: 254 TCEEYENKTAIIFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARV 313

Query: 472 LVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           L+ TDVA+RG+DIP +  V+NY +P    +FIHR GRTARAG  G A S V+
Sbjct: 314 LIATDVASRGLDIPTVELVVNYDIPSDPDVFIHRSGRTARAGRNGDAISFVT 365

>NDAI0E02430 Chr5 complement(503901..505886) [1986 bp, 661 aa] {ON}
           Anc_8.614
          Length = 661

 Score =  192 bits (488), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 125/411 (30%), Positives = 205/411 (49%), Gaps = 69/411 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI-E 186
           F +  L  L+L NI+   F +PTP+Q+ +IP+I   RD++  A+TGSGKT  F+ P++ E
Sbjct: 187 FTAPQLDDLLLENINLARFSKPTPVQKYSIPIIANGRDLMACAQTGSGKTGGFLFPVLSE 246

Query: 187 KLKT------------HSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234
             K+            +S K    ++IL+P+RELA Q     K+F+  S ++  ++ GG 
Sbjct: 247 AFKSGPSPTPEQGRNFYSKKGYPTSLILAPTRELATQIFEEAKKFTYRSWVKPCVVYGGA 306

Query: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294
            + +Q   +    D+++ATPGR   L     + L++++Y+V DEADR+ +MGF+ Q+  +
Sbjct: 307 PIGNQMREIDHGCDLLVATPGRLSDLLERGKISLQNIKYLVLDEADRMLDMGFEPQIRHI 366

Query: 295 L--VAFPT--NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           +  V  P    RQTL+FSAT P  +   A+  L++ V + +      S+N+    + ++ 
Sbjct: 367 VEGVDMPQVGERQTLMFSATFPIDIQQLARDFLNDYVFLSVGRVGSTSDNITQKILYVED 426

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
            ++ + LL LL                                                 
Sbjct: 427 QDKYSALLDLLSAT---------------------------------------------- 440

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
                 S+  T++FV T+   + +T  L    +  + I+G   Q  R++ L  F+AG  +
Sbjct: 441 ------SDGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALSAFKAGTAN 494

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSI 521
           +LV T VAARG+DIP + +VIN+ LP     ++HR+GRT RAGN G A S 
Sbjct: 495 LLVATAVAARGLDIPNVTHVINFDLPSDIDDYVHRIGRTGRAGNTGVATSF 545

>YHR169W Chr8 (442181..443476) [1296 bp, 431 aa] {ON}  DBP8ATPase,
           putative RNA helicase of the DEAD-box family; component
           of 90S preribosome complex involved in production of 18S
           rRNA and assembly of 40S small ribosomal subunit; ATPase
           activity stimulated by association with Esf2p
          Length = 431

 Score =  187 bits (474), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 131/408 (32%), Positives = 185/408 (45%), Gaps = 64/408 (15%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F S GLSK +  ++      QPT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ K
Sbjct: 4   FKSLGLSKWLTESLRAMKITQPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGPMLTK 63

Query: 188 LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNP 247
                +  G+  V+L+P+RELA+Q    F       ++R  ++ GG+S+  Q   +   P
Sbjct: 64  WSEDPS--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSVIVGGESIVQQALDLQRKP 121

Query: 248 DVVIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT--N 301
             +IATPGR  H  +    D    L   +Y+V DEAD L    F + L   + A P    
Sbjct: 122 HFIIATPGRLAHHIMSSGDDTVGGLMRAKYLVLDEADILLTSTFADHLATCISALPPKDK 181

Query: 302 RQTLLFSATLPSSLVDFAKAGL--SNPVLVRLDAET----KISENLEMLFISIKKDEREA 355
           RQTLLF+AT+   +     A +    P L     E+     I   L++ +I + +  +EA
Sbjct: 182 RQTLLFTATITDQVKSLQNAPVQKGKPPLFAYQVESVDNVAIPSTLKIEYILVPEHVKEA 241

Query: 356 NLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEM 415
            L  LL                                                    E 
Sbjct: 242 YLYQLL--------------------------------------------------TCEE 251

Query: 416 PSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVT 475
              K  I+FV      E + + LK     V+ ++  + Q  R   L+ FRA    IL+ T
Sbjct: 252 YENKTAIIFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARILIAT 311

Query: 476 DVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           DVA+RG+DIP +  V+NY +P    +FIHR GRTARAG  G A S V+
Sbjct: 312 DVASRGLDIPTVELVVNYDIPSDPDVFIHRSGRTARAGRIGDAISFVT 359

>TPHA0E02410 Chr5 (512919..514490) [1572 bp, 523 aa] {ON} Anc_6.204
           YGL078C
          Length = 523

 Score =  189 bits (480), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 132/408 (32%), Positives = 204/408 (50%), Gaps = 65/408 (15%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF    L+K +   ISK  F +PTPIQ  + P +L  RD++G+A TGSGKT AF +P I 
Sbjct: 111 SFNHVKLNKKIQDEISK--FPKPTPIQSVSWPYLLTGRDVIGVAETGSGKTFAFGVPAIN 168

Query: 187 KLKTHSAKI----GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGM 242
            L   + ++    G++ +++SP+RELA QT       +    L    + GG   + Q   
Sbjct: 169 NLVDANGQLKYKKGIQVLVISPTRELASQTFDNLVILTDKLGLHCCCVYGGVPKDPQRTQ 228

Query: 243 MMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-N 301
           +  +  VV+ATPGR L L  E ++DL +V Y+V DEADR+ E GF+E +  ++    +  
Sbjct: 229 LKVS-QVVVATPGRLLDLLQEGSVDLSNVNYLVLDEADRMLEKGFEEDIKNIIRETASVG 287

Query: 302 RQTLLFSATLPSSLVDFAKAGLSNPVLV------RLDAETKISENLEMLFISIKKDEREA 355
           RQTL+F+AT P  + + A   +  PV V       L A  +I++ +E++    KKD +  
Sbjct: 288 RQTLMFTATWPKEVRELASTFMERPVKVSIGNRDELTANKRITQIVEVI-DPFKKDRK-- 344

Query: 356 NLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEM 415
            LL LL++    P   E                                           
Sbjct: 345 -LLDLLKKYHSGPKKDEK------------------------------------------ 361

Query: 416 PSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVT 475
                 ++F   +     V + L+  GY V+ I+G L+Q  R Q L  F++G  ++L+ T
Sbjct: 362 -----VLIFALYKKEASRVERNLQYNGYQVAAIHGDLSQQQRTQALNEFKSGKCNLLLAT 416

Query: 476 DVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           DVAARG+DIP +  VIN + P + + ++HR+GRT RAG  G A ++ +
Sbjct: 417 DVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFT 464

>Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}
           complement(73551..76169) [2619 nt, 873 aa]
          Length = 872

 Score =  195 bits (495), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 115/408 (28%), Positives = 221/408 (54%), Gaps = 48/408 (11%)

Query: 128 FASFGLSKLVLINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           ++  GL   ++  I+K+  + +PT IQ + IP I+  RD++G+++TGSGKT +++LPM+ 
Sbjct: 278 WSQLGLPTDIMNLITKELKYDEPTAIQSQAIPAIMSGRDLIGISKTGSGKTISYILPMLR 337

Query: 187 KLKTHSA----KIGVRAVILSPSRELAIQTHRVFKEFSKGS-DLRSILLTGGDSLEDQFG 241
           ++K        + G   +IL+P+RELA+Q +   ++F+K    +R+I  TGG  ++ Q  
Sbjct: 338 QIKAQRTLSKNETGPLGLILAPTRELALQINEEVEKFTKQDRSIRTICCTGGSEMKKQIN 397

Query: 242 MMMGNPDVVIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLVA 297
            +    ++V+ATPGR + + + +N    +  K + +VV DEADRLF+MGF+ Q+ +++  
Sbjct: 398 DLKRGVEIVVATPGRLIDI-LTLNSGKLISTKRITFVVMDEADRLFDMGFEPQITQIMKT 456

Query: 298 FPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENL-EMLFISIKKDEREAN 356
              ++Q +LFSAT P+ L  FA   L++P+ V +++   ++EN+ +  +I   ++++   
Sbjct: 457 VRPDKQCVLFSATFPNKLRSFAARILTDPLTVTINSNNLVNENVNQSFYIEDNENDKFNR 516

Query: 357 LLYLLQEAIKM--PVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANE 414
           L+ +L    K+   + + S+ +++                                  +E
Sbjct: 517 LVNILDGFYKVNKNITSNSEEREI----------------------------------DE 542

Query: 415 MPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVV 474
             S+K  I+FV ++   + +   L+N GY    I+       R   L  F+    SIL+ 
Sbjct: 543 EVSDKKIIIFVSSQQFCDLLYSKLENFGYFPYTIHAGKPYQERVMNLEKFKTTTNSILLC 602

Query: 475 TDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           T+V +RG+++P ++ VI Y+   +   ++H  GRTAR  ++G A +++
Sbjct: 603 TEVLSRGLNVPEVSLVIIYNAAKTFAQYVHTTGRTARGTHKGDAITLL 650

>KNAG0F02050 Chr6 (392126..393727) [1602 bp, 533 aa] {ON} Anc_6.204
           YGL078C
          Length = 533

 Score =  189 bits (480), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 120/382 (31%), Positives = 196/382 (51%), Gaps = 52/382 (13%)

Query: 146 FRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKI-GVRAVILSP 204
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P +  +   S  + G++A+I+SP
Sbjct: 141 FPKPTPIQSVSWPYLLSGKDVIGVAETGSGKTLAFGVPAVNHIIETSKTVSGIQALIISP 200

Query: 205 SRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEM 264
           +RELA Q +      +    L    + GG   ++Q  M +    +V+ATPGR L L  E 
Sbjct: 201 TRELASQIYDNLIPLTDKVGLECCCVYGGVPKDEQ-RMKLRKCHIVVATPGRLLDLLQEG 259

Query: 265 NLDLKSVEYVVFDEADRLFEMGFQEQLNELL-VAFPTNRQTLLFSATLPSSLVDFAKAGL 323
           +++L  V Y+V DEADR+ E GF+E +  ++    P  RQTL+F+AT P  + + A   +
Sbjct: 260 SVNLSKVNYLVLDEADRMLEKGFEEDIKNIIRETAPHGRQTLMFTATWPKEVRELAATFM 319

Query: 324 SNPVLVRLDAETKISEN--LEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQ 381
           + PV V +    ++S N  ++ +   +++  ++  LL LL++        +S  KK    
Sbjct: 320 NQPVKVSIGNRDELSANKRIKQIVEVVEQRSKDRKLLDLLKKY-------QSGAKK---- 368

Query: 382 NXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNC 441
                                               ++  ++F   +     V + LK  
Sbjct: 369 ------------------------------------DEKVLIFALYKKEAARVERNLKYN 392

Query: 442 GYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKI 501
           GY V  I+G L Q  R   L  F+ G +++L+ TDVAARG+DIP +  VIN + P + + 
Sbjct: 393 GYNVVAIHGDLTQQQRTHALNEFKTGSSNLLLATDVAARGLDIPNVKTVINLTFPLTVED 452

Query: 502 FIHRVGRTARAGNRGWAFSIVS 523
           ++HR+GRT RAG  G A ++ +
Sbjct: 453 YVHRIGRTGRAGQTGVAHTLFT 474

>Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar to
           Ashbya gossypii AGR333C
          Length = 500

 Score =  188 bits (478), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 137/440 (31%), Positives = 217/440 (49%), Gaps = 70/440 (15%)

Query: 92  LELSDDEKKATNESDDDLNDYFNTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTP 151
           +E+  D KK  + SDD++ D   +   A  K     F   GLSK  L  I K GF   T 
Sbjct: 8   VEVEVDSKKRPS-SDDEIADNMGSETKAVEK-----FDELGLSKQTLKAIEKMGFTTMTQ 61

Query: 152 IQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKI----GVRAVILSPSRE 207
           +Q KTIP ++  RD++G A+TGSGKT AF++P IE L  HS K     G   ++++P+RE
Sbjct: 62  VQAKTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIEML--HSLKFKPRNGTGVIVITPTRE 119

Query: 208 LAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNL 266
           LA+Q   V +E  +       ++ GG +   +   +    +++IATPGR L HL+     
Sbjct: 120 LALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLSKGVNLIIATPGRLLDHLQNTKGF 179

Query: 267 DLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQTLLFSATLPSSLVDFAKAGL-S 324
             K+++ ++ DEADR+ E+GF++++ +++   P  +RQ++LFSAT  + + D A+  L  
Sbjct: 180 IFKNLKALIIDEADRILEIGFEDEMKQIIKILPNEDRQSMLFSATQTTKVEDLARISLRP 239

Query: 325 NPVLVRLDAETKIS--ENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQN 382
            P+ + +D+E + S  + LE  ++  + D+R   L   L++          Q KK+    
Sbjct: 240 GPLFINVDSEKETSTVDGLEQGYVVCESDKRFLLLFTFLKKF---------QTKKI---- 286

Query: 383 XXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCG 442
                                                  IVF+ + + V Y  +LL    
Sbjct: 287 ---------------------------------------IVFLSSCNSVRYYAELLNYID 307

Query: 443 YLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIF 502
             V  ++G   Q  R    + F      ILV TDVAARG+DIP +  +I +  P   + +
Sbjct: 308 LPVLELHGKQKQQKRTNTFFEFCNAQRGILVCTDVAARGLDIPAVDWIIQFDPPDDPRDY 367

Query: 503 IHRVGRTARAGNRGWAFSIV 522
           IHRVGRTAR G +G   S++
Sbjct: 368 IHRVGRTAR-GTKGKGKSLM 386

>KAFR0B04480 Chr2 complement(929008..930315) [1308 bp, 435 aa] {ON}
           Anc_5.69 YHR169W
          Length = 435

 Score =  186 bits (473), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 133/409 (32%), Positives = 191/409 (46%), Gaps = 64/409 (15%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF   GLSK +L ++      QPT IQ   IP IL+ RD +G A+TGSGKT  F  PM+ 
Sbjct: 6   SFKQLGLSKWLLDSLRAMKITQPTTIQSHCIPEILKGRDCIGGAKTGSGKTITFAAPMLA 65

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
           +        G+  V+L+P+RELA+Q    F       ++R  L+ GG+S+ +Q   +   
Sbjct: 66  RWSEDPC--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVALIVGGESIVNQAIELQRK 123

Query: 247 PDVVIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLVAFP--T 300
           P  +IATPGR  H  +    D    LK  +Y+V DEAD L    F + L+  + A P   
Sbjct: 124 PHFIIATPGRLAHHILNSGEDTVGGLKRAKYLVLDEADFLLNDTFAKDLSTCIGALPDKN 183

Query: 301 NRQTLLFSATLPSSLVDFAKA---GLSNPVL---VRLDAETKISENLEMLFISIKKDERE 354
            RQTLLF+AT+   +     A   G   P+    V    +  I   L++ +I I +  +E
Sbjct: 184 ARQTLLFTATITDQVRALQNAPAKGGKLPIFAYQVESVDKVAIPSTLKVEYILIPEHVKE 243

Query: 355 ANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANE 414
           A L  LL          E+ I                                   N+N 
Sbjct: 244 AYLYQLL--------TCENYI-----------------------------------NSN- 259

Query: 415 MPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVV 474
                  I+FV      E + + LK+    V+ ++  ++Q  R   L+ FRA    IL+ 
Sbjct: 260 ------VIIFVNRTATAEVLRKTLKHLDLRVASLHSQMSQQERTNSLHRFRANAARILIA 313

Query: 475 TDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           TDVA+RG+DIP +  V+NY +P     +IHR GRTARAG  G A S ++
Sbjct: 314 TDVASRGLDIPTVELVVNYDIPSDPDTYIHRSGRTARAGKSGDAISFIT 362

>KLTH0H00638g Chr8 complement(64621..65922) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P38719 Saccharomyces
           cerevisiae YHR169W DBP8 Putative ATP-dependent RNA
           helicase of the DEAD-box family involved in biogenesis
           of the 40S ribosomal subunit
          Length = 433

 Score =  186 bits (473), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 127/408 (31%), Positives = 188/408 (46%), Gaps = 64/408 (15%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           FA+ G+SK ++  +      QPT IQ+  IP ILQ +D +G A+TGSGKT AF  PM+ K
Sbjct: 5   FATLGISKWLVEALQAMKITQPTAIQKACIPQILQGKDCIGGAKTGSGKTIAFGAPMLTK 64

Query: 188 LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNP 247
                +  G+  V+L+P+RELA+Q    F       ++R  L+ GG+S+ DQ   +   P
Sbjct: 65  WSEDPS--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVALVVGGESIVDQAINLQRKP 122

Query: 248 DVVIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT--N 301
             ++ATPGR  H  +    D    LK  +++V DEAD L    F E L   +   P    
Sbjct: 123 HFIVATPGRMAHHIMNSGEDTIGGLKRAKFLVLDEADILLTDTFSEHLATCISILPPKEK 182

Query: 302 RQTLLFSATLPSSL--VDFAKAGLSNPVLVRLDAET----KISENLEMLFISIKKDEREA 355
           RQTLLF+AT+   +  +  A A    P L   + E+     I   L+  ++ + +  +EA
Sbjct: 183 RQTLLFTATVTDQVKALQNAPAAEGKPPLFSYEVESMDKVAIPSTLKTTYLLVPEQVKEA 242

Query: 356 NLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEM 415
            L  +L                                                   N  
Sbjct: 243 YLYQIL--------------------------------------------------TNAT 252

Query: 416 PSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVT 475
            +E + I+FV      E + + LK     V+ ++  + Q  R   L+ FRA    +L+ T
Sbjct: 253 YNESSAIIFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAARVLIAT 312

Query: 476 DVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           DVA+RG+DIP +  VINY +  +   FIHR GRTARAG  G +   V+
Sbjct: 313 DVASRGLDIPTVQLVINYDISSNPDTFIHRAGRTARAGRSGESICFVA 360

>Suva_15.369 Chr15 (648232..649545) [1314 bp, 437 aa] {ON} YHR169W
           (REAL)
          Length = 437

 Score =  186 bits (473), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 134/412 (32%), Positives = 184/412 (44%), Gaps = 64/412 (15%)

Query: 124 KKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLP 183
           K   F S GLSK +  ++      QPT IQ+  IP IL+ RD +G A+TGSGKT AF  P
Sbjct: 6   KNTDFKSLGLSKWLTESLKAMKITQPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGP 65

Query: 184 MIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           M+ K        G+  V+L+P+RELA+Q    F       ++R  ++ GG+S+  Q   +
Sbjct: 66  MLTKWSEDPC--GMFGVVLTPTRELAMQIAEQFTALGSNMNIRVSVVVGGESIVKQALDL 123

Query: 244 MGNPDVVIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLVAFP 299
              P  +IATPGR  H  +    D    L   +Y+V DEAD L    F   L   + A P
Sbjct: 124 QRKPHFIIATPGRLAHHIMSSGEDTVGGLMRAKYLVLDEADILLTSTFANHLATCIGALP 183

Query: 300 T--NRQTLLFSATLPS---SLVDFAKAGLSNPVL---VRLDAETKISENLEMLFISIKKD 351
               RQTLLF+AT+     SL D    G   P+    V    +  I   L+  +I + + 
Sbjct: 184 PKDKRQTLLFTATITDQVRSLQDAPVQGNKPPLFAYQVESVDDVAIPSTLKTEYILVPEH 243

Query: 352 EREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPN 411
            +EA L  LL                                                  
Sbjct: 244 VKEAYLYQLL-------------------------------------------------- 253

Query: 412 ANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSI 471
             E    K  IVFV      E + + LK     V+ ++  + Q  R   L+ FRA    +
Sbjct: 254 TCEEYENKTAIVFVNRTMSAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARV 313

Query: 472 LVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           L+ TDVA+RG+DIP +  V+NY +P    +FIHR GRTARAG  G A S V+
Sbjct: 314 LIATDVASRGLDIPTVELVVNYDIPSDPDVFIHRSGRTARAGRDGDAISFVT 365

>Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}
           similar to Ashbya gossypii AFL027C
          Length = 877

 Score =  194 bits (494), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 121/405 (29%), Positives = 215/405 (53%), Gaps = 58/405 (14%)

Query: 128 FASFGLSKLVLINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +   GL+  V+  + K+  F  PTPIQ + IP I+  RDI+G+++TGSGKT +F+LP++ 
Sbjct: 299 WTHLGLTSDVMDLLVKEFQFNFPTPIQSQAIPAIMSGRDIIGISKTGSGKTVSFLLPLLR 358

Query: 187 KLKTHS----AKIGVRAVILSPSRELAIQTHRVFKEFSKGSD-LRSILLTGGDSLEDQFG 241
           ++K+       + G   ++L+P+RELA+Q H    +F+  +  ++SI  TGG  ++ Q  
Sbjct: 359 QIKSQRPLRVGETGPIGLLLAPTRELAVQIHEEVVKFTAANPRIKSICCTGGSEIKKQIN 418

Query: 242 MMMGNPDVVIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLVA 297
            +    ++++ATPGRF+ L + +N    ++ K + +VV DEADRLF++GF+ Q+N+++  
Sbjct: 419 DIKRGIEIIVATPGRFIDL-LSLNSGNLVNPKRIVFVVLDEADRLFDLGFEPQVNQIMKC 477

Query: 298 FPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANL 357
              ++Q +LFSAT P+ L  FA   L NP+ + +++++ I+EN+E   + I  DE     
Sbjct: 478 IRPDKQCVLFSATFPTKLKSFASKILHNPIHITINSKSLINENIEQR-VEIFGDE----- 531

Query: 358 LYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPS 417
                         ES+ K L                              +P       
Sbjct: 532 --------------ESKFKSLLHW--------------------------LVPTQTREVD 551

Query: 418 EKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDV 477
           EK TI+FV ++   ++++  L+  G     I+     + R   L +F+     IL+ T+V
Sbjct: 552 EK-TIIFVSSQQICDFLSNRLEVNGLGTFSIHAGKPFNERTWNLRSFKETKNGILICTEV 610

Query: 478 AARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
            +RG+++P ++ V+ Y+   S   ++H  GRTAR  N+G A +++
Sbjct: 611 LSRGLNVPEVSLVLIYNAAKSFAQYVHTTGRTARGTNKGMAVTLL 655

>KLLA0A09669g Chr1 complement(847036..848529) [1494 bp, 497 aa] {ON}
           highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
           localizes to both the nuclear periphery and nucleolus
           highly enriched in nuclear pore complex fractions
          Length = 497

 Score =  188 bits (477), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 132/429 (30%), Positives = 211/429 (49%), Gaps = 65/429 (15%)

Query: 104 ESDDDLNDYFNTTADAAAKHK-KGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQ 162
           ES+ D  +      D A   + +GSF+   LS   +  I K GF Q T +Q +TIP +L 
Sbjct: 11  ESEQDHAETETVVKDTATTGEVEGSFSDLKLSDGTMKAIGKMGFTQMTAVQTRTIPPLLA 70

Query: 163 KRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKI----GVRAVILSPSRELAIQTHRVFKE 218
            +D++G A+TGSGKT AF++P IE L  HS K     G   ++++P+RELA+Q   V +E
Sbjct: 71  GKDVLGAAKTGSGKTLAFLIPAIEML--HSLKFKPRNGTGVIVITPTRELALQIFGVARE 128

Query: 219 FSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFD 277
             +       ++ GG +   +   +M   +++IATPGR L HL+       K+++ +V D
Sbjct: 129 LMEFHSQTFGIVIGGANRRQEADKLMKGVNILIATPGRLLDHLQNTKGFIFKNLKALVID 188

Query: 278 EADRLFEMGFQEQLNELLVAFPT-NRQTLLFSATLPSSLVDFAKAGL-SNPVLVRLDAE- 334
           EADR+ E+GF++++ +++   P  +RQ++LFSAT  + + D A+  L   P+ + +D+E 
Sbjct: 189 EADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQTTKVEDLARISLRPGPLFINVDSEK 248

Query: 335 -TKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXX 393
            T  ++ LE  ++  + D+R   L   L+   K                           
Sbjct: 249 DTSTADGLEQGYVVCESDKRFLLLFSFLKRNQK--------------------------- 281

Query: 394 XXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALN 453
                                    K  IVF+ + + V+Y  +LL      V  ++G   
Sbjct: 282 -------------------------KKVIVFLSSCNSVKYYAELLNYIDLPVLELHGKQK 316

Query: 454 QHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAG 513
           Q  R    + F      ILV TDVAARG+DIP +  +I +  P   + +IHRVGRTAR G
Sbjct: 317 QQKRTNTFFEFCNAERGILVCTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-G 375

Query: 514 NRGWAFSIV 522
            +G   S++
Sbjct: 376 TKGKGKSLM 384

>NCAS0C01720 Chr3 complement(317951..319873) [1923 bp, 640 aa] {ON}
           Anc_2.164 YNL112W
          Length = 640

 Score =  191 bits (485), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 125/413 (30%), Positives = 203/413 (49%), Gaps = 69/413 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI-E 186
           F++  L +L+L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 171 FSAPQLDELLLENIKLARFTKPTPVQKYSVPIVENGRDLMACAQTGSGKTGGFLFPVLSE 230

Query: 187 KLKT------------HSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234
             KT            +S K    A+IL+P+RELA Q     K+F+  S +R  ++ GG 
Sbjct: 231 SFKTGPSKTPEQGRNFYSKKGYPTALILAPTRELATQIFDEAKKFTYRSWVRPCVVYGGA 290

Query: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294
            + +Q   +    D+++ATPGR   L     + L ++ Y+V DEADR+ +MGF+ Q+ ++
Sbjct: 291 PIGNQMREVDHGCDLLVATPGRLTDLIDRGKISLANIRYLVLDEADRMLDMGFEPQIRQI 350

Query: 295 LVA--FPT--NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           +     P   +RQTL+FSAT P  +   A+  L++ + + +      SEN+  + + ++ 
Sbjct: 351 VEGSDMPQVGDRQTLMFSATFPVDIQQLARDFLNDYIFLSVGRVGSTSENITQVILYVED 410

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
            ++ + LL LL            + K++  Q                             
Sbjct: 411 QDKYSALLDLLAATTDGLTLIFVETKRMADQ----------------------------- 441

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
                                  +T  L    +  + I+G   Q  R++ L  FRAG  +
Sbjct: 442 -----------------------LTDFLIMQNFKATAIHGDRTQQERERALSAFRAGTAT 478

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           ILV T VAARG+DIP + +VIN+ LPG    ++HR+GRT RAGN G A S  +
Sbjct: 479 ILVATAVAARGLDIPNVTHVINFDLPGDIDDYVHRIGRTGRAGNTGVATSFFN 531

>KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {ON}
           similar to uniprot|Q754U8 Ashbya gossypii AFL027C PRP5
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 and
           weakly similar to YBR237W uniprot|P21372 Saccharomyces
           cerevisiae PRP5 RNA helicase in the DEAD-box family
          Length = 812

 Score =  193 bits (491), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 127/406 (31%), Positives = 204/406 (50%), Gaps = 59/406 (14%)

Query: 128 FASFGLSKLVLINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           ++  GLS  ++  IS +  F   TPIQ + IP I+  RD++G+++TGSGKT AF+LP++ 
Sbjct: 247 WSQLGLSSEIMDLISNELQFVTLTPIQCQAIPAIMSGRDVIGISKTGSGKTVAFLLPLVR 306

Query: 187 KLKTHSA----KIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGM 242
           ++K        + G   +IL+P+RELA+Q      +F KGS + SI   GG  L+ Q   
Sbjct: 307 QIKAQPPLAPDETGPIGLILTPTRELAVQIQEEALKFCKGSGISSICCVGGSELKQQINE 366

Query: 243 MMGNPDVVIATPGRFLHLKVEMNLDLKS---VEYVVFDEADRLFEMGFQEQLNELLVAFP 299
           +    D+++ATPGRF+ L    +  L S   + +VV DEADRLF++GF  Q+N+++    
Sbjct: 367 LKRGVDIIVATPGRFIDLMTLNSGHLLSPTRISFVVMDEADRLFDLGFGPQVNQIMGCIR 426

Query: 300 TNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLE---MLFISIKKDEREAN 356
            ++Q +LFSAT PS L  FA   L NP+ + +++++ I+EN++    +F     DE    
Sbjct: 427 PDKQCVLFSATFPSKLKHFASRTLKNPIQITINSKSLINENIQQRVQIF-----DEEHVK 481

Query: 357 LLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMP 416
             +LL              K+L                             RL  A    
Sbjct: 482 FEFLL--------------KRLSD---------------------------RL--ALHRG 498

Query: 417 SEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTD 476
            ++ TI+FV ++   + +   L   G     I+       R + L  F+     IL+ T+
Sbjct: 499 EDEKTIIFVGSQQLCDLLYDELLLNGITTFPIHAGKPSAERLRNLQKFKETDNGILICTE 558

Query: 477 VAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           V +RG+++P ++ VI Y+   +   ++H VGRT R  N G A S V
Sbjct: 559 VLSRGLNVPEVSLVIIYNAAKTIAQYVHTVGRTGRGTNNGVALSFV 604

>YPL119C Chr16 complement(324411..326264) [1854 bp, 617 aa] {ON}
           DBP1Putative ATP-dependent RNA helicase of the DEAD-box
           protein family; mutants show reduced stability of the
           40S ribosomal subunit scanning through 5' untranslated
           regions of mRNAs
          Length = 617

 Score =  190 bits (482), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 128/435 (29%), Positives = 210/435 (48%), Gaps = 72/435 (16%)

Query: 109 LNDYFNTTADAAAKHKKG---SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRD 165
            ++Y N   DA+ K        F+S  L +L++ NI    F +PTP+Q+ +IP++ + RD
Sbjct: 134 FDNYDNIPVDASGKDVPEPILDFSSPPLDELLMENIKLASFTKPTPVQKYSIPIVTKGRD 193

Query: 166 IVGMARTGSGKTAAFVLPMI------------EKLKTHSAKIGV-RAVILSPSRELAIQT 212
           ++  A+TGSGKT  F+ P+             EK ++  ++ G   A++L+P+RELA Q 
Sbjct: 194 LMACAQTGSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQI 253

Query: 213 HRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVE 272
               ++F+  S +R  ++ GG  + +Q   +    D+++ATPGR   L     + L +++
Sbjct: 254 FEEARKFTYRSWVRPCVVYGGAPIGNQMREVDRGCDLLVATPGRLNDLLERGKVSLANIK 313

Query: 273 YVVFDEADRLFEMGFQEQLNELL--VAFPT--NRQTLLFSATLPSSLVDFAKAGLSNPVL 328
           Y+V DEADR+ +MGF+ Q+  ++     P+  NRQTL+FSAT P  +   A+  L N + 
Sbjct: 314 YLVLDEADRMLDMGFEPQIRHIVEECDMPSVENRQTLMFSATFPVDIQHLARDFLDNYIF 373

Query: 329 VRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXX 388
           + +      SEN+    + +   ++++ LL LL    K       + K++  Q       
Sbjct: 374 LSVGRVGSTSENITQRILYVDDMDKKSALLDLLSAEHKGLTLIFVETKRMADQ------- 426

Query: 389 XXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYI 448
                                                        +T  L    +  + I
Sbjct: 427 ---------------------------------------------LTDFLIMQNFKATAI 441

Query: 449 YGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGR 508
           +G   Q  R++ L  F+A +  ILV T VAARG+DIP + +VINY LP     ++HR+GR
Sbjct: 442 HGDRTQAERERALSAFKANVADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGR 501

Query: 509 TARAGNRGWAFSIVS 523
           T RAGN G A S  +
Sbjct: 502 TGRAGNTGVATSFFN 516

>Kpol_1072.50 s1072 complement(115009..116961) [1953 bp, 650 aa]
           {ON} complement(115009..116961) [1953 nt, 651 aa]
          Length = 650

 Score =  190 bits (483), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 121/408 (29%), Positives = 202/408 (49%), Gaps = 69/408 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F S  L  L+L NI    F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F+ P++ +
Sbjct: 162 FTSPPLDALLLENIILARFTKPTPVQKYSVPIVSRGRDLMACAQTGSGKTGGFLFPVLSE 221

Query: 188 -------------LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234
                         K+   K    A++L+P+RELA Q +   K+F+  S +R  ++ GG 
Sbjct: 222 SFKNGPSPMPESARKSFVKKAYPTALVLAPTRELATQIYDEAKKFTYRSWVRPTVVYGGS 281

Query: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294
            +  Q   +    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+ ++
Sbjct: 282 DIGSQIRDLSRGCDLLVATPGRLSDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIRQI 341

Query: 295 L--VAFP--TNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           +     P    RQTL+FSAT P  +   A+  LS+ + + +      SEN+    + ++ 
Sbjct: 342 VDGCDMPPVGERQTLMFSATFPDDIQHLARDFLSDYIFLSVGKVGSTSENITQRILYVED 401

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
            ++++ LL LL  +                                              
Sbjct: 402 MDKKSTLLDLLSAS---------------------------------------------- 415

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
                 ++  T++FV T+   + +T  L    +  + I+G   Q  R++ L  F+ G  +
Sbjct: 416 ------NDGLTLIFVETKRMADELTDFLIMQDFRATAIHGDRTQSERERALAAFKNGNAN 469

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWA 518
           +LV T VAARG+DIP + +V+NY LP     ++HR+GRT RAGN G A
Sbjct: 470 LLVATAVAARGLDIPNVTHVVNYDLPSDIDDYVHRIGRTGRAGNTGVA 517

>TDEL0G00930 Chr7 complement(186836..188146) [1311 bp, 436 aa] {ON}
           Anc_5.69 YHR169W
          Length = 436

 Score =  185 bits (469), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 126/409 (30%), Positives = 192/409 (46%), Gaps = 64/409 (15%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F S GL + ++  +S     QPT IQ+  IP I++  D +G A+TGSGKT AF  PM+ 
Sbjct: 8   TFKSLGLPRWLVDALSAMRITQPTSIQKGCIPAIMKGGDCIGGAKTGSGKTIAFAAPMLT 67

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
           K     +  G+  V+L+P+RELA+Q    F       ++R  ++ GG+S+  Q   +   
Sbjct: 68  KWSEDPS--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSIVVGGESIVKQALELQRK 125

Query: 247 PDVVIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-- 300
           P  +IATPGR  H  +    D    L   +++V DEAD L    F + LN  + A P   
Sbjct: 126 PHFIIATPGRLAHHILNSGEDTVGGLMRAKFLVLDEADSLLTSTFAKDLNVCVSALPPKD 185

Query: 301 NRQTLLFSATLPSSL--VDFAKAGLSNPVLVRLDAE----TKISENLEMLFISIKKDERE 354
            RQTLLF+AT+   +  +  A +  + P L   + E      +   L+  +I I +  +E
Sbjct: 186 KRQTLLFTATITDQVRALQDAPSQENKPPLYCYEVENVDNVAVPSTLKTEYILIPEYVKE 245

Query: 355 ANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANE 414
           A L +LL                                                   +E
Sbjct: 246 AYLYHLL--------------------------------------------------TSE 255

Query: 415 MPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVV 474
              + + I+FV      E + + LKN    V+ ++  + Q  R   L  FRA    +L+ 
Sbjct: 256 EYKDSSAIIFVNRTMTAEIMRRTLKNLDIRVASLHSQMPQQERTNSLQRFRANAARVLIA 315

Query: 475 TDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           TDVA+RG+DIP++  V+NY +P    ++IHR GRTARAG RG A S ++
Sbjct: 316 TDVASRGLDIPVVELVVNYDIPSDPDVYIHRSGRTARAGRRGDAISFIT 364

>Skud_16.161 Chr16 complement(295968..297827) [1860 bp, 619 aa] {ON}
           YPL119C (REAL)
          Length = 619

 Score =  189 bits (480), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 126/413 (30%), Positives = 201/413 (48%), Gaps = 69/413 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F S  L  L++ NI   GF +PTP+Q+ +IP++ + RD++  A+TGSGKT  F+ P+  +
Sbjct: 156 FNSPPLDALLMENIKLAGFNKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTE 215

Query: 188 L----------KTHS--AKIGV-RAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234
           L          K HS  ++ G   A++L+P+RELA Q     ++F+  S +R  ++ GG 
Sbjct: 216 LFQIGPSSVPEKAHSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGA 275

Query: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294
            + +Q   +    D+++ATPGR   L     + L + +Y+V DEADR+ +MGF+ Q+  +
Sbjct: 276 PIGNQMREVDRGCDLLVATPGRLNDLLERGKISLANTKYLVLDEADRMLDMGFEPQIRHI 335

Query: 295 L--VAFPT--NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           +     P+  NRQTL+FSAT P  +   A+  L N + + +      SEN+    + +  
Sbjct: 336 VEECDMPSVGNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDD 395

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
            ++++ LL LL    K       + K++  Q                             
Sbjct: 396 MDKKSALLDLLSAEHKGLTLIFVETKRMADQ----------------------------- 426

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
                                  +T  L    +  + I+G   Q  R++ L  F+A +  
Sbjct: 427 -----------------------LTDFLIMQNFKATAIHGDRTQAERERALSAFKANIAD 463

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           ILV T VAARG+DIP + +VINY LP     ++HR+GRT RAGN G A S  +
Sbjct: 464 ILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFN 516

>TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {ON}
           Anc_6.148 YBR237W
          Length = 877

 Score =  192 bits (488), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 125/406 (30%), Positives = 213/406 (52%), Gaps = 45/406 (11%)

Query: 128 FASFGLSKLVLINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           ++  G+S  V+  ++K   +  PTPIQ + IP I+  RD++G+++TGSGKT ++ LP+I 
Sbjct: 283 WSQLGISSDVMYLLTKTLQYDTPTPIQSQAIPAIMTGRDVIGISKTGSGKTISYALPLIR 342

Query: 187 KLKTH----SAKIGVRAVILSPSRELAIQTHRVFKEFSKGS-DLRSILLTGGDSLEDQFG 241
            +K      +++ G   +I++P+RELAIQ +   ++F K    +RSI  TGG  L++Q  
Sbjct: 343 HVKAQRPLSNSETGPLGLIIAPTRELAIQINEEIQKFIKSDPSIRSICCTGGSELKNQIY 402

Query: 242 MMMGNPDVVIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLVA 297
                 ++V+ATPGRF+ L + +N    L+ K +  V+ DEADRLF+MGF+ Q+ +++  
Sbjct: 403 EFKRGIEIVVATPGRFIDL-LTLNTGKLLNTKRITSVILDEADRLFDMGFEPQVTQIMKT 461

Query: 298 FPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKD-EREAN 356
              ++Q +LFSAT P  L  F K  L NP+ + +D++T ++EN+   F  +  D E+   
Sbjct: 462 IRPDKQCVLFSATFPIKLQAFVKRVLHNPLTITIDSKTMVNENVHQAFEILNNDSEKFFK 521

Query: 357 LLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMP 416
           L+ +L   ++     ES   K  +Q                                +  
Sbjct: 522 LIEILDNFVE---KRESSQSKGSEQ------------------------------VEDEI 548

Query: 417 SEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTD 476
            +K  I+FV ++   + V   L+   Y V  I+   +   R   L  F+    SIL+ T+
Sbjct: 549 IDKKIIIFVSSQQTCDAVAANLEKYDYDVFSIHAGRSYQERVSNLEKFKKTKNSILLCTE 608

Query: 477 VAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           V +RG+++P ++ VI Y+       ++H  GRTAR   RG A +++
Sbjct: 609 VLSRGLNVPEVSLVIIYNAVNKFSQYVHTTGRTARGTRRGNAITLL 654

>Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  191 bits (486), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 113/408 (27%), Positives = 218/408 (53%), Gaps = 48/408 (11%)

Query: 128 FASFGLSKLVLINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           ++  GLS   +  I++K  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 257 WSQLGLSTDTMTLITEKLRFESLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLR 316

Query: 187 KLKTHSA----KIGVRAVILSPSRELAIQTHRVFKEFSKGSDL-RSILLTGGDSLEDQFG 241
           ++K        + G   +IL+P+RELA+Q H   ++F+    L RS+  TGG  ++ Q  
Sbjct: 317 QVKAQRPLSKHETGPLGLILAPTRELALQIHEEVRKFTGAEALIRSVCCTGGSEMKKQIT 376

Query: 242 MMMGNPDVVIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLVA 297
            +    ++V+ATPGRF+ + + +N    L  K + +V+ DEADRLF++GF+ Q+ +++  
Sbjct: 377 DLKRGAEIVVATPGRFIDI-LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKT 435

Query: 298 FPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLF-ISIKKDEREAN 356
              ++Q +LFSAT P+ L  FA   L +P+ + ++++  ++EN++  F I    DE+  N
Sbjct: 436 VRPDKQCVLFSATFPNKLRSFAVRVLRSPISITINSKGLVNENVKQKFKICNSDDEKFDN 495

Query: 357 LLYLLQEAIKM--PVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANE 414
           L+ ++    +    + TE+  +                                  +++ 
Sbjct: 496 LVQIVHGRAEFFNEILTEADGE----------------------------------SSDF 521

Query: 415 MPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVV 474
             ++   I+FV ++   +++++ L+N G +   I+       R   L  F+    S+L+ 
Sbjct: 522 EEADAKAIIFVSSQQICDFISKKLQNAGIITCAIHAGKPYQERLMNLEKFKREKNSVLLC 581

Query: 475 TDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           T+V +RG+++P ++ VI Y+   +   ++H  GRTAR    G A +++
Sbjct: 582 TEVLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 629

>CAGL0J06908g Chr10 complement(662041..663855) [1815 bp, 604 aa]
           {ON} similar to uniprot|P24784 Saccharomyces cerevisiae
           YPL119c DBP1 or uniprot|P06634 Saccharomyces cerevisiae
           YOR204w
          Length = 604

 Score =  187 bits (476), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 122/413 (29%), Positives = 203/413 (49%), Gaps = 69/413 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F S  L +L+L N+    F +PTP+Q+ +IP++ + RD++  A+TGSGKT  F+ P++ +
Sbjct: 140 FKSPPLDELLLENVELANFSKPTPVQKYSIPIVTKNRDLMACAQTGSGKTGGFLFPVLSE 199

Query: 188 L-------------KTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234
           L              ++  K    A++L+P+RELAIQ     K+++  S ++  ++ GG 
Sbjct: 200 LFLNGPAPLPEHTRHSYMRKCYPSALVLAPTRELAIQIFDEAKKYTYRSWVKPYVVYGGA 259

Query: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294
            +  Q   M    ++++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 260 PIGQQMRDMDRGCNLLVATPGRLNDLLERGKISLVNVKYLVLDEADRMLDMGFEPQIRHI 319

Query: 295 L--VAFPT--NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           +     P+  +RQTL+FSAT P  +   A+  L + + + +      SEN++   + ++ 
Sbjct: 320 VEDCDMPSVNDRQTLMFSATFPREIQHLARDFLKDYIFLSVGRVGSTSENIQQKVLFVED 379

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
            ++ + LL +L   I        + K++  Q                             
Sbjct: 380 YDKNSALLDILINEIDGLTLVFVETKRMADQ----------------------------- 410

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
                                  +T  L    +  + I+G   Q  R++ L+ FR G+ +
Sbjct: 411 -----------------------LTDFLIVQNFKATAIHGDRTQAERERALHAFRNGIAN 447

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           ILV T VAARG+DIP + NVINY LP     ++HR+GRT RAGN G A S  +
Sbjct: 448 ILVATAVAARGLDIPNVTNVINYDLPTDIDDYVHRIGRTGRAGNVGVATSFFN 500

>Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W
           (REAL)
          Length = 848

 Score =  190 bits (483), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 115/407 (28%), Positives = 216/407 (53%), Gaps = 46/407 (11%)

Query: 128 FASFGLSKLVLINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           ++  GLS  ++  I+ K  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 255 WSQLGLSTDIMTLITGKLHFDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLR 314

Query: 187 KLKTHSA----KIGVRAVILSPSRELAIQTHRVFKEFSKGSD--LRSILLTGGDSLEDQF 240
           ++K   +    + G   +IL+P+RELA+Q H    +F+ G+D  +RS+  TGG  ++ Q 
Sbjct: 315 QVKAQRSLSKHETGPLGLILAPTRELALQIHEEVTKFT-GTDASIRSVCCTGGSEMKKQI 373

Query: 241 GMMMGNPDVVIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLV 296
             +    ++V+ATPGRF+ + + +N    L  K + +V+ DEADRLF++GF+ Q+ +++ 
Sbjct: 374 TDLKRGAEIVVATPGRFIDI-LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMK 432

Query: 297 AFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLF-ISIKKDEREA 355
               ++Q +LFSAT P+ L  FA   L +P+ + ++++  ++EN++  F I    DE+  
Sbjct: 433 TVRPDKQCVLFSATFPNKLRSFAVRVLRSPISITINSKGLVNENVKQKFKICHSDDEKFE 492

Query: 356 NLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEM 415
           NL+ +     K     +++I                                    ++  
Sbjct: 493 NLIQIAHGGNKFFDEGQTEIDG--------------------------------ETSDLD 520

Query: 416 PSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVT 475
            ++   I+FV ++   + +++ L N G +   I+       R   L  F+    SIL+ T
Sbjct: 521 ETDAKAIIFVSSQQICDLISKKLTNAGIVAYAIHAGKPYQERLMNLEKFKREKNSILLCT 580

Query: 476 DVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           +V +RG+++P ++ VI Y+   +   ++H  GRTAR    G A +++
Sbjct: 581 EVLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 627

>KLLA0A05203g Chr1 complement(462167..463474) [1308 bp, 435 aa] {ON}
           highly similar to uniprot|P38719 Saccharomyces
           cerevisiae YHR169W DBP8 Putative ATP-dependent RNA
           helicase of the DEAD-box family involved in biogenesis
           of the 40S ribosomal subunit
          Length = 435

 Score =  182 bits (463), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 123/408 (30%), Positives = 190/408 (46%), Gaps = 64/408 (15%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F S G SK ++  ++     QPT IQ+  IP IL+ RD +G A TGSGKT AF  PM+ K
Sbjct: 6   FKSLGCSKWLVEALNAMKIVQPTAIQKACIPEILKGRDCIGGANTGSGKTIAFAAPMLTK 65

Query: 188 LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNP 247
                   G+  ++L+P+RELA+Q    F  F    ++R  ++ GG+S+  Q   +   P
Sbjct: 66  WSEDPQ--GMFGIVLTPTRELAMQIAEQFTAFGSAMNIRVAIVVGGESIVQQAIELQKRP 123

Query: 248 DVVIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLVAFP--TN 301
             +IATPGR  H  +    D    LK V+++V DEAD L    F + L   +   P    
Sbjct: 124 HFIIATPGRLAHHVLNSGEDTIGGLKRVKFLVLDEADILLTETFSKDLATCVSILPPKNK 183

Query: 302 RQTLLFSATLPSSLVDFAKAGLSN--PVLVRLDAET----KISENLEMLFISIKKDEREA 355
           RQ LLF+AT+   +   + A  +   P +   + E+     I + LE  ++ + +  +E+
Sbjct: 184 RQNLLFTATMTDQVKALSDAPQTEGKPPVFTFEVESVDNVAIPKTLETTYLLVPEHVKES 243

Query: 356 NLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEM 415
            L  +L         +E  +K                                       
Sbjct: 244 YLYQIL--------TSEKYVK--------------------------------------- 256

Query: 416 PSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVT 475
               + I+FV      E + + LK+    V+ ++  + Q  R   +  FRA    +L+ T
Sbjct: 257 ---SSCIIFVNRTVTAEILRRTLKSLDVRVTSLHSQMPQQERTNSVQRFRAQAARVLIAT 313

Query: 476 DVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           DVA+RG+DIP++  V+NY +PG+   FIHR GRTARAG  G +   V+
Sbjct: 314 DVASRGLDIPIVELVVNYDIPGNPDTFIHRAGRTARAGRHGESLCFVT 361

>TPHA0L02160 Chr12 complement(448305..449801) [1497 bp, 498 aa] {ON}
           Anc_5.40 YMR290C
          Length = 498

 Score =  184 bits (467), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 132/437 (30%), Positives = 215/437 (49%), Gaps = 69/437 (15%)

Query: 100 KATNESDDDLNDYFNTTADAAAKHKKG-----SFASFGLSKLVLINISKKGFRQPTPIQR 154
           K + E D+ L       +  + K + G     SFA   LS+  +  I K GF   TP+Q 
Sbjct: 3   KRSREDDNSLEMEVLNVSSTSGKDENGNATVESFADLKLSEPTMKAIEKMGFENMTPVQA 62

Query: 155 KTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKI----GVRAVILSPSRELAI 210
           +TIP +L  RD++G A+TGSGKT AF+LP IE L  HS K     G   ++++P+RELA+
Sbjct: 63  RTIPPLLAGRDVLGAAKTGSGKTLAFLLPAIEML--HSLKYKPRNGTGVIVITPTRELAL 120

Query: 211 QTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLK 269
           Q   V +E  +       ++ GG +   +   ++   +++IATPGR L HL+       K
Sbjct: 121 QIFGVARELMEFHSQTFGIVIGGANRRQEADKLVKGVNMLIATPGRLLDHLQNTKGFVYK 180

Query: 270 SVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQTLLFSATLPSSLVDFAKAGL-SNPV 327
           +++ ++ DEADR+ E+GF++++ +++   P  +RQ++LFSAT  + + D A+  L   P+
Sbjct: 181 NLKALIIDEADRILEIGFEDEMKQIIRILPKEDRQSMLFSATQTTKVEDLARMSLRKGPL 240

Query: 328 LVRL--DAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXX 385
            + +  D +T  ++ LE  ++  + D+R   L   L+          +Q KK+       
Sbjct: 241 FINVVTDKDTSTADGLEQGYVVCESDKRFLLLFSFLK---------RNQKKKI------- 284

Query: 386 XXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLV 445
                                               IVF+ + + V+Y  +LL      V
Sbjct: 285 ------------------------------------IVFLSSCNSVKYYAELLNYIDLPV 308

Query: 446 SYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHR 505
             ++G   Q  R    + F      ILV TDVAARG+DIP +  ++ +  P   + +IHR
Sbjct: 309 LELHGKQKQQKRTNTFFEFCNAERGILVCTDVAARGLDIPAVDWIVQFDPPDDPRDYIHR 368

Query: 506 VGRTARAGNRGWAFSIV 522
           VGRTAR G +G   S++
Sbjct: 369 VGRTAR-GTKGKGKSLM 384

>CAGL0I02354g Chr9 (209279..210592) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P38719 Saccharomyces cerevisiae
           YHR169w DBP8
          Length = 437

 Score =  182 bits (461), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 130/416 (31%), Positives = 187/416 (44%), Gaps = 72/416 (17%)

Query: 124 KKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLP 183
           +K +F   GLSK ++ ++     R PT IQ   IP IL+ RD +G A+TGSGKT AF  P
Sbjct: 7   RKQNFRQLGLSKWLVESLDAMRIRTPTAIQSGCIPEILKGRDCIGGAKTGSGKTIAFAGP 66

Query: 184 MIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           M+ +        G+  ++L+P+RELA+Q    F       ++R  L+ GG+S+ DQ   +
Sbjct: 67  MLTQWSEDPT--GMFGIVLTPTRELAMQIAEQFTALGSYMNIRVALVVGGESIVDQALQL 124

Query: 244 MGNPDVVIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLVAFP 299
              P  +IATPGR  H  +    D    LK V+Y+V DEAD L    F   L   + A P
Sbjct: 125 QRKPHFIIATPGRLAHHILNSGDDTVGGLKRVKYLVLDEADILLTETFSNDLKTCVGALP 184

Query: 300 --TNRQTLLFSATLPSSLVDFAKAGLSNPV------LVRLDAE----TKISENLEMLFIS 347
               RQTLLF+A    ++ D  +A    PV      L   + E      I   L   ++ 
Sbjct: 185 PKEKRQTLLFTA----TITDQVRALQDAPVQKGKQPLFCYEVENVDNVAIPSTLNTEYVL 240

Query: 348 IKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXR 407
           + +  +EA L  LL                                              
Sbjct: 241 VPEHVKEAYLYQLL---------------------------------------------- 254

Query: 408 RLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAG 467
                 E  +    I+FV      E + + LK     V+ ++  + Q  R   ++ FRA 
Sbjct: 255 ----TCESYANSTAIIFVNRTTAAEVLRRTLKALDVRVASLHSQMPQQERTNSMHRFRAN 310

Query: 468 LTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
              +L+ TDVA+RG+DIP +  VINY +P     FIHR GRTARAG +G A S ++
Sbjct: 311 AARVLIATDVASRGLDIPTVELVINYDIPSDPDTFIHRSGRTARAGRKGDAISFIT 366

>CAGL0M13519g Chr13 complement(1330802..1332286) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290c HAS1 helicase associated with SET1P
          Length = 494

 Score =  183 bits (464), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 125/407 (30%), Positives = 203/407 (49%), Gaps = 63/407 (15%)

Query: 117 ADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGK 176
           AD  +     SF S  LS+  +  I K GF + TP+Q +TIP ++  RD++G A+TGSGK
Sbjct: 20  ADVESSDVDHSFKSLNLSQPTMRAIEKMGFSKMTPVQARTIPPLMAGRDVLGAAKTGSGK 79

Query: 177 TAAFVLPMIEKLKTHSAKI----GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTG 232
           T AF+LP IE L  HS K     G   +I++P+RELA+Q   V +E  +       ++ G
Sbjct: 80  TLAFLLPTIELL--HSLKFKPRNGTGVIIITPTRELALQIFGVVRELMEFHSQTFGIVIG 137

Query: 233 GDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQL 291
           G +   +   +M   ++++ATPGR L HL+       K+++ +V DEADR+ E+GF++++
Sbjct: 138 GANRRQEAEKLMKGVNLLVATPGRLLDHLQNTKGFIFKNLKALVIDEADRILEIGFEDEM 197

Query: 292 NELLVAFPT-NRQTLLFSATLPSSLVDFAKAGL-SNPVLVRLDAE--TKISENLEMLFIS 347
            +++   P  +RQ++LFSAT  + + D ++  L   P+ + + +E  +  ++ LE  ++ 
Sbjct: 198 RQIIKILPNEDRQSMLFSATQTTKVEDLSRISLRPGPLFINVVSEHDSSTADGLEQGYVV 257

Query: 348 IKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXR 407
            + D+R   L   L+          +Q KK+                             
Sbjct: 258 CESDKRFLLLFSFLK---------RNQKKKI----------------------------- 279

Query: 408 RLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAG 467
                         IVF+ + + V+Y  +LL      V  ++G   Q  R    + F   
Sbjct: 280 --------------IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNA 325

Query: 468 LTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGN 514
              IL+ TDVAARG+DIP +  +I +  P   + +IHRVGRTAR  N
Sbjct: 326 ERGILICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTN 372

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  189 bits (479), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 109/387 (28%), Positives = 210/387 (54%), Gaps = 43/387 (11%)

Query: 146 FRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTH----SAKIGVRAVI 201
           F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ ++K        + G   +I
Sbjct: 276 FDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPLSKHETGPLGLI 335

Query: 202 LSPSRELAIQTHRVFKEFSK-GSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHL 260
           L+P+RELA+Q H    +F++  + +RS+  TGG  ++ Q   +    ++V+ATPGRF+ +
Sbjct: 336 LAPTRELALQIHEEVNKFTETDAGIRSVCCTGGSEMKKQITDLKRGAEIVVATPGRFIDI 395

Query: 261 KVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLV 316
            + +N    L  K + +V+ DEADRLF++GF+ Q+ +++     ++Q +LFSAT P+ L 
Sbjct: 396 -LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVRPDKQFVLFSATFPNKLR 454

Query: 317 DFAKAGLSNPVLVRLDAETKISENLEMLF-ISIKKDEREANLLYLLQEAIKMPVATESQI 375
            FA   L +P+ + ++++  ++EN++  F I   +DE+  NL+ +L++  ++    +S +
Sbjct: 455 SFAVRVLRSPISITINSKGMVNENVKQKFKICHSEDEKFDNLMQILRKRNELLDEVQSDV 514

Query: 376 KKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVT 435
                                              +  E+ ++   I+FV ++   ++++
Sbjct: 515 DG------------------------------ETSDLEEVDAK--AIIFVSSQQICDFIS 542

Query: 436 QLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSL 495
           + L N G +   I+       R   L  F+    SIL+ T+V +RG+++P ++ VI Y+ 
Sbjct: 543 KKLANVGVVTYAIHAGKPYQERVMNLEKFKREKNSILLCTEVLSRGLNVPEVSLVIIYNS 602

Query: 496 PGSSKIFIHRVGRTARAGNRGWAFSIV 522
             +   ++H  GRTAR    G A +++
Sbjct: 603 VKTFAQYVHTTGRTARGSRSGTAITLL 629

>KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.40
           YMR290C
          Length = 496

 Score =  182 bits (463), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 126/405 (31%), Positives = 204/405 (50%), Gaps = 64/405 (15%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F    LS+  L  I K GF + TP+Q +TIP ++  RD++G A+TGSGKT AF+LP IE
Sbjct: 35  TFKELNLSQPTLKAIDKMGFTKMTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPAIE 94

Query: 187 KLKTHSAKI----GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGM 242
            L  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   
Sbjct: 95  ML--HSLKFKPRNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEK 152

Query: 243 MMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT- 300
           +M   +++IATPGR L HL+       K+++ +V DEADR+ E+GF++++ +++   P  
Sbjct: 153 LMKGVNILIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMRQIIKILPNE 212

Query: 301 NRQTLLFSATLPSSLVDFAKAGL-SNPVLVRLDAE--TKISENLEMLFISIKKDEREANL 357
           +RQ++LFSAT  + + D A+  L   P+ + + +E  +  ++ LE  ++  + D+R   L
Sbjct: 213 DRQSMLFSATQTTKVEDLARISLRKGPLFINVVSEKDSSTADGLEQGYVVCESDKRFLLL 272

Query: 358 LYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPS 417
              L+          +Q KK+                                       
Sbjct: 273 FSFLK---------RNQKKKI--------------------------------------- 284

Query: 418 EKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDV 477
               IVF+ + + V+Y  +LL      V  ++G   Q  R    + F      ILV TDV
Sbjct: 285 ----IVFLSSCNSVKYHAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV 340

Query: 478 AARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           AARG+DIP +  +I +  P   + +IHRVGRTAR G +G   S++
Sbjct: 341 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 384

>SAKL0H01430g Chr8 (149724..151226) [1503 bp, 500 aa] {ON} highly
           similar to uniprot|Q03532 Saccharomyces cerevisiae
           YMR290C HAS1 ATP-dependent RNA helicase localizes to
           both the nuclear periphery and nucleolus highly enriched
           in nuclear pore complex fractions
          Length = 500

 Score =  181 bits (458), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 125/405 (30%), Positives = 202/405 (49%), Gaps = 64/405 (15%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F    LS+  +  I K GF Q T +Q +TIP ++  RD++G A+TGSGKT AF++P IE
Sbjct: 38  TFKELNLSQQTVKAIEKMGFTQMTQVQSRTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIE 97

Query: 187 KLKTHSAKI----GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGM 242
            L  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   
Sbjct: 98  ML--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEK 155

Query: 243 MMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT- 300
           ++   +++IATPGR L HL+       K+++ +  DEADR+ E+GF++++ +++   P  
Sbjct: 156 LVKGVNLLIATPGRLLDHLQNTKGFVFKNLKALCIDEADRILEIGFEDEMKQIIKILPNE 215

Query: 301 NRQTLLFSATLPSSLVDFAKAGL-SNPVLVRLDA--ETKISENLEMLFISIKKDEREANL 357
           +RQ++LFSAT  + + D A+  L   P+ + +D+  ET   E LE  ++  + D+R   L
Sbjct: 216 DRQSMLFSATQTTKVEDLARISLRPGPLFINVDSGKETSTVEGLEQGYVVCESDKRFLLL 275

Query: 358 LYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPS 417
              L+          +Q KK+                                       
Sbjct: 276 FSFLK---------RNQKKKI--------------------------------------- 287

Query: 418 EKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDV 477
               IVF+ + + V+Y  +LL      V  ++G   Q  R    + F      ILV TDV
Sbjct: 288 ----IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV 343

Query: 478 AARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           AARG+DIP +  +I +  P   + +IHRVGRTAR G +G   S++
Sbjct: 344 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 387

>CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa]
           {ON} similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237w Pre-mRNA processing RNA helicase PRP5
          Length = 816

 Score =  186 bits (471), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 117/387 (30%), Positives = 195/387 (50%), Gaps = 58/387 (14%)

Query: 145 GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTH----SAKIGVRAV 200
            ++  TPIQ +TIP I+  RD++G+++TGSGKT +++LPMI  +K      + + G  AV
Sbjct: 271 SYKSLTPIQTQTIPAIMSGRDVIGISKTGSGKTISYLLPMIRHVKAQKKLRNGETGPIAV 330

Query: 201 ILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHL 260
           I +P+RELA+Q +   ++     D+ SI  TGG  L+ Q   +    ++ IATPGRF+ L
Sbjct: 331 IFAPTRELAVQINEEVQKLISDLDISSICCTGGSDLKKQIDKLKTGVEIAIATPGRFIDL 390

Query: 261 KVEMNLDLKS---VEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVD 317
                 +L S   + +VV DEADRLF+ GF+ Q+  +L     +RQ +LFSAT PS + +
Sbjct: 391 LSLNGGNLVSTLRISFVVMDEADRLFDFGFEPQIASVLRTVRPDRQCVLFSATFPSKVSN 450

Query: 318 FAKAGLSNPVLVRLDAETKISENLEMLFISIKKDERE--ANLLYLLQEAIKMPVATESQI 375
           FA   L +P+ + ++AE  ++E +   F +I  DE +    LL LL+             
Sbjct: 451 FASRFLDSPLQITVNAEGMVNERINQKF-TICSDESDKFKELLSLLKV------------ 497

Query: 376 KKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVT 435
                                                N    ++ TI+FV ++   + + 
Sbjct: 498 ------------------------------------FNSETVDEKTIIFVSSQQICDIIE 521

Query: 436 QLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSL 495
           + L +    +  I+     + R+Q L  F+    SIL+ T+V +RG+++P ++ VI Y+ 
Sbjct: 522 KRLTDYSEKLYSIHAGRPYNERRQNLELFKKTSNSILLCTEVMSRGLNVPEVSRVILYNS 581

Query: 496 PGSSKIFIHRVGRTARAGNRGWAFSIV 522
             +   ++H  GRTAR    G + S++
Sbjct: 582 AKTFAQYVHSTGRTARGTREGTSISLL 608

>Kwal_56.24760 s56 (1136947..1138248) [1302 bp, 433 aa] {ON} YHR169W
           (DBP8) - DEAD-box protein [contig 160] FULL
          Length = 433

 Score =  179 bits (453), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 123/409 (30%), Positives = 188/409 (45%), Gaps = 64/409 (15%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F++ G+SK +   +       PT IQ+  IP IL+ +D +G A+TGSGKT AF  PM+ 
Sbjct: 4   TFSNLGVSKWLTEALRAMKIDHPTAIQKACIPQILKGKDCIGGAKTGSGKTIAFAAPMLT 63

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
           K     +  G+  V+L+P+RELA+Q    F       ++R  L+ GG+S+ DQ   +   
Sbjct: 64  KWSEDPS--GMFGVVLTPTRELAMQIAEQFTALGSSMNIRVALVVGGESIVDQAIALQRK 121

Query: 247 PDVVIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTN- 301
           P  +IATPGR  H  +    D    LK V+++V DEAD L    F E L   +   P   
Sbjct: 122 PHFIIATPGRLAHHVMNSGEDTIGGLKRVKFLVLDEADILLTDTFTEHLAICIGILPPKE 181

Query: 302 -RQTLLFSATLPSS--LVDFAKAGLSNPVLVRLDAET----KISENLEMLFISIKKDERE 354
            RQ LLF+AT+     ++  A A    P L   + E+     I   L+  ++ + +  +E
Sbjct: 182 RRQNLLFTATVTDQVKMLQNAPATEGKPPLFSYEVESMDKVAIPSTLKTSYLLVPEQVKE 241

Query: 355 ANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANE 414
           A L  +L  A  +                                               
Sbjct: 242 AYLYQILTSAAYI----------------------------------------------- 254

Query: 415 MPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVV 474
              + + I+FV      E + + LK     V+ ++  + Q  R   L+ FRA    +L+ 
Sbjct: 255 ---DSSAIIFVNRTVTAEILRRTLKQLDVRVASLHSQMPQQERTNSLHRFRANAARVLIA 311

Query: 475 TDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           TDVA+RG+DIP +  V+NY +  +   FIHR GRTARAG +G +   V+
Sbjct: 312 TDVASRGLDIPTVQLVVNYDISANPDTFIHRAGRTARAGRKGESICFVA 360

>KLTH0B08998g Chr2 complement(731722..733200) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
           localizes to both the nuclear periphery and nucleolus
           highly enriched in nuclear pore complex fractions
          Length = 492

 Score =  179 bits (455), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 128/407 (31%), Positives = 200/407 (49%), Gaps = 64/407 (15%)

Query: 125 KGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPM 184
           K  FA   LS   +  I K GF   T +Q +TIP +L  RD++G A+TGSGKT AF+LP 
Sbjct: 27  KEKFAELNLSPPTMKAIDKMGFTTMTQVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLLPA 86

Query: 185 IEKLKTHSAKI----GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQF 240
           IE L  HS K     G   ++++P+RELA+Q   V K   +       ++ GG +   + 
Sbjct: 87  IEML--HSLKFKPRNGTGVIVITPTRELALQIFGVAKTLMEFHSQTFGIVIGGANRRQEA 144

Query: 241 GMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFP 299
             +    +++IATPGR L HL+   +   K+++ +V DEADR+ E+GF++++ +++   P
Sbjct: 145 DKLAKGVNLLIATPGRLLDHLQNTKDFVFKNLKALVIDEADRILEIGFEDEMRQIVKILP 204

Query: 300 T-NRQTLLFSATLPSSLVDFAKAGL-SNPVLVRLDAE--TKISENLEMLFISIKKDEREA 355
           +  RQT+LFSAT  + + D A+  L   P+ + +D+E  T  ++ LE  ++    D+R  
Sbjct: 205 SEERQTMLFSATQTTKVEDLARISLRPGPLFINVDSEKQTSTADGLEQGYVVCDSDKRFL 264

Query: 356 NLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEM 415
            L   L+          +Q KK+                                     
Sbjct: 265 LLFSFLK---------RNQKKKI------------------------------------- 278

Query: 416 PSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVT 475
                 IVF+ + + V Y  +LL      V  ++G   Q  R    + F       LV T
Sbjct: 279 ------IVFLSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGTLVCT 332

Query: 476 DVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           DVAARG+DIP +  +I +  P   + +IHRVGRTAR G++G   S++
Sbjct: 333 DVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GSKGKGKSLM 378

>Skud_13.463 Chr13 complement(823646..825163) [1518 bp, 505 aa] {ON}
           YMR290C (REAL)
          Length = 505

 Score =  179 bits (455), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 134/435 (30%), Positives = 212/435 (48%), Gaps = 72/435 (16%)

Query: 97  DEKKATNESDDDLNDYFNTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKT 156
           DE K+ N+SD        T  + AA  +K  F    LS+  L  I K GF   T +Q +T
Sbjct: 21  DENKSVNQSDA------ATEGETAAYVEK--FEELKLSQPTLKAIEKLGFTTMTSVQSRT 72

Query: 157 IPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKI----GVRAVILSPSRELAIQT 212
           IP +L  RD++G A+TGSGKT AF++P IE L  HS K     G   ++++P+RELA+Q 
Sbjct: 73  IPPLLAGRDVLGAAKTGSGKTLAFLIPAIELL--HSLKFKPRNGTGIIVITPTRELALQI 130

Query: 213 HRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSV 271
             V +E  +       ++ GG +   +   +M   +++IATPGR L HL+       K++
Sbjct: 131 FGVARELMEFHSQTFGIVIGGANRRQEAEKLMKGVNMLIATPGRLLDHLQNTKGFVFKNL 190

Query: 272 EYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQTLLFSATLPSSLVDFAKAGL-SNPVLV 329
           + ++ DEADR+ E+GF++++ +++   P  +RQ++LFSAT  + + D A+  L   P+ +
Sbjct: 191 KALIIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQTTKVEDLARISLRPGPLFI 250

Query: 330 RLDAET--KISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXX 387
            +  ET    ++ LE  ++    D+R   L   L+          +Q KK+         
Sbjct: 251 NVVPETDNSTADGLEQGYVVCDSDDRFLLLFSFLK---------RNQKKKI--------- 292

Query: 388 XXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSY 447
                                             IVF+ + + V+Y  +LL      V  
Sbjct: 293 ----------------------------------IVFLSSCNSVKYYAELLNYIDLPVLE 318

Query: 448 IYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVG 507
           ++G   Q  R    + F      IL+ TDVAARG+DIP +  +I +  P   + +IHRVG
Sbjct: 319 LHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVG 378

Query: 508 RTARAGNRGWAFSIV 522
           RTAR G  G   S++
Sbjct: 379 RTAR-GTEGKGKSLM 392

>KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.148
           YBR237W
          Length = 852

 Score =  185 bits (469), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 116/406 (28%), Positives = 213/406 (52%), Gaps = 48/406 (11%)

Query: 128 FASFGLSKLVLINISK-KGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           ++  GL+  ++ +I     F++ TPIQ + +P I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 260 WSQLGLNTSIMNSIKNVMKFQELTPIQAQALPAIMSGRDVIGISKTGSGKTISYLLPLLR 319

Query: 187 KLKTH----SAKIGVRAVILSPSRELAIQTHR-VFKEFSKGSDLRSILLTGGDSLEDQFG 241
           ++K+     +++ G   ++L+P+RELA+Q H  + K  +  + L  I  TGG  L+DQ  
Sbjct: 320 QVKSQRDLSNSETGPIGLVLAPTRELALQIHEEINKLINDDASLNCICCTGGSELKDQIS 379

Query: 242 MMMGNPDVVIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLVA 297
            +     +V+ATPGRF+ L + +N    L    + +VV DEADRLF+MGF+ Q+ +++ A
Sbjct: 380 SVKRGVKIVVATPGRFIDL-LTINSGKLLSTGRITFVVMDEADRLFDMGFEPQVTQIMKA 438

Query: 298 FPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREAN- 356
              ++Q +LFSAT  + +  FA   L NP+ + +++   ++EN+   F   + D ++ + 
Sbjct: 439 IRPDKQCVLFSATFSNKIRSFAMRVLKNPITITINSNNIVNENVSQNFRVCESDTQKFDE 498

Query: 357 LLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMP 416
           L+ LL+E      A E                                       ++ + 
Sbjct: 499 LISLLKERNDKHEAQEG-----------------------------------FEESDNLQ 523

Query: 417 SEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTD 476
             K TI+FV ++   + +   L + G+ +  I+       R   L  +R    S+L+ T+
Sbjct: 524 DNK-TIIFVASQQICDILETNLVSSGFEIFSIHAGKPYQERVLNLEKYRRTRNSLLLCTE 582

Query: 477 VAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           V +RG+++P ++ VI Y+   +   +IH  GRTAR  ++G A S +
Sbjct: 583 VLSRGLNVPEVSLVIIYNAVKTFAQYIHTTGRTARGNSKGKAVSFL 628

>KAFR0G02030 Chr7 complement(428516..430336) [1821 bp, 606 aa] {ON}
           Anc_8.614 YOR204W
          Length = 606

 Score =  181 bits (460), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 120/408 (29%), Positives = 197/408 (48%), Gaps = 69/408 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI-E 186
           F +  L  L+L NI    F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 140 FTAPTLEGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 199

Query: 187 KLKT------------HSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGD 234
             K             +  K    AVI++P+REL  Q     K+F+  S ++  ++ GG 
Sbjct: 200 SFKNGPTPLPENSGSHYQRKAYPTAVIMAPTRELVSQIFDEAKKFTYRSWVKPCVVYGGA 259

Query: 235 SLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 294
            + +Q   M    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 260 PIANQMREMDRGCDLLVATPGRLSDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHI 319

Query: 295 LVAFPTN----RQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKK 350
           +          RQTL+FSAT P+ +   A+  LS+ + + +      SEN+    + ++ 
Sbjct: 320 VEGCDMTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQRVLYVED 379

Query: 351 DEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLP 410
           +++++ LL LL  + +       + K+L  Q                             
Sbjct: 380 EDKKSALLDLLAASDEGLTLIFVETKRLADQ----------------------------- 410

Query: 411 NANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTS 470
                                  +T  L    +  + I+G   Q  R++ L  FR+G  +
Sbjct: 411 -----------------------LTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAAN 447

Query: 471 ILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWA 518
           +LV T VAARG+DIP + +VIN+ LP     ++HR+GRT RAGN G A
Sbjct: 448 LLVATAVAARGLDIPNVTHVINFDLPSDIDDYVHRIGRTGRAGNTGVA 495

>NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {ON}
           Anc_6.148
          Length = 887

 Score =  184 bits (468), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 119/405 (29%), Positives = 204/405 (50%), Gaps = 42/405 (10%)

Query: 128 FASFGLSKLVLINISKK-GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           ++  GL+   +  I+K   +   TPIQ + IP I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 292 WSQLGLNTDTMNLITKNLRYETLTPIQSQAIPAIMSGRDVIGISKTGSGKTISYLLPLLR 351

Query: 187 KLKTHSA----KIGVRAVILSPSRELAIQTHRVFKEF-SKGSDLRSILLTGGDSLEDQFG 241
            +K        + G   +IL+P+RELA+Q H   + F     ++RSI  TGG  L+ Q  
Sbjct: 352 HIKAQRPLSKNETGPLGLILAPTRELALQIHDEIERFIVHDENIRSICCTGGSELKKQIN 411

Query: 242 MMMGNPDVVIATPGRFLHLKVEMNLDLKSVE---YVVFDEADRLFEMGFQEQLNELLVAF 298
            +     +V+ATPGRF+ L       L S E   +V+ DEADRLF++GF+ Q+ +++   
Sbjct: 412 DLKRGVQIVVATPGRFIDLLTLNTGKLVSTERITFVIMDEADRLFDLGFEPQITQIMKTI 471

Query: 299 PTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDERE-ANL 357
             ++Q +LFSAT P+ L +FA   L++P+ + +++   ++EN+E      + D  +   L
Sbjct: 472 RPDKQCVLFSATFPNKLRNFAMRILNSPLSITINSNNLVNENVEQKVAICETDSAKFQEL 531

Query: 358 LYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPS 417
           L +LQ              + KQQ+                                   
Sbjct: 532 LTILQ-------------NQNKQQDQCENDEDEEREDETTL------------------- 559

Query: 418 EKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDV 477
           +K TI+FV ++   + +   L N GY +  I+       R   L  F+    SIL+ T+V
Sbjct: 560 DKKTIIFVASQQICDLLYSQLVNFGYSLFAIHAGKPYQERITNLEGFKNTKNSILICTEV 619

Query: 478 AARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
            +RG+++P ++ VI Y+   +   ++H  GRTAR    G A +++
Sbjct: 620 LSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGNLHGIAITLL 664

>TDEL0G00650 Chr7 (132659..134116) [1458 bp, 485 aa] {ON} Anc_5.40
           YMR290C
          Length = 485

 Score =  178 bits (451), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 121/404 (29%), Positives = 197/404 (48%), Gaps = 64/404 (15%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F+   LS   +  + K GF   TP+Q +TIP +L  RD++G A+TGSGKT AF++P IE+
Sbjct: 23  FSGLNLSDATMKAVEKMGFSSMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIER 82

Query: 188 LKTHSAKI----GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           L  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   +
Sbjct: 83  L--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTYGIVIGGANRRQEADKL 140

Query: 244 MGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-N 301
               +++IATPGR L HL+       K+++ +V DEADR+ E+GF++++ +++   P  +
Sbjct: 141 AKGVNMLIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMRQIIKILPNDD 200

Query: 302 RQTLLFSATLPSSLVDFAKAGL-SNPVLVRLDAE--TKISENLEMLFISIKKDEREANLL 358
           RQ++LFSAT  + + D A+  L   P+ + + +E     ++ LE  ++    D+R   L 
Sbjct: 201 RQSMLFSATQTTKVEDLARISLRPGPLFINVVSEKDNSTADGLEQGYVVCDSDKRFLLLF 260

Query: 359 YLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSE 418
             L+   K                                                    
Sbjct: 261 SFLKRNQK---------------------------------------------------- 268

Query: 419 KATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVA 478
           K  IVF+ + + V+Y  +LL      V  ++G   Q  R    + F      IL+ TDVA
Sbjct: 269 KKVIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVA 328

Query: 479 ARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           ARG+DIP +  +I +  P   + +IHRVGRTAR G +G   S++
Sbjct: 329 ARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 371

>TBLA0B07950 Chr2 complement(1884315..1885496) [1182 bp, 393 aa]
           {ON} Anc_5.69 YHR169W
          Length = 393

 Score =  176 bits (445), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 129/409 (31%), Positives = 185/409 (45%), Gaps = 64/409 (15%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F + GLS+ ++ ++       PT IQ+  IP IL+ RD +G A+TGSGKT AF  PM+ 
Sbjct: 7   NFENLGLSRWLVESLKSMKITTPTAIQKHCIPEILKGRDCIGGAKTGSGKTIAFAGPMLT 66

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
           K        G+ AVIL+P+RELA+Q    F       ++R  L+ GG+++  Q   +   
Sbjct: 67  KWSEDPC--GMFAVILTPTRELAMQIAEQFTALGSSMNIRVCLVVGGENIVKQALELQNK 124

Query: 247 PDVVIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-- 300
           P  +IATPGR  H  +    D        +Y+V DEAD L    F + L+  +   P   
Sbjct: 125 PHFIIATPGRLAHHILRSGEDTVGGFIRCKYLVLDEADILLTSTFSKDLSVCIGKLPPKE 184

Query: 301 NRQTLLFSATLPSS---LVDFAKAGLSNPVL---VRLDAETKISENLEMLFISIKKDERE 354
            RQTLLF+AT+      L D  K     P+    V    +  I   L+  ++ +    +E
Sbjct: 185 KRQTLLFTATITDQVKVLQDAPKHDGRLPLFSYQVESIDKVAIPSTLKTEYVLVPGHVKE 244

Query: 355 ANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANE 414
           A L +LL                                                    E
Sbjct: 245 AYLYHLL--------------------------------------------------TCE 254

Query: 415 MPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVV 474
             +E + IVFV      E + + L +    V+ ++  + Q  R   L+ FRA    +L+ 
Sbjct: 255 AYNESSAIVFVNRTVTAEILRRTLYDLEVRVTSLHSQMPQQERTNSLHRFRANAARVLIA 314

Query: 475 TDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           TDVA+RG+DIP +  VINY LP     FIHR GRTARAG  G A S V+
Sbjct: 315 TDVASRGLDIPTVELVINYDLPADPDTFIHRSGRTARAGRTGDAISFVT 363

>TBLA0C06780 Chr3 complement(1636223..1637713) [1491 bp, 496 aa]
           {ON} Anc_5.40 YMR290C
          Length = 496

 Score =  178 bits (451), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 131/435 (30%), Positives = 219/435 (50%), Gaps = 68/435 (15%)

Query: 97  DEKKATNESDDDLNDYFNTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKT 156
           +++K++ E D +L +  N +++A    +  +FA   LS+  L  I K  F + T +Q +T
Sbjct: 7   EDEKSSPEQDSNL-EVENGSSEAP---ETTAFADLNLSEPTLKAIGKLDFTEMTAVQART 62

Query: 157 IPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKI----GVRAVILSPSRELAIQT 212
           IP +L  RD++G A+TGSGKT AF++P IE L  HS K     G   ++++P+RELA+Q 
Sbjct: 63  IPPLLAGRDVLGAAKTGSGKTLAFLIPAIEML--HSLKFKPRNGTGVIVITPTRELALQI 120

Query: 213 HRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSV 271
             V +E  +       ++ GG +   +   ++   +++IATPGR L HL+       K++
Sbjct: 121 FGVARELMEFHSQTFGIVIGGANRRQEADKLVKGVNILIATPGRLLDHLQNTKGFVFKNL 180

Query: 272 EYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQTLLFSATLPSSLVDFAKAGL-SNPVLV 329
           + +V DEADR+ E+GF++++ +++   P  +RQ++LFSAT  + + D A+  L   P+ +
Sbjct: 181 KALVIDEADRILEIGFEDEMKQIIKILPNEDRQSMLFSATQTTKVEDLARISLRKGPLFI 240

Query: 330 RLDAE--TKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXX 387
            +  E  T  ++ LE  ++  + D+R   L   L+          +Q KK+         
Sbjct: 241 NVVPENDTSTADGLEQGYVVCESDKRFLLLFSFLK---------RNQKKKI--------- 282

Query: 388 XXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSY 447
                                             IVF+ + + V+Y  +LL      V  
Sbjct: 283 ----------------------------------IVFLSSCNSVKYYAELLNYIDLPVLE 308

Query: 448 IYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVG 507
           ++G   Q  R    + F      ILV TDVAARG+DIP +  +I +  P   + +IHRVG
Sbjct: 309 LHGKQKQQKRTNTFFEFCNAERGILVCTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVG 368

Query: 508 RTARAGNRGWAFSIV 522
           RTAR G +G   S++
Sbjct: 369 RTAR-GTKGKGKSLM 382

>AGR333C Chr7 complement(1353154..1354668) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR290C
           (HAS1)
          Length = 504

 Score =  178 bits (452), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 126/404 (31%), Positives = 199/404 (49%), Gaps = 64/404 (15%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    LS   L  I K GF + T +Q +TIP ++  RD++G A+TGSGKT AF+LP IE 
Sbjct: 41  FDELNLSSQTLKAIGKMGFTKMTQVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPAIEM 100

Query: 188 LKTHSAKI----GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           L  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   +
Sbjct: 101 L--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKL 158

Query: 244 MGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-N 301
               +++IATPGR L HL+       K+++ +V DEADR+ E+GF++++ +++   P  +
Sbjct: 159 AKGVNLLIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNED 218

Query: 302 RQTLLFSATLPSSLVDFAKAGL-SNPVLVRLDA--ETKISENLEMLFISIKKDEREANLL 358
           RQ++LFSAT  + + D A+  L   P+ + +D+  ET  ++ LE  ++    D+R   L 
Sbjct: 219 RQSMLFSATQTTKVEDLARISLRPGPLFINVDSEKETSTADGLEQGYVVCDSDKRFLLLF 278

Query: 359 YLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSE 418
             L+                K QN                                    
Sbjct: 279 TFLK----------------KFQN------------------------------------ 286

Query: 419 KATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVA 478
           K  IVF+ + + V+Y  +LL      V  ++G   Q  R    + F      ILV TDVA
Sbjct: 287 KKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDVA 346

Query: 479 ARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           ARG+DIP +  +I +  P   + +IHRVGRTA+ G +G   S++
Sbjct: 347 ARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAK-GTKGKGKSLM 389

>Kpol_513.15 s513 complement(41334..42839) [1506 bp, 501 aa] {ON}
           complement(41334..42839) [1506 nt, 502 aa]
          Length = 501

 Score =  178 bits (451), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 125/405 (30%), Positives = 200/405 (49%), Gaps = 64/405 (15%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F    LS   L  I K GF   TP+Q +TIP +L  RD++G A+TGSGKT AF++P IE
Sbjct: 38  NFKDLKLSDPTLKAIEKMGFTSMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIE 97

Query: 187 KLKTHSAKI----GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGM 242
            L  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   
Sbjct: 98  ML--HSLKFKPRNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEK 155

Query: 243 MMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT- 300
           ++   ++++ATPGR L HL+       K+++ +V DEADR+ E+GF++++ +++   P  
Sbjct: 156 LIKGVNMLVATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNE 215

Query: 301 NRQTLLFSATLPSSLVDFAKAGL-SNPVLVRLDAE--TKISENLEMLFISIKKDEREANL 357
           +RQ++LFSAT  + + D A+  L   P+ + +  E  T  ++ LE  ++  + D+R   L
Sbjct: 216 DRQSMLFSATQTTKVEDLARISLRKGPLFINVVTERDTSTADGLEQGYVVCESDKRFLLL 275

Query: 358 LYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPS 417
              L+          +Q KK+                                       
Sbjct: 276 FSFLK---------RNQKKKI--------------------------------------- 287

Query: 418 EKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDV 477
               IVF+ + + V Y  +LL      V  ++G   Q  R    + F      ILV TDV
Sbjct: 288 ----IVFLSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV 343

Query: 478 AARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           AARG+DIP +  +I +  P   + +IHRVGRTAR G +G   S++
Sbjct: 344 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 387

>NCAS0F02200 Chr6 (438960..440486) [1527 bp, 508 aa] {ON} Anc_5.40
          Length = 508

 Score =  178 bits (451), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 123/404 (30%), Positives = 200/404 (49%), Gaps = 64/404 (15%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    LS   L  I K GF   TP+Q +TIP ++  RD++G A+TGSGKT AF++P IE 
Sbjct: 46  FQDLTLSPPTLKAIEKMGFTTLTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIEL 105

Query: 188 LKTHSAKI----GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           L  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   +
Sbjct: 106 L--HSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKL 163

Query: 244 MGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-N 301
           M   +++IATPGR L HL+       K+++ ++ DEADR+ E+GF++++ +++   P  +
Sbjct: 164 MKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMKQIIKILPNED 223

Query: 302 RQTLLFSATLPSSLVDFAKAGL-SNPVLVRLDAE--TKISENLEMLFISIKKDEREANLL 358
           RQ++LFSAT  + + D A+  L   P+ + + +E  T  ++ LE  ++    D+R   L 
Sbjct: 224 RQSMLFSATQTTKVEDLARISLRKGPLFINVASEDNTSTADGLEQGYVVCDSDKRFLLLF 283

Query: 359 YLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSE 418
             L+          +Q KK+                                        
Sbjct: 284 SFLK---------RNQKKKI---------------------------------------- 294

Query: 419 KATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVA 478
              IVF+ + + V+Y  +LL      V  ++G   Q  R    + F      IL+ TDVA
Sbjct: 295 ---IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNADRGILICTDVA 351

Query: 479 ARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           ARG+DIP +  ++ +  P   + +IHRVGRTAR G +G   S++
Sbjct: 352 ARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 394

>KLLA0A10659g Chr1 complement(927059..928255) [1197 bp, 398 aa] {ON}
           highly similar to uniprot|Q12099 Saccharomyces
           cerevisiae YDR021W FAL1 Nucleolar protein required for
           maturation of 18S rRNA member of the eIF4A subfamily of
           DEAD-box ATP-dependent RNA helicases
          Length = 398

 Score =  175 bits (443), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 107/420 (25%), Positives = 206/420 (49%), Gaps = 62/420 (14%)

Query: 113 FNTTADAAAKHK-------KGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRD 165
           FN   D+  K K         +F S  L   +L  I   GF  P+ IQ + I  I+  +D
Sbjct: 3   FNRDDDSKLKFKTSKKLKVSATFESMNLKPDLLRGIYFYGFEYPSSIQSRAISQIISGKD 62

Query: 166 IVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDL 225
           ++  A++G+GKTA F + +++ + + S ++  +A++LSP+RELA Q+  V        ++
Sbjct: 63  VIAQAQSGTGKTATFTIGLLQAIDSKSKEL--QALVLSPTRELASQSESVISNLGDYLNV 120

Query: 226 RSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-- 283
            +   TGG +L+     +  N  VV  TPGR L +     L++++ + +V DEAD L   
Sbjct: 121 TAHACTGGKALQQDIKKVSKNCQVVSGTPGRVLDMIKRQVLNVRNCKILVLDEADELLGE 180

Query: 284 EMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEM 343
            +GF++Q+ ++    P   Q ++ SAT+   +++  K  +S+PV + +  +    + ++ 
Sbjct: 181 TLGFKQQIYDIFTKLPPTIQVVVVSATMSKDILEITKKFMSDPVKILVKRDEISLDVIKQ 240

Query: 344 LFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXX 403
            ++ ++K+E + + L  L +++ +                                    
Sbjct: 241 YYVDVEKEEWKFDTLCDLYDSLTIT----------------------------------- 265

Query: 404 XXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYN 463
                             ++F  TR  V+++++ L    + VS ++G + Q  R Q + +
Sbjct: 266 ----------------QCVIFCNTRKKVDWLSRKLTQTNFSVSSMHGDMKQEERDQVMND 309

Query: 464 FRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           FR+G   +L+ TDV ARG+D+  ++ VINY +P + + +IHR+GR+ R G +G A + ++
Sbjct: 310 FRSGKARVLISTDVWARGIDVQQISLVINYDIPDNLENYIHRIGRSGRFGRKGVAINFIT 369

>Suva_13.480 Chr13 complement(832037..833554) [1518 bp, 505 aa] {ON}
           YMR290C (REAL)
          Length = 505

 Score =  177 bits (449), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 135/451 (29%), Positives = 217/451 (48%), Gaps = 83/451 (18%)

Query: 86  DSKFPSLELSDD-----EKKATNESDDDLNDYFNTTADAAAKHKKGSFASFGLSKLVLIN 140
           DS+ P   + D+     +K+AT+E+D     Y  T            FA   LS+  L  
Sbjct: 11  DSESPEEPVVDEIESIKQKEATSEADQ--TTYVET------------FAELNLSEPTLKA 56

Query: 141 ISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKI----G 196
           I K GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P IE L  HS K     G
Sbjct: 57  IEKMGFTTMTSVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIELL--HSLKFKPRNG 114

Query: 197 VRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGR 256
              ++++P+RELA+Q   V +E  +       ++ GG +   +   +M   +++IATPGR
Sbjct: 115 TGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLMKGVNMLIATPGR 174

Query: 257 FL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NRQTLLFSATLPSS 314
            L HL+       K+++ ++ DEADR+ E+GF++++ +++   P  +RQ++LFSAT  + 
Sbjct: 175 LLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPNDDRQSMLFSATQTTK 234

Query: 315 LVDFAKAGL-SNPVLVRLDAET--KISENLEMLFISIKKDEREANLLYLLQEAIKMPVAT 371
           + D A+  L   P+ + +  ET    ++ LE  ++    D R   L   L+         
Sbjct: 235 VEDLARISLRPGPLFINVVPETDNSTADGLEQGYVVCDSDNRFLLLFSFLK--------- 285

Query: 372 ESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHV 431
            +Q KK+                                           IVF+ + + V
Sbjct: 286 RNQKKKI-------------------------------------------IVFLSSCNSV 302

Query: 432 EYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVI 491
           +Y  +LL      V  ++G   Q  R    + F      IL+ TDVAARG+DIP +  ++
Sbjct: 303 KYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVAARGLDIPAVDWIV 362

Query: 492 NYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
            +  P   + +IHRVGRTAR G +G   S++
Sbjct: 363 QFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 392

>Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}
           similar to Ashbya gossypii AFR452C
          Length = 565

 Score =  178 bits (452), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 134/443 (30%), Positives = 214/443 (48%), Gaps = 71/443 (16%)

Query: 98  EKKATNESDDD---LNDYFNTTADAAA-KHKKGSFASFGL--SKLVLINISKKGFRQPTP 151
           EKK +  ++ D   L + FN TA     KH   +++   L  + +V +     G+ +PTP
Sbjct: 129 EKKLSEMTERDWRILREDFNITAKGGGMKHPLRNWSELKLIPTDIVKVITDDLGYEEPTP 188

Query: 152 IQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK------LKTHSAKIGVRAVILSPS 205
           IQR TIP +   RD +G+A TGSGKT AF++P+  K      L   + + G +A+IL+P+
Sbjct: 189 IQRATIPNVQNNRDFMGVASTGSGKTLAFLIPIFMKFTKLPPLNVITRQDGPQALILAPT 248

Query: 206 RELAIQTHRVFKEFSKGSDLRSILLT---GGDSLEDQFGMMMGNPDVVIATPGRFLHLKV 262
           RELA Q     K+F      R  L+T   GG +LE+    +    ++++ATPGR +    
Sbjct: 249 RELAQQIEAEAKKFCAHWK-RPCLVTSIVGGHTLEEIIFNLQDGCNILVATPGRLIDCLE 307

Query: 263 EMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFP--TNRQTLLFSATLPSSLVDFAK 320
              L LK V  +V DEADR+ + GF++QL  +L        +QTL+F+AT+ SS+   A 
Sbjct: 308 NHVLVLKQVYTLVLDEADRMVDFGFEDQLTTILARTDDILEKQTLMFTATMSSSIERIAN 367

Query: 321 AGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQ 380
             L NP  V +       +                     +Q+ I+  VAT+ Q  K+  
Sbjct: 368 GYLRNPGFVTIGGSGSAPQ---------------------IQQIIEY-VATDEQRFKMLT 405

Query: 381 QNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLK- 439
           Q+                          LPN          I+F+  +   +++ +  + 
Sbjct: 406 QDI-------------------------LPN-----YRPPVIIFINYKVTADWLLRKFQE 435

Query: 440 NCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSS 499
              + V+ ++G+ +Q  R+  L  FR G   I+V TDVA RG+DIP ++ V+N+ +P   
Sbjct: 436 ESKFRVTILHGSKSQTQREHSLKAFREGKVDIMVATDVAGRGIDIPNVSLVVNFQMPSKL 495

Query: 500 KIFIHRVGRTARAGNRGWAFSIV 522
             +IHR+GRT RA  +G   + +
Sbjct: 496 DDYIHRIGRTGRANQKGTTLTFL 518

>ZYRO0D07546g Chr4 (657145..658629) [1485 bp, 494 aa] {ON} highly
           similar to uniprot|Q03532 Saccharomyces cerevisiae
           YMR290C HAS1 ATP-dependent RNA helicase localizes to
           both the nuclear periphery and nucleolus highly enriched
           in nuclear pore complex fractions
          Length = 494

 Score =  176 bits (447), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 126/405 (31%), Positives = 202/405 (49%), Gaps = 64/405 (15%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F    LS+  L  I K GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P IE
Sbjct: 31  TFGELELSQPTLKAIDKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIE 90

Query: 187 KLKTHSAKI----GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGM 242
           +L  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   
Sbjct: 91  RL--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADK 148

Query: 243 MMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT- 300
           ++   +++IATPGR L HL+       K+++ ++ DEADR+ E+GF+E++ +++   P  
Sbjct: 149 LVKGVNLLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEEEMRQIIKILPNE 208

Query: 301 NRQTLLFSATLPSSLVDFAKAGL-SNPVLVRLDAETKIS--ENLEMLFISIKKDEREANL 357
           +RQ++LFSAT  + + D A+  L + P+ + + +E   S  E LE  ++    D+R   L
Sbjct: 209 DRQSMLFSATQTTKVEDLARISLRAGPLFINVVSEKDNSTVEGLEQGYVVCDSDKRFLLL 268

Query: 358 LYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPS 417
              L+          +Q KK+                                       
Sbjct: 269 FSFLK---------RNQKKKI--------------------------------------- 280

Query: 418 EKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDV 477
               IVF+ + + V+Y  +LL      V  ++G   Q  R    + F      ILV TDV
Sbjct: 281 ----IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVSTDV 336

Query: 478 AARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           AARG+DIP +  +I +  P   + +IHRVGRTAR G +G   S++
Sbjct: 337 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GAKGKGKSLM 380

>SAKL0D03960g Chr4 complement(321960..323156) [1197 bp, 398 aa] {ON}
           highly similar to uniprot|Q12099 Saccharomyces
           cerevisiae YDR021W FAL1 Nucleolar protein required for
           maturation of 18S rRNA member of the eIF4A subfamily of
           DEAD-box ATP-dependent RNA helicases
          Length = 398

 Score =  174 bits (440), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 104/399 (26%), Positives = 197/399 (49%), Gaps = 55/399 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F S  L + +L  I   GF  P+ IQ + I  I+  RD++  A++G+GKTA F + M++
Sbjct: 24  TFESMKLKEDLLRGIYSYGFEAPSAIQSRAITQIISGRDVIAQAQSGTGKTATFTIGMLQ 83

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
            +   S  +  ++++LSP+RELA Q  +V         + +   TGG +L+     +  +
Sbjct: 84  AIDVKSKDL--QSLVLSPTRELATQISQVVSNLGDYMSISAHACTGGKTLQADIKKLSKS 141

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFE--MGFQEQLNELLVAFPTNRQT 304
             VV  TPGR L +     L+ ++V+ +V DEAD L    +GF++Q+ ++    PT+ Q 
Sbjct: 142 CQVVSGTPGRVLDMIKRRLLNTRNVKMLVLDEADELLSETLGFKQQIYDIFTKLPTSVQV 201

Query: 305 LLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEA 364
           ++ SAT+   +++  K  +S+PV + +  +    E ++   +++ K+E + + L  L ++
Sbjct: 202 VVVSATMNKDILEITKKFMSDPVKILVKRDEISLEGIKQYHVNVDKEEWKFDTLCDLYDS 261

Query: 365 IKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVF 424
           + +                                                      ++F
Sbjct: 262 LTIT---------------------------------------------------QCVIF 270

Query: 425 VPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDI 484
             T+  V++++  L    + VS ++G + Q  R + + +FR G + +L+ TDV ARG+D+
Sbjct: 271 CNTKKKVDWLSHKLAQANFAVSAMHGDMKQEERDKVMNDFRNGTSRVLISTDVWARGIDV 330

Query: 485 PLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
             ++ VINY LP   + +IHR+GR+ R G +G A + ++
Sbjct: 331 QQVSLVINYDLPEILESYIHRIGRSGRFGRKGVAINFIT 369

>YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}
           PRP28RNA helicase in the DEAD-box family, involved in
           RNA isomerization at the 5' splice site
          Length = 588

 Score =  178 bits (451), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 131/411 (31%), Positives = 203/411 (49%), Gaps = 75/411 (18%)

Query: 136 LVLINISKKGFRQPTPIQRKTIPLIL---QKRDIVGMARTGSGKTAAFVLPMIEKL---- 188
           L+ + I +  F  PTPIQR TIP +    Q RD +G+A TGSGKT AFV+P++ K+    
Sbjct: 184 LLRVIIQELRFPSPTPIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPILIKMSRSP 243

Query: 189 -KTHSAKI--GVRAVILSPSRELAIQ----THRVFKEFSKGS--DLRSILLTGGDSLEDQ 239
            +  S KI  G +A+IL+P+REL  Q    T +V K +SK S  D + I + GG SLE+ 
Sbjct: 244 PRPPSLKIIDGPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGGHSLEEI 303

Query: 240 FGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAF- 298
              +    D+++ATPGR +       L +K VE +V DEAD++ ++GF++Q+  +L    
Sbjct: 304 SFSLSEGCDILVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVD 363

Query: 299 -----PTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDER 353
                  NRQTL+F+AT+   +   A   +  PV   +  ET  SE              
Sbjct: 364 INADSAVNRQTLMFTATMTPVIEKIAAGYMQKPVYATIGVETG-SEP------------- 409

Query: 354 EANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNAN 413
                 L+Q+ ++     E + KKLK                              P   
Sbjct: 410 ------LIQQVVEYADNDEDKFKKLK------------------------------PIVA 433

Query: 414 EMPSEKATIVFVPTRHHVEYVTQ-LLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSIL 472
           +   +   I+F+  +   +++ +   K     V+ ++G+ +Q  R+  L  FR     I+
Sbjct: 434 KY--DPPIIIFINYKQTADWLAEKFQKETNMKVTILHGSKSQEQREHSLQLFRTNKVQIM 491

Query: 473 VVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           + T+VAARG+DIP ++ V+N+ +      +IHR+GRT RA N G A S VS
Sbjct: 492 IATNVAARGLDIPNVSLVVNFQISKKMDDYIHRIGRTGRAANEGTAVSFVS 542

>KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {ON}
           Anc_6.148 YBR237W
          Length = 884

 Score =  182 bits (461), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 116/407 (28%), Positives = 210/407 (51%), Gaps = 58/407 (14%)

Query: 128 FASFGL--SKLVLI-NISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPM 184
           ++  GL  SK+ LI N+ K  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP+
Sbjct: 306 WSQLGLDTSKMNLIENVFK--FDSLTPIQAQALPAIMSGRDVIGISKTGSGKTISYLLPL 363

Query: 185 IEKLKTHSA----KIGVRAVILSPSRELAIQTHR-VFKEFSKGSDLRSILLTGGDSLEDQ 239
           +  +K        + G  A+I++P+RELA+Q ++   +       LR+I  TGG  L+ Q
Sbjct: 364 LRHIKAQRPLSKNETGPLALIIAPTRELALQIYQETLRFLDSDKSLRAICCTGGSQLKTQ 423

Query: 240 FGMMMGNPDVVIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELL 295
              +    ++V+ATPGRF+ L + MN    +  K + +VV DEADRLF+MGF+ Q+ +++
Sbjct: 424 INDLKRGTEIVVATPGRFIDL-LTMNSGKLISSKKISFVVLDEADRLFDMGFEPQVTQIM 482

Query: 296 VAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREA 355
                ++Q +LFSAT P+ L +FA   L +P+ + +++ T ++EN+         +  + 
Sbjct: 483 KTIRPDKQCVLFSATFPNKLRNFAMRVLKSPLSITINSNTMVNENVTQKVELCNNELDKF 542

Query: 356 NLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEM 415
           ++L  L E  +  + +  Q +K+                                     
Sbjct: 543 DILLSLLEKHQAKLVSPEQDEKV------------------------------------- 565

Query: 416 PSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVT 475
                 I+FV ++   + +   L+N  Y +  I+   +   R   L  F+    SIL+ T
Sbjct: 566 ------IIFVASQQICDTLYAKLENYDYDLFAIHAGKSYQERITNLNKFKETANSILICT 619

Query: 476 DVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           +V +RG+++P ++ V+ ++   +   ++H  GRTAR  N G A +++
Sbjct: 620 EVLSRGLNVPEVSLVVIFNAIKTFAQYVHTTGRTARGNNHGDAITLL 666

>AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR169W
           (DBP8)
          Length = 435

 Score =  174 bits (441), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 124/427 (29%), Positives = 188/427 (44%), Gaps = 64/427 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F   G++K +   ++     QPT IQ+  IP IL  RD +G A+TGSGKT AF  PM+ 
Sbjct: 7   TFKDLGVAKWLAEALNSMKITQPTTIQKACIPEILAGRDCIGGAKTGSGKTIAFAAPMLT 66

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
           K        G+  ++L+P+RELA+Q    F       ++R  L+ GG+ +  Q   +   
Sbjct: 67  KWSADPC--GMFGIVLTPTRELAMQIAEQFTALGSVMNIRVALVVGGEDIVSQALELQRK 124

Query: 247 PDVVIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-- 300
           P  +IATPGR  H  +    D    LK V Y+V DEAD L    F + L   +   P   
Sbjct: 125 PHFIIATPGRLAHHIMHSGEDTIGGLKRVRYLVLDEADILLTDTFSDALATCVQILPPKE 184

Query: 301 NRQTLLFSATLPSSLVDFAKAGLSN--PVLVRLDAET----KISENLEMLFISIKKDERE 354
            RQ LLF+AT+   ++    A  ++  P L     E      +  +L+  ++ + +  +E
Sbjct: 185 KRQNLLFTATMTDQVLALKDAPPTSGKPPLFSFHVENLDDLAVPASLQTTYLLVPEHVKE 244

Query: 355 ANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANE 414
           A L  +L                                                  ++E
Sbjct: 245 AYLYQVL--------------------------------------------------SSE 254

Query: 415 MPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVV 474
               K+ IVFV      E + ++L      V+ ++  + Q  R   L  FRA    +L+ 
Sbjct: 255 EYKSKSAIVFVNRTISAEILRRMLMQLEIRVTSLHSQMPQRERTNSLQRFRANAARVLIA 314

Query: 475 TDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXX 534
           TDVA+RG+DIP +  V+NY +P +   +IHR GRTARAG  G A S ++           
Sbjct: 315 TDVASRGLDIPAVQLVVNYDIPANPDTYIHRAGRTARAGRGGEALSFIAPKDVSRIQAIE 374

Query: 535 XXXGKKI 541
              GKK+
Sbjct: 375 ERIGKKM 381

>Kwal_23.4288 s23 (654900..656378) [1479 bp, 492 aa] {ON} YMR290C
           (HAS1) - Putative RNA-dependent helicase [contig 1] FULL
          Length = 492

 Score =  175 bits (443), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 128/420 (30%), Positives = 202/420 (48%), Gaps = 68/420 (16%)

Query: 116 TADAA----AKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMAR 171
           +AD A    A   K  F+   LS   +  + K GF   T +Q +TIP +L  RD++G A+
Sbjct: 14  SADVANAPEAPEYKEKFSELNLSSPTIKAVEKLGFTTMTQVQSRTIPPLLAGRDVLGAAK 73

Query: 172 TGSGKTAAFVLPMIEKLKTHSAKI----GVRAVILSPSRELAIQTHRVFKEFSKGSDLRS 227
           TGSGKT AF+LP +E L  HS K     G   V+++P+RELA+Q   V K   +      
Sbjct: 74  TGSGKTLAFLLPAVEML--HSLKFKPRNGTGVVVITPTRELALQIFGVAKSLMEFHSQTF 131

Query: 228 ILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMG 286
            ++ GG +   +   +    +++IATPGR L HL+       K+++ ++ DEADR+ E+G
Sbjct: 132 GIVIGGANRRQEADKLAKGVNLLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIG 191

Query: 287 FQEQLNELLVAFPT-NRQTLLFSATLPSSLVDFAKAGL-SNPVLVRLDAETKIS--ENLE 342
           F++++ +++   P  +RQT+LFSAT  + + D A+  L   P+ + +D+E + S  + LE
Sbjct: 192 FEDEMRQIVKILPNEDRQTMLFSATQTTKVEDLARISLRPGPLFINVDSEKENSTVDGLE 251

Query: 343 MLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXX 402
             ++  + D+R   L   L+   K                                    
Sbjct: 252 QGYVVCESDKRFLLLFSFLKRNQK------------------------------------ 275

Query: 403 XXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLY 462
                           K  IVF+ + + V Y  +LL      V  ++G   Q  R    +
Sbjct: 276 ----------------KKVIVFLSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFF 319

Query: 463 NFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
            F       LV TDVAARG+DIP +  +I +  P   + +IHRVGRTAR G++G   S++
Sbjct: 320 EFCNAERGTLVCTDVAARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GSKGKGKSLM 378

>YMR290C Chr13 complement(850074..851591) [1518 bp, 505 aa] {ON}
           HAS1ATP-dependent RNA helicase; localizes to both the
           nuclear periphery and nucleolus; highly enriched in
           nuclear pore complex fractions; constituent of 66S
           pre-ribosomal particles
          Length = 505

 Score =  175 bits (444), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 124/404 (30%), Positives = 199/404 (49%), Gaps = 64/404 (15%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    LS+  L  I K GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P IE 
Sbjct: 44  FEELKLSQPTLKAIEKMGFTTMTSVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIEL 103

Query: 188 LKTHSAKI----GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           L  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   +
Sbjct: 104 L--HSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKL 161

Query: 244 MGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-N 301
           M   +++IATPGR L HL+       K+++ ++ DEADR+ E+GF++++ +++   P  +
Sbjct: 162 MKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPNED 221

Query: 302 RQTLLFSATLPSSLVDFAKAGL-SNPVLVRLDAET--KISENLEMLFISIKKDEREANLL 358
           RQ++LFSAT  + + D A+  L   P+ + +  ET    ++ LE  ++    D+R   L 
Sbjct: 222 RQSMLFSATQTTKVEDLARISLRPGPLFINVVPETDNSTADGLEQGYVVCDSDKRFLLLF 281

Query: 359 YLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSE 418
             L+          +Q KK+                                        
Sbjct: 282 SFLK---------RNQKKKI---------------------------------------- 292

Query: 419 KATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVA 478
              IVF+ + + V+Y  +LL      V  ++G   Q  R    + F      IL+ TDVA
Sbjct: 293 ---IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVA 349

Query: 479 ARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           ARG+DIP +  +I +  P   + +IHRVGRTAR G +G   S++
Sbjct: 350 ARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 392

>NDAI0C03600 Chr3 complement(826718..828277) [1560 bp, 519 aa] {ON}
           Anc_5.40
          Length = 519

 Score =  175 bits (444), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 117/403 (29%), Positives = 197/403 (48%), Gaps = 60/403 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F    LS   +  I K GF   TP+Q +TIP ++  RD++G A+TGSGKT AF++P IE
Sbjct: 52  NFNDLSLSSQTMKAIEKMGFESLTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIE 111

Query: 187 KLKTHSAKI--GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMM 244
            L +   K   G   ++++P+RELA+Q   V +E  +       ++ GG +   +   +M
Sbjct: 112 LLYSLKFKPRNGTGIIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLM 171

Query: 245 GNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-NR 302
              +++IATPGR L HL+       K+++ ++ DEADR+ E+GF++++ +++   P  +R
Sbjct: 172 KGVNILIATPGRLLDHLQNTKGFIFKNLKALIIDEADRILEIGFEDEMKQIIRILPNEDR 231

Query: 303 QTLLFSATLPSSLVDFAKAGL-SNPVLVRLDAE--TKISENLEMLFISIKKDEREANLLY 359
           Q++LFSAT  + + D A+  L   P+ + +++E  T  ++ LE  ++    D+R   L  
Sbjct: 232 QSMLFSATQTTKVEDLARISLRKGPLFINVESEKDTSTADGLEQGYVVCDSDKRFLLLFS 291

Query: 360 LLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEK 419
            L+   K                                                    +
Sbjct: 292 FLKRNQK----------------------------------------------------R 299

Query: 420 ATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAA 479
            ++ F  + + V+Y  +LL      V  ++G   Q  R    + F      ILV TDVAA
Sbjct: 300 KSLSFYSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNADKGILVCTDVAA 359

Query: 480 RGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           RG+DIP +  ++ +  P   + +IHRVGRTAR G +G   S++
Sbjct: 360 RGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 401

>KNAG0H01370 Chr8 complement(243799..244995) [1197 bp, 398 aa] {ON}
           Anc_3.249 YDR021W
          Length = 398

 Score =  172 bits (435), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 105/401 (26%), Positives = 196/401 (48%), Gaps = 57/401 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F S GL + +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + M++
Sbjct: 22  AFESMGLDRKLLQGIYAYGFEAPSAIQSRAITQIISGKDVIAQAQSGTGKTATFTIGMLQ 81

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSL--EDQFGMMM 244
                  +  ++ +ILSP+RELA Q + V        +++S+ L GG+ +  +D   +  
Sbjct: 82  --ACSFGQNDLQCLILSPTRELAGQINSVVGNLGSFLNVKSVALVGGNKMAKQDSQKLQN 139

Query: 245 GNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF--EMGFQEQLNELLVAFPTNR 302
           G   VV  TPGR L L     L +K  + +V DEAD L    +GF++Q+ ++    P N 
Sbjct: 140 GQVHVVSGTPGRVLDLIKRHVLVVKKCKMLVLDEADELLGESLGFKQQIYDIFTKLPKNC 199

Query: 303 QTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQ 362
           Q ++ SAT+   +++  K  ++ PV + +  E    E ++  ++ + K++ + + L  L 
Sbjct: 200 QVVVVSATMSKDIIEVTKKFMTTPVKILVKQEEISLEKIKQYYVDVDKEDWKFDTLCDLY 259

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
           +++ +                                                      +
Sbjct: 260 DSLTIT---------------------------------------------------QCV 268

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           +F  T+  V+++   L    + V+ ++G + Q  R + + +FR+G + +L+ TDV ARG+
Sbjct: 269 IFCNTKRKVDWLAIKLTQSNFSVASMHGDMKQEERDKVMSDFRSGKSRVLISTDVWARGI 328

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           D+  ++ V+NY LP   + +IHR+GR+ R G +G A + V+
Sbjct: 329 DVQQVSLVVNYDLPDIMENYIHRIGRSGRFGRKGIAINFVT 369

>Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON}
           YDR243C (REAL)
          Length = 604

 Score =  177 bits (448), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 126/410 (30%), Positives = 206/410 (50%), Gaps = 75/410 (18%)

Query: 136 LVLINISKKGFRQPTPIQRKTIPLIL---QKRDIVGMARTGSGKTAAFVLPMIEKL---- 188
           L+ I I +  F  PTPIQR TIP +    Q RD +G+A TGSGKT AF++P++ ++    
Sbjct: 200 LLHIVIHQLQFPLPTPIQRITIPNVCNAKQYRDFLGVASTGSGKTLAFIIPVLIRMSRSS 259

Query: 189 -KTHSAKI--GVRAVILSPSRELA----IQTHRVFKEFSKGS--DLRSILLTGGDSLEDQ 239
            +  S KI  G +A+IL+P+REL     ++  +V K +S+ S  D R + + GG SLE+ 
Sbjct: 260 PRPTSLKIMDGPKALILAPTRELVQQIQVEAEKVTKIWSRESNYDCRVVSIVGGHSLEEI 319

Query: 240 FGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAF- 298
              +    D+++ATPGR +       L +K VE +V DEAD++ ++GF++Q+  +L    
Sbjct: 320 SYSLSEGCDILVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDLGFEDQVTTILTKVD 379

Query: 299 -----PTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDER 353
                 TNRQTL+F+AT+   +   A   +  PV   +  +T  SE              
Sbjct: 380 VSADSATNRQTLMFTATMTPVIEKIAAGYMRKPVYATIGVDTG-SEP------------- 425

Query: 354 EANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNAN 413
                 L+Q+ ++     E + KKLK                             +    
Sbjct: 426 ------LIQQIVEYADNEEQKFKKLKS----------------------------IVTKY 451

Query: 414 EMPSEKATIVFVPTRHHVEYVTQ-LLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSIL 472
           E P     I+F+  +   +++ +   K     V+ ++G+ +Q  R+  L  FR+G   ++
Sbjct: 452 EPP----IIIFINYKQTADWLAERFQKETNMRVTILHGSKSQEQREHSLQLFRSGRVQVM 507

Query: 473 VVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           + T+VAARG+DIP ++ V+N+ +      +IHR+GRT RA  +G A S+V
Sbjct: 508 IATNVAARGLDIPNVSLVVNFQISKKIDDYIHRIGRTGRAAKKGTAISLV 557

>Smik_13.506 Chr13 complement(832760..834277) [1518 bp, 505 aa] {ON}
           YMR290C (REAL)
          Length = 505

 Score =  174 bits (442), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 124/404 (30%), Positives = 198/404 (49%), Gaps = 64/404 (15%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    LS+  L  I K GF   T +Q +TIP +L  RD++G A+TGSGKT AF++P IE 
Sbjct: 44  FEELKLSQPTLKAIEKMGFTTMTSVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIEL 103

Query: 188 LKTHSAKI----GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           L  HS K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   +
Sbjct: 104 L--HSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKL 161

Query: 244 MGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-N 301
           M   +++IATPGR L HL+       K+++ ++ DEADR+ E+GF++++ +++   P  +
Sbjct: 162 MKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMRQIIKILPNED 221

Query: 302 RQTLLFSATLPSSLVDFAKAGL-SNPVLVRLDAET--KISENLEMLFISIKKDEREANLL 358
           RQ++LFSAT  + + D A+  L   P+ + +  ET    ++ LE  ++    D R   L 
Sbjct: 222 RQSMLFSATQTTKVEDLARISLRPGPLFINVVPETDNSTADGLEQGYVVCDSDNRFLLLF 281

Query: 359 YLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSE 418
             L+          +Q KK+                                        
Sbjct: 282 SFLK---------RNQKKKI---------------------------------------- 292

Query: 419 KATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVA 478
              IVF+ + + V+Y  +LL      V  ++G   Q  R    + F      IL+ TDVA
Sbjct: 293 ---IVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDVA 349

Query: 479 ARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           ARG+DIP +  +I +  P   + +IHRVGRTAR G +G   S++
Sbjct: 350 ARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 392

>NCAS0A10430 Chr1 (2073293..2074492) [1200 bp, 399 aa] {ON}
           Anc_3.249
          Length = 399

 Score =  171 bits (434), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 108/421 (25%), Positives = 204/421 (48%), Gaps = 63/421 (14%)

Query: 113 FNTTADAAAKHKKG-------SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRD 165
           FN   D   K K         +F S  L   +L  I   GF  P+ IQ + I  I+   D
Sbjct: 3   FNRETDQKLKFKTSKKLKVSPTFESMSLKPDLLRGIYSYGFETPSSIQSRAITRIISGSD 62

Query: 166 IVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDL 225
           I+  A++G+GKTA F + M++ +     K  ++A+ILSP+RELA+Q ++V        ++
Sbjct: 63  IIAQAQSGTGKTATFAIGMLQIIDLK--KKDLQALILSPTRELAVQINQVVSNLGDYMNV 120

Query: 226 RSILLTGGDSLEDQF-GMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF- 283
           +S+ +TGG  ++D    +      VV  TPGR L +     L +++++ +V DEAD L  
Sbjct: 121 KSLAMTGGKMMKDDLKKVSKSGCQVVSGTPGRVLDMIKRQLLAIRNIQMLVLDEADELLG 180

Query: 284 -EMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLE 342
             +GF++Q+ ++    P + Q ++ SAT+   +++  K  +S+PV + +  +    E ++
Sbjct: 181 ESLGFKQQIYDIFAKLPKSCQVVVVSATMSKDIIEVTKKFMSDPVKILVKQDEISLEGIK 240

Query: 343 MLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXX 402
             ++ + K+E + + L  + +++ +                                   
Sbjct: 241 QYYVDVGKEEWKFDTLCDIYDSLTIT---------------------------------- 266

Query: 403 XXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLY 462
                              ++F  T+  V++++  L    + V  ++G + Q  R + + 
Sbjct: 267 -----------------QCVIFCNTKKKVDWLSAKLTQSNFAVVSMHGDMKQEERDKVMN 309

Query: 463 NFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           +FR G + +L+ TDV ARG+D+  ++ VINY LP + + +IHR+GR+ R G +G A + +
Sbjct: 310 DFRTGHSRVLISTDVWARGIDVQQVSLVINYDLPENMENYIHRIGRSGRFGRKGIAINFL 369

Query: 523 S 523
           +
Sbjct: 370 T 370

>KNAG0D02780 Chr4 complement(504774..506204) [1431 bp, 476 aa] {ON}
           Anc_5.40 YMR290C
          Length = 476

 Score =  173 bits (439), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 121/404 (29%), Positives = 197/404 (48%), Gaps = 64/404 (15%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F+S  LS   +  I K GF + T +Q +TIP +L  +D++G A+TGSGKT AF++P IE 
Sbjct: 11  FSSLELSAPTMKAIEKMGFTKMTTVQERTIPPLLAGKDVLGAAKTGSGKTLAFLIPAIET 70

Query: 188 LKTHSAKI----GVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           L  H+ K     G   ++++P+RELA+Q   V +E  +       ++ GG +   +   +
Sbjct: 71  L--HALKFKPRNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKL 128

Query: 244 MGNPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT-N 301
               +++IATPGR L HL+       K+++ +V DEADR+ E+GF++++ +++   P   
Sbjct: 129 AKGVNILIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIRILPNEE 188

Query: 302 RQTLLFSATLPSSLVDFAKAGL-SNPVLVRLDAET--KISENLEMLFISIKKDEREANLL 358
           RQ++LFSAT  + + D A+  L   P+ + +  ET    ++ LE  ++  + D+R   L 
Sbjct: 189 RQSMLFSATQTTKVEDLARISLRKGPLFINVVPETDHSTADGLEQGYVVCESDKRFLLLF 248

Query: 359 YLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSE 418
             L+   K                                                    
Sbjct: 249 SFLKRNQK---------------------------------------------------- 256

Query: 419 KATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVA 478
           K  IVF+ + + V+Y  +LL      V  ++G   Q  R    + F      ILV TDVA
Sbjct: 257 KKVIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDVA 316

Query: 479 ARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           ARG+DIP +  ++ +  P   + +IHRVGRTAR G +G   S++
Sbjct: 317 ARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 359

>TBLA0D02800 Chr4 (686898..688661) [1764 bp, 587 aa] {ON} Anc_8.469
           YDR243C
          Length = 587

 Score =  176 bits (445), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 131/422 (31%), Positives = 206/422 (48%), Gaps = 88/422 (20%)

Query: 132 GLSKLVLINISKK--GFRQPTPIQRKTIPLI----LQKRDIVGMARTGSGKTAAFVLPMI 185
           GL   ++++I KK   F +P+ IQR  IP I      KRD +G+A TGSGKT AFVLP+I
Sbjct: 174 GLMPDIVLDIIKKELKFEEPSAIQRVAIPNISSKKTPKRDFLGIASTGSGKTLAFVLPII 233

Query: 186 EKLKTHSAKI-------GVRAVILSPSRELAIQTHR----VFK---EFSKGSDLRSILLT 231
             L   S +I       G +A+IL+P+RELA Q  +    + K   E     +  S+ + 
Sbjct: 234 CSLIKSSPRIPLLKIKNGPKALILAPTRELAQQCQQEASNILKYIFERDPSLNFNSVSVI 293

Query: 232 GGDSLEDQFGMMMGNPDVVIATPGRFL-----HLKVEMNLDLKSVEYVVFDEADRLFEMG 286
           GG S+++Q   +    D++IATPGR +     H+ V  +LD     ++V DEADR+ ++G
Sbjct: 294 GGHSIQEQLQDLRNGADILIATPGRLIDVLESHMTVFSDLD-----FLVLDEADRMVDLG 348

Query: 287 FQEQLNELLVAFP-----TNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENL 341
           F++QL  +L          N QT++F+AT+   +   A   L  PV   +   T     +
Sbjct: 349 FEDQLLTILTHIQKASTILNIQTIMFTATMSPKIEKIANRYLKKPVYATIGNATSTEPQI 408

Query: 342 EMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXX 401
           E +            + Y   E +K         KKL                       
Sbjct: 409 EQI------------VDYAANEDVKF--------KKL----------------------- 425

Query: 402 XXXXXRRLPNANEMPSEKATIVFVPTRHHVEY-VTQLLKNCGYLVSYIYGALNQHARKQQ 460
                  L   +  PS    I+F+  +   ++ V +  +   + V+ I+G+ +Q  R+Q 
Sbjct: 426 -------LEYVSNFPS--PIIIFINYKRTADWLVDKFYQETTFRVTTIHGSKSQEQREQA 476

Query: 461 LYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFS 520
           L N R+G   IL+ T+VAARG+DIP ++ V+NY +P   + +IHR+GRT RA  +G A +
Sbjct: 477 LNNLRSGKAHILIATNVAARGIDIPNVSLVVNYQMPLKFEDYIHRIGRTGRASQKGTAVT 536

Query: 521 IV 522
           ++
Sbjct: 537 LL 538

>Suva_2.409 Chr2 complement(727948..729717) [1770 bp, 589 aa] {ON}
           YDR243C (REAL)
          Length = 589

 Score =  176 bits (445), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 124/400 (31%), Positives = 200/400 (50%), Gaps = 75/400 (18%)

Query: 146 FRQPTPIQRKTIPLILQK---RDIVGMARTGSGKTAAFVLPMIEKL-----KTHSAKI-- 195
           F  PTPIQR TIP + +K   RD +G+A TGSGKT AF++P++ ++     +  S KI  
Sbjct: 195 FHLPTPIQRITIPNVCRKKQYRDFLGVASTGSGKTLAFIVPILIRMSRSSPRPRSLKIMD 254

Query: 196 GVRAVILSPSRELAIQTH----RVFKEFS--KGSDLRSILLTGGDSLEDQFGMMMGNPDV 249
           G +A+IL+P+REL  Q      +V K++S     D + + + GG SLE+    +    D+
Sbjct: 255 GPKALILAPTRELVQQIQAEAEKVTKKWSIENNYDCKVVSIVGGHSLEEISFSLSEGCDI 314

Query: 250 VIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAF------PTNRQ 303
           ++ATPGR +       L +K VE +V DEAD++ ++GF++Q+  +L           NRQ
Sbjct: 315 LVATPGRLIDSLDNHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVDVSADSSINRQ 374

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQE 363
           T++F+AT+ S +   A   +  PV   +  +T  SE                    L+Q+
Sbjct: 375 TMMFTATMTSVIEKIAAGYMKKPVYATIGVDTG-SEP-------------------LIQQ 414

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
            ++     + + KKL                            R +    E P     IV
Sbjct: 415 IVEYSDNDDQKFKKL----------------------------RSVVTKYEPP----IIV 442

Query: 424 FVPTRHHVEYVTQLLKN-CGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           F+  +   +++ +  +N     V+ ++G+ +Q  R+  L  FR+G   I+V T+VAARG+
Sbjct: 443 FINYKQTADWLAEKFQNETNMKVTILHGSKSQEQREHSLKLFRSGKVQIMVATNVAARGL 502

Query: 483 DIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           DIP ++ V+N+ +P     +IHR+GRT RA   G A S V
Sbjct: 503 DIPNVSLVVNFQIPKKIDDYIHRIGRTGRAAKEGTAISYV 542

>Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON}
           YDR243C (REAL)
          Length = 587

 Score =  175 bits (444), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 127/411 (30%), Positives = 204/411 (49%), Gaps = 75/411 (18%)

Query: 136 LVLINISKKGFRQPTPIQRKTIPLIL---QKRDIVGMARTGSGKTAAFVLPMIEKL---- 188
           L+ I   K  F  PTPIQR TIP +    Q RD +G+A TGSGKT AF++P++ ++    
Sbjct: 183 LLCIIKQKLQFFSPTPIQRITIPNVCNAKQHRDFLGVASTGSGKTLAFIIPILIRMSRSP 242

Query: 189 -KTHSAKI--GVRAVILSPSRELAIQ----THRVFKEFSKGS--DLRSILLTGGDSLEDQ 239
            +  S KI  G +A+IL+P+REL  Q    T +V K +S+ +  D R I + GG S E+ 
Sbjct: 243 PRPSSLKIMDGPKALILAPTRELVQQIQAETEKVTKIWSRENNYDCRVISIVGGHSFEEI 302

Query: 240 FGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL---- 295
              +    D+++ATPGR +       L +K VE +V DEAD++ ++GF++Q+  +L    
Sbjct: 303 SFSLSEGCDILVATPGRLIDSLDNHLLVMKQVETLVLDEADKMIDLGFEDQVTNILTKVD 362

Query: 296 --VAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDER 353
             V   TNRQTL+F+AT+   +   A   +  PV   +  +T  SE              
Sbjct: 363 VNVDSATNRQTLMFTATMTPVIEKIAAGYMRKPVYATIGLDTG-SEP------------- 408

Query: 354 EANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNAN 413
                 L+++ ++     E + KKLK                                + 
Sbjct: 409 ------LIRQVVEYADNEEEKFKKLK--------------------------------SV 430

Query: 414 EMPSEKATIVFVPTRHHVEYVTQLLKN-CGYLVSYIYGALNQHARKQQLYNFRAGLTSIL 472
            +  E   I+F+  +   +++ +  +      V+ ++G+ +Q  R+  L  FR G   I+
Sbjct: 431 VIKYESPIIIFINYKQTADWLAERFQTETNMKVTILHGSKSQEQREHSLQLFRTGKVQIM 490

Query: 473 VVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           + T+VAARG+DIP ++ V+N+ +      ++HR+GRT RA   G AFS VS
Sbjct: 491 IATNVAARGLDIPNVSLVVNFQISKKIDDYVHRIGRTGRAQREGTAFSFVS 541

>Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {ON}
           YDR243C (PRP28) - RNA helicase [contig 27] FULL
          Length = 571

 Score =  174 bits (441), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 122/428 (28%), Positives = 215/428 (50%), Gaps = 71/428 (16%)

Query: 111 DYFNTTADAAAKHKKGSFASFGLSKLVLINI--SKKGFRQPTPIQRKTIPLILQKRDIVG 168
           D+   T   + +H    ++  GL    L+ I  SK  +R+PTPIQR TIP +L+ RD VG
Sbjct: 152 DFHIETKGGSIQHPLRDWSETGLIAPGLVEIISSKLKYREPTPIQRITIPNVLRGRDFVG 211

Query: 169 MARTGSGKTAAFVLPMIEKLK-----THSAKI-GVRAVILSPSRELAIQTH----RVFKE 218
           +A TGSGKT AF+LP + +L          K+ G   +IL+P+RELA Q      +V   
Sbjct: 212 IAATGSGKTLAFLLPSLCQLSKLPPLNDITKLDGPFTLILAPTRELAQQIEAEAKKVVNL 271

Query: 219 FSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDE 278
           +S+ + + SI+  GG S+E+    +    D+++ATPGR +       L LK V  +V DE
Sbjct: 272 WSRPTKVTSIV--GGHSIEEISYSLSDGCDILVATPGRLIDCLENRMLVLKQVRILVLDE 329

Query: 279 ADRLFEMGFQEQLNELLVAFPT--NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETK 336
           ADR+ + GF++QL  +L    +   RQT++F+AT+ +++   A   L+ P          
Sbjct: 330 ADRMIDFGFEDQLTTILARTESVSGRQTMMFTATMSNTVEKIANGYLTKPA--------- 380

Query: 337 ISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXX 396
                   ++ +  D+ +A +    ++ ++   + E + +K+ +                
Sbjct: 381 --------YVRVGSDDTKAQI----KQIVEYLPSEEQRFQKMAR---------------- 412

Query: 397 XXXXXXXXXXRRLPNANEMPSEKATI-VFVPTRHHVEY-VTQLLKNCGYLVSYIYGALNQ 454
                           + +P  +A I +F+  +   ++ V++      + V+ ++G+ +Q
Sbjct: 413 ----------------DILPKFRAPIMIFINYKKTADWLVSKFSSETRFKVTTLHGSKSQ 456

Query: 455 HARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGN 514
             R+  L   R G   I++ TDVA RG+DIP ++ V+N+ +  + + ++HR+GRT RAG 
Sbjct: 457 EQREHSLNMLRTGKVDIMIATDVAGRGIDIPDVSLVVNFQMCTAFESYVHRIGRTGRAGR 516

Query: 515 RGWAFSIV 522
            G A + +
Sbjct: 517 SGCALTFL 524

>TPHA0M00900 Chr13 (175733..176935) [1203 bp, 400 aa] {ON} Anc_3.249
           YDR021W
          Length = 400

 Score =  170 bits (430), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/404 (25%), Positives = 202/404 (50%), Gaps = 62/404 (15%)

Query: 126 GSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI 185
            +F +  L   +L  +   GF  P+ IQ + I  I+   D++  A++G+GKTA F + M+
Sbjct: 24  ATFEAMDLKDDLLKGVYLYGFEAPSAIQSRAITQIISGTDVIAQAQSGTGKTATFTIGML 83

Query: 186 EKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM-M 244
           + +      +  +A+ILSP+RELA Q ++V        +++S  +TGG +++D    M  
Sbjct: 84  QVIDLKRKDL--QALILSPTRELATQINQVVTNLGDYMNVQSYAMTGGKTMKDDLKKMNK 141

Query: 245 GNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF--EMGFQEQLNELLVAFPTNR 302
               VV  TPGR L +     +  ++V+ ++ DEAD L    +GF++Q+ E+    P+  
Sbjct: 142 SGCQVVSGTPGRVLDMIKRQLISTRNVQMLILDEADELLGEHLGFKQQIYEIFAKLPSAC 201

Query: 303 QTLLFSATLPSSLVDFAKAGLSNP--VLVRLDAETKIS-ENLEMLFISIKKDEREANLLY 359
           Q ++ SAT+   +++  K  +S+P  +LV+ D   +IS E ++  ++++ K++ + + L 
Sbjct: 202 QVVVVSATMSKDIIEVTKKFMSDPTKILVKRD---EISLEGIKQFYVNVSKEDWKFDTLC 258

Query: 360 LLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEK 419
            L +++ +                                                    
Sbjct: 259 DLYDSLTIT--------------------------------------------------- 267

Query: 420 ATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAA 479
             ++F  T+  V++++Q L    + V  ++G + Q  R + + +FR G + +L+ TDV A
Sbjct: 268 QCVIFCNTKKKVDWLSQKLTRSNFSVIAMHGDMKQEDRDKVMNDFRTGTSRVLISTDVWA 327

Query: 480 RGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           RG+D+  ++ VINY LP + + +IHR+GR+ R G +G + + V+
Sbjct: 328 RGIDVQQVSLVINYDLPENMENYIHRIGRSGRFGRKGVSINFVT 371

>KAFR0E01160 Chr5 (232985..234202) [1218 bp, 405 aa] {ON} Anc_3.249
           YDR021W
          Length = 405

 Score =  169 bits (429), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 111/427 (25%), Positives = 207/427 (48%), Gaps = 69/427 (16%)

Query: 113 FNTTADAAAKHK-------KGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRD 165
           FN  +D   K K         SF S  L+ L+L  I   GF  P+ IQ + I  I+  RD
Sbjct: 3   FNRESDQKLKFKTSQKLKVSASFESMQLNPLLLQGIYSNGFEAPSAIQSRAITQIISGRD 62

Query: 166 IVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDL 225
           ++  A++G+GKTA F + M++     S+++  + +ILSP+RELA Q ++V        ++
Sbjct: 63  VIAQAQSGTGKTATFTIGMLQVCNFKSSEL--QCLILSPTRELASQINQVVCNIGDYLNV 120

Query: 226 RSILLTGGDSL------EDQFGMMMGN-PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDE 278
           +S+ + GG +       ++   ++  N   +V  TPGR L L     ++ K V+ +V DE
Sbjct: 121 KSMAVVGGKTSASSSKNKNDLNLLRNNKCHIVSGTPGRVLDLIKRQVINTKKVKILVLDE 180

Query: 279 ADRLF--EMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETK 336
           AD L    +GF++Q+ ++    P   Q ++ SAT+   +++  K  L++PV + +  +  
Sbjct: 181 ADELLAESLGFKQQIYDIFTKLPKTCQVVVVSATMNKDIIEVTKKFLNDPVKILVKQDQI 240

Query: 337 ISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXX 396
             E ++   +++ K+E + + L  L +++ +                             
Sbjct: 241 SLEGIKQYHVNVDKEEWKFDTLCDLYDSLTI----------------------------- 271

Query: 397 XXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHA 456
                                    ++F  T+  V++++  L    + V  ++G + Q  
Sbjct: 272 ----------------------NQCVIFCNTKKKVDWLSSKLLQANFSVVSMHGDMKQEE 309

Query: 457 RKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRG 516
           R + + +FR+G + +L+ TDV ARG+D+  ++ VINY LP + + +IHR+GR+ R G +G
Sbjct: 310 RDKIMNDFRSGHSRVLISTDVWARGIDVQQVSLVINYDLPENMENYIHRIGRSGRFGRKG 369

Query: 517 WAFSIVS 523
            A + V+
Sbjct: 370 VAINFVT 376

>NCAS0B02570 Chr2 (429423..431195) [1773 bp, 590 aa] {ON} Anc_8.469
          Length = 590

 Score =  174 bits (440), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 117/396 (29%), Positives = 194/396 (48%), Gaps = 66/396 (16%)

Query: 146 FRQPTPIQRKTIPLILQ-KRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKI-------GV 197
           F  PTP+QR TIP I++  RD VG+A TGSGKT AFVLPM+ +L T+           G 
Sbjct: 195 FDFPTPVQRITIPNIVKGNRDFVGVASTGSGKTLAFVLPMLTQLLTNGVPPIALKKMNGP 254

Query: 198 RAVILSPSRELA----IQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIAT 253
             ++L P+RELA    ++  +V     +   ++   + GG SLE+    +    D++IAT
Sbjct: 255 IGLVLVPTRELAQQIQLEAEKVVNLIREEYPIKIESIVGGHSLEEISSNLNEGCDILIAT 314

Query: 254 PGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNR-------QTLL 306
           PG+ +       L + ++ Y+V DEAD++ ++GF++QL  +L     N        +TL+
Sbjct: 315 PGKLIECLENHLLVISNLSYLVLDEADKMIDLGFEDQLKTILNNLEVNNSNVSSLYRTLM 374

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIK 366
           F+ATL S L   A   L NP+   + AE                    A+ +  +Q+ ++
Sbjct: 375 FTATLSSPLEKIASGYLRNPIYASIKAEG-------------------ADAMPQIQQVVQ 415

Query: 367 MPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVP 426
                + + K ++                             L   N M + +  I+F+ 
Sbjct: 416 YCPTDDQKFKAIES---------------------------ILREKNTMDNPRV-IIFIN 447

Query: 427 TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPL 486
            +   +++     +  Y V+ ++G+ +Q  R+  +   R+G   IL+ T+VAARG+DIP 
Sbjct: 448 YKATADWLANKFASTKYKVTILHGSKSQEQREHSIQLLRSGKIQILIATNVAARGLDIPN 507

Query: 487 LANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           +A VIN+  P     ++HR+GRT RAGN G A +++
Sbjct: 508 VALVINFHFPKDFADYVHRIGRTGRAGNLGTAVTLI 543

>Kpol_1036.3 s1036 complement(10496..11695) [1200 bp, 399 aa] {ON}
           complement(10496..11695) [1200 nt, 400 aa]
          Length = 399

 Score =  169 bits (428), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 101/400 (25%), Positives = 199/400 (49%), Gaps = 56/400 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F S  L   +L  I   GF  P+ IQ + I  I+   D++  A++G+GKTA F + M++
Sbjct: 24  TFESMNLKDDLLRGIYGYGFEAPSAIQSRAITQIISGTDVIAQAQSGTGKTATFTIGMLQ 83

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
            +      +  +A++LSP+RELA Q ++V        +++S  +TGG +++D    M  N
Sbjct: 84  AIDLKRKDL--QALVLSPTRELASQINQVVSNLGDYMNVQSYAMTGGKTMKDDLNRMQKN 141

Query: 247 -PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF--EMGFQEQLNELLVAFPTNRQ 303
              VV  TPGR L +     L+ ++V+ ++ DEAD L    +GF++Q+ ++    P   Q
Sbjct: 142 GCQVVSGTPGRVLDMFKRHLLNTRNVQMLILDEADELLGESLGFKQQIYDIFTKLPAACQ 201

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQE 363
            ++ SAT+   +++  K  +S+PV + +  +    E ++  +++++K++ + + L  L +
Sbjct: 202 VVVVSATMSKDILEVTKKFMSDPVKILVKRDEISLEGIKQYYVNVEKEDWKFDTLCDLYD 261

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
           ++ +                                                      ++
Sbjct: 262 SLTIT---------------------------------------------------QCVI 270

Query: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483
           F  T+  V++++  L    + V  ++G + Q  R + + +FR+G + +L+ TDV ARG+D
Sbjct: 271 FCNTKKKVDWLSAKLTQSNFAVVSMHGDMKQEDRNKVMSDFRSGHSRVLISTDVWARGID 330

Query: 484 IPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +  ++ VINY +P   + +IHR+GR+ R G +G A + ++
Sbjct: 331 VQQVSLVINYDIPEIMENYIHRIGRSGRFGRKGVAINFIT 370

>YDR021W Chr4 (486804..488003) [1200 bp, 399 aa] {ON}  FAL1Nucleolar
           protein required for maturation of 18S rRNA, member of
           the eIF4A subfamily of DEAD-box ATP-dependent RNA
           helicases
          Length = 399

 Score =  169 bits (428), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 103/400 (25%), Positives = 198/400 (49%), Gaps = 56/400 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F S  L   +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + +++
Sbjct: 24  TFESMNLKDDLLRGIYSYGFEAPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGLLQ 83

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
            +     K  ++A+ILSP+RELA Q  +V K      ++ +  +TGG +L+D    M  +
Sbjct: 84  AIDLR--KKDLQALILSPTRELASQIGQVVKNLGDYMNVNAFAITGGKTLKDDLKKMQKH 141

Query: 247 -PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFE--MGFQEQLNELLVAFPTNRQ 303
               V  TPGR L +  +  L  ++V+ +V DEAD L    +GF++Q+ ++    P N Q
Sbjct: 142 GCQAVSGTPGRVLDMIKKQMLQTRNVQMLVLDEADELLSETLGFKQQIYDIFAKLPKNCQ 201

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQE 363
            ++ SAT+   +++  +  +++PV + +  +    E ++   +++ K+E + + L  + +
Sbjct: 202 VVVVSATMNKDILEVTRKFMNDPVKILVKRDEISLEGIKQYVVNVDKEEWKFDTLCDIYD 261

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
           ++ +                                                      ++
Sbjct: 262 SLTIT---------------------------------------------------QCVI 270

Query: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483
           F  T+  V++++Q L    + V  ++G + Q  R + + +FR G + +L+ TDV ARG+D
Sbjct: 271 FCNTKKKVDWLSQRLIQSNFAVVSMHGDMKQEERDKVMNDFRTGHSRVLISTDVWARGID 330

Query: 484 IPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +  ++ VINY LP   + +IHR+GR+ R G +G A + ++
Sbjct: 331 VQQVSLVINYDLPEIIENYIHRIGRSGRFGRKGVAINFIT 370

>TBLA0I01860 Chr9 (418583..419746) [1164 bp, 387 aa] {ON} Anc_3.249
           YDR021W
          Length = 387

 Score =  169 bits (427), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 106/421 (25%), Positives = 206/421 (48%), Gaps = 63/421 (14%)

Query: 113 FNTTADAAAKHK-------KGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRD 165
           FN  +D   K K         SF S  L   +L  I   GF  P+ IQ + I  I+  +D
Sbjct: 3   FNRESDKQLKFKTSKKLKISSSFESMKLKDDLLRGIYSYGFEAPSAIQSRAITQIISGKD 62

Query: 166 IVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDL 225
           ++  A++G+GKTA F + M++ +   +  +  +A+ILSP+RELA Q H+V        ++
Sbjct: 63  VIAQAQSGTGKTATFTIGMLQAIDLKNKDL--QALILSPTRELASQIHQVVSNLGDYMNV 120

Query: 226 RSILLTGGDSLEDQFGMMMGN-PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFE 284
           +S  +TGG +++D    +  N   VV  TPGR L +     L  ++++ ++ DEAD L  
Sbjct: 121 QSFAITGGKTMKDDIKKIQRNGCQVVSGTPGRVLDMFKRQMLKSRNIKMLILDEADELLS 180

Query: 285 --MGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLE 342
             +GF++Q+ ++    P + Q ++ SAT+   +++  K  +++PV + +  +    E ++
Sbjct: 181 ETLGFKQQIYDIFTKLPPSCQVVVVSATMNKDILEITKKFMNDPVKILVKRDEISLEGIK 240

Query: 343 MLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXX 402
             +++++++E + + L  L +++ +                                   
Sbjct: 241 QYYVNVEREEWKFDTLCDLYDSLTIT---------------------------------- 266

Query: 403 XXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLY 462
                              ++F  ++  V++++Q L    + +  ++G + Q  R + + 
Sbjct: 267 -----------------QCVIFCNSKKKVDWLSQKLIQNNFAIVSMHGDMEQDERDRVMN 309

Query: 463 NFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
            FR G + +LV TDV ARG+D+  ++ VINY L  + + +IHR+GR+ R G +G A + +
Sbjct: 310 EFRTGQSRVLVSTDVWARGIDVQQVSLVINYDLCENLENYIHRIGRSGRFGRKGIAINFI 369

Query: 523 S 523
           +
Sbjct: 370 T 370

>ZYRO0A03476g Chr1 complement(277585..278784) [1200 bp, 399 aa] {ON}
           highly similar to uniprot|Q12099 Saccharomyces
           cerevisiae YDR021W FAL1 Nucleolar protein required for
           maturation of 18S rRNA member of the eIF4A subfamily of
           DEAD-box ATP-dependent RNA helicases
          Length = 399

 Score =  169 bits (427), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 108/421 (25%), Positives = 203/421 (48%), Gaps = 63/421 (14%)

Query: 113 FNTTADAAAKHKKG-------SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRD 165
           FN   D+  K K         +F +  L   +L  I   GF  P+ IQ + I  I+  +D
Sbjct: 3   FNREDDSRLKFKTSKKLRVSPTFEAMNLKDDLLRGIYSYGFEAPSSIQSRAITQIISGKD 62

Query: 166 IVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDL 225
           ++  A++G+GKTA F + M++ L+     +  +A++LSP+RELA Q+ +V        ++
Sbjct: 63  VIAQAQSGTGKTATFTIGMLQVLELKRKDL--QALVLSPTRELASQSCQVVSNLGDYLNV 120

Query: 226 RSILLTGGDSLEDQFGMMMGN-PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFE 284
           ++  LTGG +L+D    +  +   VV  TPGR L L     +  ++V+ +V DEAD L  
Sbjct: 121 KAFALTGGKALKDDLKRIQSSGCHVVSGTPGRVLDLIKRQVVQTRNVQVLVLDEADELLS 180

Query: 285 --MGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLE 342
             +GF++Q+ ++    P   Q ++ SAT+   +++  K  +S+PV + +  +    E + 
Sbjct: 181 ETLGFKQQIYDIFARLPPGCQVVVVSATMSRDILEVTKKFMSDPVKILVKRDEISLEGIS 240

Query: 343 MLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXX 402
             ++ + K+E + + L  L +++ +                                   
Sbjct: 241 QYYVDVSKEEWKFDTLCDLYDSLTIT---------------------------------- 266

Query: 403 XXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLY 462
                              ++F  TR  V+++++ L    + V  ++G + Q  R + + 
Sbjct: 267 -----------------QCVIFCNTRKKVDWLSKKLIQSNFAVVSMHGDMKQEDRDKVMN 309

Query: 463 NFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           +FR G + +L+ TDV ARG+D+  ++ VINY +P   + +IHR+GR+ R G +G A + +
Sbjct: 310 DFRTGHSRVLISTDVWARGIDVQQISLVINYDMPEIMENYIHRIGRSGRFGRKGVAVNFI 369

Query: 523 S 523
           +
Sbjct: 370 T 370

>Ecym_4755 Chr4 complement(1469426..1470622) [1197 bp, 398 aa] {ON}
           similar to Ashbya gossypii AER408W
          Length = 398

 Score =  168 bits (426), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 102/400 (25%), Positives = 198/400 (49%), Gaps = 55/400 (13%)

Query: 126 GSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI 185
            SF +  L   +L  I   GF  P+ IQ + I  I++ +D++  A++G+GKTA F + M+
Sbjct: 23  ASFEAMKLQDNLLRGIYSYGFEAPSAIQSRAITQIIKGKDVIAQAQSGTGKTATFTIAML 82

Query: 186 EKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMG 245
           + +   S     +A++LSP+RELA+Q  +V        ++ +   TGG +L+        
Sbjct: 83  QIIDMKSKD--CQALVLSPTRELAVQISQVVTNLGGYMNVVAHACTGGKALQQDINKFNK 140

Query: 246 NPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF--EMGFQEQLNELLVAFPTNRQ 303
              VV  TPGR L       L+ + ++ +V DEAD L    +GF++Q+ ++    PT+ Q
Sbjct: 141 GCHVVSGTPGRVLDTIKRRALNTRHIKMLVLDEADELLSDSLGFKQQIYDIFTKLPTSVQ 200

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQE 363
            +L SAT+   +++  K  +++PV + +  +    + ++   ++++K+E + + L  L +
Sbjct: 201 VVLISATISKDVLEVVKKLMTDPVKLLVKRDQISLDVIKQYHVNVEKEEWKFDTLCDLYD 260

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
           ++ +                                                      ++
Sbjct: 261 SLTI---------------------------------------------------NQCVI 269

Query: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483
           F  T+  V+++++ L    + VS I+G + Q  R++ + +FR+G + +L+ TDV ARG+D
Sbjct: 270 FCNTKKKVDWLSRKLLQTNFAVSSIHGDMQQDEREKVMNDFRSGSSRLLISTDVWARGID 329

Query: 484 IPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +  ++ VINY +P   + +IHR+GR+ R G +G A + ++
Sbjct: 330 VQQISLVINYDIPELLENYIHRIGRSGRFGRKGIAINFIT 369

>Skud_4.273 Chr4 (477488..478687) [1200 bp, 399 aa] {ON} YDR021W
           (REAL)
          Length = 399

 Score =  168 bits (425), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 101/400 (25%), Positives = 198/400 (49%), Gaps = 56/400 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F S  L   +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + +++
Sbjct: 24  TFESMNLKDDLLRGIYSYGFEAPSSIQSRAITQIISGKDVIAQAQSGTGKTATFTIGLLQ 83

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
            +     ++ ++A+ILSP+RELA Q  +V        ++ +  +TGG +L+D    +  N
Sbjct: 84  AIDLK--RMDLQALILSPTRELASQIGQVVTNLGDYMNVNAFAMTGGKTLKDDLKKIQKN 141

Query: 247 PDVVIA-TPGRFLHLKVEMNLDLKSVEYVVFDEADRLFE--MGFQEQLNELLVAFPTNRQ 303
              VI+ TPGR L +     L  ++V  ++ DEAD L    +GF++Q+ ++    P N Q
Sbjct: 142 GCQVISGTPGRVLDMIKRQMLQTRNVRMLILDEADELLSETLGFKQQIYDIFTKLPKNCQ 201

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQE 363
            ++ SAT+   +++  +  L++PV + +  +    E ++   +++ K++ + + L  + +
Sbjct: 202 VVVVSATMNKDILEVTRKFLNDPVKILVKRDEISLEGIKQYIVNVDKEDWKFDTLCDIYD 261

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
           ++ +                                                      ++
Sbjct: 262 SLTIT---------------------------------------------------QCVI 270

Query: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483
           F  T+  V++++Q L    + V  ++G + Q  R + + +FR G + +L+ TDV ARG+D
Sbjct: 271 FCNTKKKVDWLSQRLTQSNFAVVSMHGDMKQEERDKVMNDFRTGHSRVLISTDVWARGID 330

Query: 484 IPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +  ++ VINY LP   + +IHR+GR+ R G +G A + ++
Sbjct: 331 VQQVSLVINYDLPEIIENYIHRIGRSGRFGRKGVAINFIT 370

>TDEL0D03760 Chr4 complement(689455..690651) [1197 bp, 398 aa] {ON}
           Anc_3.249 YDR021W
          Length = 398

 Score =  168 bits (425), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 100/400 (25%), Positives = 197/400 (49%), Gaps = 56/400 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F +  L   +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + +++
Sbjct: 24  TFEAMKLKDDLLRGIYSYGFEAPSAIQSRAITQIISGKDVIAQAQSGTGKTATFTIGILQ 83

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
            ++     +  +A++LSP+RELA Q  +V        ++++  +TGG +L+D    + G+
Sbjct: 84  AIELKRKDL--QALVLSPTRELATQISQVVSNLGDYMNVKTYAITGGKTLKDDIKKIQGS 141

Query: 247 -PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFE--MGFQEQLNELLVAFPTNRQ 303
              +V  TPGR L +     L  +SV+ ++ DEAD L    +GF+ Q+ ++    P   Q
Sbjct: 142 GCHIVSGTPGRVLDMIKRQILKTRSVQMLILDEADELLSERLGFKNQIYDIFTKLPPACQ 201

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQE 363
            ++ SAT+   +++  K  +S+PV + +  +    E ++   +++ K++ + + L  L +
Sbjct: 202 VVVVSATMNKDILEITKKFMSDPVKILVKKDEISLEGIKQYMVNVDKEDWKFDTLCDLYD 261

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
           ++ +                                                      ++
Sbjct: 262 SLTIT---------------------------------------------------QCVI 270

Query: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483
           F  T+  V+++ Q +    + VS ++G + Q  R + + +FR G + +L+ TDV ARG+D
Sbjct: 271 FCNTKKKVDWLAQKMSQSNFAVSSMHGDMKQEDRDRVMNDFRTGHSRVLISTDVWARGID 330

Query: 484 IPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +  ++ VINY +P   + +IHR+GR+ R G +G A + V+
Sbjct: 331 VQQISLVINYDIPEILENYIHRIGRSGRFGRKGVAINFVT 370

>Suva_2.171 Chr2 (297542..298741) [1200 bp, 399 aa] {ON} YDR021W
           (REAL)
          Length = 399

 Score =  168 bits (425), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 106/421 (25%), Positives = 203/421 (48%), Gaps = 63/421 (14%)

Query: 113 FNTTADAAAKHKKG-------SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRD 165
           FN   D   K K         +F S  L + +L  I   GF  P+ IQ + I  I+  +D
Sbjct: 3   FNREEDQKLKFKTSKKLKVTSTFESMDLKEDLLRGIYSYGFEAPSSIQSRAITQIISGKD 62

Query: 166 IVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDL 225
           ++  A++G+GKTA F + +++ +     K  ++A+ILSP+RELA Q  +V        ++
Sbjct: 63  VIAQAQSGTGKTATFTIGLLQAIDLK--KKDLQALILSPTRELANQIGQVVTNLGDYMNV 120

Query: 226 RSILLTGGDSLEDQFGMMMGN-PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFE 284
            +  +TGG +L+D    +  N   VV  TPGR L +     L  ++V+ ++ DEAD L  
Sbjct: 121 NAFAMTGGKTLKDDLKKLQKNGCQVVSGTPGRVLDMIKRQMLQTRNVQVLILDEADELLS 180

Query: 285 --MGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLE 342
             +GF++Q+ ++    P N Q ++ SAT+   +++  +  +++PV + +  +    E ++
Sbjct: 181 ETLGFKQQIYDIFAKLPKNCQVVVVSATMNKDILEVTRKFMNDPVKILVKRDEISLEGIK 240

Query: 343 MLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXX 402
              +++ K++ + + L  + +++ +                                   
Sbjct: 241 QYVVNVDKEDWKFDTLCDIYDSLTIT---------------------------------- 266

Query: 403 XXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLY 462
                              ++F  T+  V++++Q L    + V  ++G + Q  R + + 
Sbjct: 267 -----------------QCVIFCNTKKKVDWLSQRLTQSNFAVVSMHGDMKQEERDKVMN 309

Query: 463 NFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           +FR G + +L+ TDV ARG+D+  ++ VINY LP   + +IHR+GR+ R G +G A + +
Sbjct: 310 DFRTGHSRVLISTDVWARGIDVQQVSLVINYDLPEIIENYIHRIGRSGRFGRKGVAINFI 369

Query: 523 S 523
           +
Sbjct: 370 T 370

>Smik_4.255 Chr4 (467483..468682) [1200 bp, 399 aa] {ON} YDR021W
           (REAL)
          Length = 399

 Score =  167 bits (423), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 107/421 (25%), Positives = 204/421 (48%), Gaps = 59/421 (14%)

Query: 106 DDDLNDYFNTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRD 165
           D+DL   F T+          +F S  L   +L  I   GF  P+ IQ + I  I+  +D
Sbjct: 6   DEDLKLKFKTSKKLKVSP---TFESMNLKDDLLRGIYSYGFDAPSSIQSRAITQIISGKD 62

Query: 166 IVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDL 225
           ++  A++G+GKTA F + +++ +     K  ++A+ILSP+RELA Q  +V K      ++
Sbjct: 63  VIAQAQSGTGKTATFTIGLLQAIDLR--KRDLQALILSPTRELASQIGQVVKNLGDYMNV 120

Query: 226 RSILLTGGDSLEDQFGMMMGN-PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFE 284
            +  +TGG +L+D    +  +   VV  TPGR L +     L  ++V+ +V DEAD L  
Sbjct: 121 NAFAMTGGKTLKDDLKKVQKHGCQVVSGTPGRVLDMIKRQMLQTRNVQMLVLDEADELLS 180

Query: 285 --MGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLE 342
             +GF++Q+ ++    P N Q ++ SAT+   +++  +  +++PV + +  +    E ++
Sbjct: 181 ETLGFKQQIYDIFAKLPKNCQVVVVSATMNKDILEVTRKFMNDPVKILVKRDEISLEGIK 240

Query: 343 MLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXX 402
              +++ K++ + + L  + +++ +                                   
Sbjct: 241 QYVVNVDKEDWKFDTLCDIYDSLTIT---------------------------------- 266

Query: 403 XXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLY 462
                              ++F  T+  V++++Q L    + V  ++G + Q  R + + 
Sbjct: 267 -----------------QCVIFCNTKKKVDWLSQRLSQSNFAVVSMHGDMKQEERDKVMN 309

Query: 463 NFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
            FR G + +L+ TDV ARG+D+  ++ VINY LP   + +IHR+GR+ R G +G A + +
Sbjct: 310 EFRTGHSRVLISTDVWARGIDVQQVSLVINYDLPEIIENYIHRIGRSGRFGRKGVAINFI 369

Query: 523 S 523
           +
Sbjct: 370 T 370

>CAGL0M06567g Chr13 complement(679126..680325) [1200 bp, 399 aa]
           {ON} highly similar to uniprot|Q12099 Saccharomyces
           cerevisiae YDR021w FAL1 involved in maturation of 18S
           rRNA
          Length = 399

 Score =  166 bits (420), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 100/403 (24%), Positives = 200/403 (49%), Gaps = 60/403 (14%)

Query: 126 GSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMI 185
            +F S  L + +L  I   GF  P+ IQ + I  I+  +D++  A++G+GKTA F + M+
Sbjct: 23  ATFESMDLKEGLLRGIYSYGFEAPSAIQSRAITQIISGKDVIAQAQSGTGKTATFTIGML 82

Query: 186 EK--LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
           +   LK H     ++A++LSP+RELA Q  +V        ++++  +TGG +++D    +
Sbjct: 83  QAIDLKKHD----LQALVLSPTRELAAQIGKVVTNLGDYMNVKAYAMTGGKTMKDDLKKI 138

Query: 244 MGNPDVVIA-TPGRFLHLKVEMNLDLKSVEYVVFDEADRLFE--MGFQEQLNELLVAFPT 300
             +   VI+ TPGR L +     ++ + V+ +V DEAD L    +GF+ Q+ ++    P 
Sbjct: 139 QKHGCQVISGTPGRVLDMIKRRLIETRHVQILVLDEADELLSDTLGFKHQIYDIFTKLPR 198

Query: 301 NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYL 360
             Q ++ SAT+   +++  K  +++PV + +  +    E ++  +++++K+E + + L  
Sbjct: 199 TSQVVVVSATMSPEILEITKKFMNDPVKILVKRDEITLEGIKQYYVNVEKEEWKFDTLCD 258

Query: 361 LQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKA 420
           + +++ +                                                     
Sbjct: 259 IYDSLTIT---------------------------------------------------Q 267

Query: 421 TIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAAR 480
            ++F  ++  V+++   LK   + V  ++G + Q  R + +  FR G + +L+ TDV AR
Sbjct: 268 CVIFCNSKKKVDWLAHKLKQSNFAVISMHGDMKQDERDRVMNEFRTGQSRVLISTDVWAR 327

Query: 481 GVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           G+D+  ++ VINY LP  ++ ++HR+GR+ R G +G A + ++
Sbjct: 328 GIDVQQVSLVINYDLPEITENYVHRIGRSGRFGRKGVAINFLT 370

>CAGL0K11198g Chr11 complement(1087381..1089129) [1749 bp, 582 aa]
           {ON} similar to uniprot|P23394 Saccharomyces cerevisiae
           YDR243c PRP28
          Length = 582

 Score =  170 bits (430), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 125/439 (28%), Positives = 214/439 (48%), Gaps = 76/439 (17%)

Query: 109 LNDYFNTTADA--AAKHKKGSFASFGL--SKLVLINISKKGFRQPTPIQRKTIPLILQK- 163
           + + FN T+    A KH   +++   +  + LV       GF +PT IQR TIP  +   
Sbjct: 150 MREEFNITSKGKGAVKHPLRNWSETNVIPTDLVRALTEGMGFDEPTAIQRITIPNAISSN 209

Query: 164 ----RDIVGMARTGSGKTAAFVLPMIEKLKTHSAKI-------GVRAVILSPSRELAIQT 212
               RDI+G+A TGSGKT AF +P++ +L    A+        G  A++L P+RELA Q 
Sbjct: 210 KSVPRDILGIASTGSGKTLAFSIPILARLDALPARPVNLKTLDGPLALVLVPTRELAQQI 269

Query: 213 ----HRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDL 268
               +R+   +    +L ++ + GG S+ D    +    D++IATPGR L +     + L
Sbjct: 270 SQEINRLLSAWENKKNLNAVSIVGGHSMSDISHTLRNGCDILIATPGRLLDVLDNHLVVL 329

Query: 269 KSVEYVVFDEADRLFEMGFQEQLNELLVAFPTN----RQTLLFSATLPSSLVDFAKAGLS 324
             ++ +V DEADR+ ++GF++Q+  +L     +    RQT+LF+ATL SS+   AK  L 
Sbjct: 330 NKIQSLVLDEADRMIDLGFEDQMKSILSHLMADELAARQTMLFTATLSSSVESIAKGYLK 389

Query: 325 NPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXX 384
           NP+ V + +     + L    +    D+ +  L +L  + IK                  
Sbjct: 390 NPLHVSVGSRWDSDKPLITQVVRHTGDD-DKKLSFLKDDLIK------------------ 430

Query: 385 XXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYL 444
                                       N +P+    I+F+  +   +++T  L +   +
Sbjct: 431 ----------------------------NGLPA----IIFINYKETADWLTLRLSDRFNI 458

Query: 445 VSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIH 504
           V+ ++G+ +Q  R+  +   ++G  ++L+ T+VAARG+DIP +A V+N+ +      +IH
Sbjct: 459 VT-LHGSKSQSQRESAIQKLKSGTANVLIATNVAARGLDIPDVALVVNFQMSKKFDDYIH 517

Query: 505 RVGRTARAGNRGWAFSIVS 523
           R+GRT RAG  G A + ++
Sbjct: 518 RIGRTGRAGKTGIAVTYLT 536

>NDAI0A05860 Chr1 complement(1331381..1332580) [1200 bp, 399 aa]
           {ON} Anc_3.249
          Length = 399

 Score =  165 bits (417), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 99/400 (24%), Positives = 202/400 (50%), Gaps = 56/400 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F S  L   +L  I   GF  P+ IQ + I  I+   D++  A++G+GKTA F + M++
Sbjct: 24  TFESMSLKPNLLKGIYSYGFESPSSIQSRAITRIIAGNDVIAQAQSGTGKTATFTIGMLQ 83

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
            +   S K  ++ +ILSP+RELA+Q ++V        +++S+ + GG  +++    +  N
Sbjct: 84  II--DSDKKQLQGLILSPTRELAVQINQVVGNLGDYMNVKSMAMIGGKMMKEDLKKINKN 141

Query: 247 PDVVIA-TPGRFLHLKVEMNLDLKSVEYVVFDEADRLFE--MGFQEQLNELLVAFPTNRQ 303
              VI+ TPGR L +     L++++++ +V DEAD L    +GF++Q+ ++    P + Q
Sbjct: 142 SCHVISGTPGRILDMIKRQLLNVRNIQILVLDEADELLSEILGFKQQIYDIFAKLPKSCQ 201

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQE 363
            ++ SAT+  ++++  K  +++PV + +  +    E ++   +++ K++ + + L  + +
Sbjct: 202 VVVVSATMDKNILEITKKFMNDPVKILVKQDEISLEGIKQYIVNVDKEDWKFDTLCDIYD 261

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
           ++ +                                                      ++
Sbjct: 262 SLTIT---------------------------------------------------QCVI 270

Query: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483
           F  T+  V++++  L    + V  ++G + Q  R + + +FR G + +L+ TDV ARG+D
Sbjct: 271 FCNTKKKVDWLSAKLAQANFAVVSMHGDMKQEDRDKVMNDFRTGHSRVLISTDVWARGID 330

Query: 484 IPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +  ++ VINY LP + + +IHR+GR+ R G +G A + ++
Sbjct: 331 VQQVSLVINYDLPENMENYIHRIGRSGRFGRKGVAINFIT 370

>Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {ON}
           YBR237W (PRP5) - RNA helicase homolog [contig 61] FULL
          Length = 425

 Score =  165 bits (418), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 108/362 (29%), Positives = 177/362 (48%), Gaps = 53/362 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF   G  + VL  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 113 SFDEAGFPEYVLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 172

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      S   G   ++LSP+RELA+Q      +F K S +R+  + GG     Q   +
Sbjct: 173 HINAQPLLSPGDGPIVLVLSPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIREL 232

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
               ++VIATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 233 SRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 292

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLLQ 362
           TL++SAT P  +   A+  L +P+ V + + E   S N++ +   + + ++   LL  L+
Sbjct: 293 TLMWSATWPKEVQQLARDYLHDPIQVNVGSLELAASHNIKQVVEVVSEMDKRDRLLKHLE 352

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
                  A+E +  K+                                           +
Sbjct: 353 ------TASEDKDSKI-------------------------------------------L 363

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           +F  T+   + VT++L+  G+    I+G   Q+ R   L  FR+G + I+V TDVAARG+
Sbjct: 364 IFASTKRTCDEVTRVLRQDGWPALAIHGDKAQNERDWVLQEFRSGNSPIMVATDVAARGI 423

Query: 483 DI 484
            +
Sbjct: 424 GM 425

>TBLA0C00640 Chr3 (129301..131040) [1740 bp, 579 aa] {ON} Anc_8.124
           YGL171W
          Length = 579

 Score =  169 bits (427), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 129/446 (28%), Positives = 217/446 (48%), Gaps = 83/446 (18%)

Query: 126 GSF----ASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFV 181
           GSF      F   K +L N+    F +PTPIQ + IP+ L  RDIV  A TGSGKT AF+
Sbjct: 125 GSFDDLITRFSFDKRLLNNLIDNHFTEPTPIQSEAIPIALLDRDIVACAPTGSGKTMAFL 184

Query: 182 LPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKE---------FSKGSDLRSILLTG 232
           +P+++++      +G++ +I+SP++ELA   +++F E         F K   L+  LL+ 
Sbjct: 185 IPLLQQIIDEKKVVGLKGLIISPTKELA---NQIFLECVKLSRSIFFEKKRPLQVALLSK 241

Query: 233 GDSLEDQFGMMMGNP-DVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQL 291
             S + +  ++  +  D++I+TP R + +    +LDL  V++++FDEAD+LF+  F EQ 
Sbjct: 242 SLSAKLKNKVISNSKYDIIISTPLRLIDVVRNESLDLSKVKHLIFDEADKLFDKTFVEQT 301

Query: 292 NELLVAF--PTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIK 349
           +++L +   P  R+++ FSAT+PSS+ D A++ +++PV V +  +   + N+        
Sbjct: 302 DDILSSCTDPALRKSM-FSATIPSSVEDIAQSLMNDPVRVVIGHKEAANSNI-------- 352

Query: 350 KDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRL 409
               E  L++   E  K+       IK+L Q                             
Sbjct: 353 ----EQKLIFCGNEEGKLIA-----IKQLTQ----------------------------- 374

Query: 410 PNANEMPSEKATIVFVP--TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAG 467
               E   +   I+F+   TR    Y   +       V  I+       R + +  F++G
Sbjct: 375 ----EGEFKPPVIIFLESITRAKALYHEMMYDRLN--VDVIHAERTTIQRNKIIERFKSG 428

Query: 468 LTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXX 527
               L+ TDV ARGVD   +  VINY +P SS+ ++HR+GRT RAG +G A ++ +    
Sbjct: 429 ELWCLICTDVLARGVDFKGVNLVINYDVPRSSQAYVHRIGRTGRAGRKGKAITLYTKQDA 488

Query: 528 XXXXXXXXXXGKKILLTPMYESSCQI 553
                       K ++  M +S C++
Sbjct: 489 LAV---------KPIINVMKQSGCEV 505

>Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON}
           complement(441..1766) [1326 nt, 442 aa]
          Length = 441

 Score =  165 bits (417), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 109/362 (30%), Positives = 173/362 (47%), Gaps = 53/362 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF   G    VL  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 114 SFDEAGFPDYVLEEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 173

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      S   G   ++L+P+RELA+Q  +   +F   S +R+  + GG     Q   +
Sbjct: 174 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGSSSRIRNSCVYGGVPRGQQIREL 233

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
               ++VIATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 234 SRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLLQ 362
           TL++SAT P  +   A   L++P+ V++ + E   S N+  L   +   E+   LL  L+
Sbjct: 294 TLMWSATWPKEVKQLAHDYLNDPIQVQIGSLELSASHNITQLVEVVSDFEKRDRLLKHLE 353

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
                  A+E +  K+                                           +
Sbjct: 354 ------TASEDKDSKI-------------------------------------------L 364

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           VF  T+   + VT+ L+  G+    I+G  +Q  R   L  FR G + I+V TDVAARG+
Sbjct: 365 VFASTKRTCDEVTKYLREDGWPALAIHGDKDQRERDWVLQEFREGRSPIMVATDVAARGI 424

Query: 483 DI 484
            +
Sbjct: 425 GM 426

>AER408W Chr5 (1418694..1419890) [1197 bp, 398 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR021W (FAL1)
          Length = 398

 Score =  162 bits (411), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 103/399 (25%), Positives = 201/399 (50%), Gaps = 55/399 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F S  L + +L  I   GF  P+ IQ + I  I++ +D++  A++G+GKTA F + M++
Sbjct: 24  TFESMKLQENLLRGIYGYGFEAPSAIQSRAITQIIRGKDVIAQAQSGTGKTATFTIGMLQ 83

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
            + + S  +  +A++LSP+RELA Q  +V +      ++ ++  TGG +L+     +   
Sbjct: 84  VIDSSSKDL--QALVLSPTRELAAQISQVVRNLGDYMNVVALACTGGKALQQDISKVNKG 141

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFE--MGFQEQLNELLVAFPTNRQT 304
             V+  TPGR L +     ++ + V+ +V DEAD L    +GF++QL ++    P++ Q 
Sbjct: 142 CHVMSGTPGRVLDMIKRRIINTRHVKMLVLDEADELLSETLGFKQQLYDIFTKLPSSVQV 201

Query: 305 LLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEA 364
           ++ SAT+   +++  K  +S+PV + +  +    E ++   I++ K+E + + L  L ++
Sbjct: 202 VVVSATMSKVVLEVTKKFMSDPVKILVKRDEVSLEGIKQYHINVDKEEWKFDTLCDLYDS 261

Query: 365 IKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVF 424
           + +                                                      ++F
Sbjct: 262 LTIT---------------------------------------------------QCVIF 270

Query: 425 VPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDI 484
             T+  V++++  L    + V+ I+G + Q  R + + +FR+G + +L+ TDV ARG+D+
Sbjct: 271 CNTKKKVDWLSHKLIQNNFAVASIHGDMKQDDRDKVMSDFRSGSSRVLISTDVWARGIDV 330

Query: 485 PLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
             ++ VINY LP   + +IHR+GR+ R G +G A + ++
Sbjct: 331 QQVSLVINYDLPELLENYIHRIGRSGRFGRKGVAINFIT 369

>ZYRO0A10802g Chr1 complement(869465..871780) [2316 bp, 771 aa] {ON}
           similar to uniprot|P20448 Saccharomyces cerevisiae
           YJL033W HCA4 Putative nucleolar DEAD box RNA helicase
           high- copy number suppression of a U14 snoRNA processing
           mutant suggests an involvement in 18S rRNA synthesis
          Length = 771

 Score =  169 bits (429), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 120/439 (27%), Positives = 205/439 (46%), Gaps = 61/439 (13%)

Query: 94  LSDDEKKATNESDDDLNDYFNTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQ 153
           L+  ++K   + +D   +  +T        K   F    LS  VL  +    + + T IQ
Sbjct: 7   LTTSQRKQIRKREDQYIEELHTKTQEFNNPKATYFQDLPLSNAVLRGLKDASYVKLTDIQ 66

Query: 154 RKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKL--KTHSAKIGVRAVILSPSRELAIQ 211
           R +IP+ L+  D++G A+TGSGKT AF++P++EKL  +  +   GV A+I+SP+RELA+Q
Sbjct: 67  RDSIPVSLKGNDVLGAAKTGSGKTLAFLIPVLEKLYRERWTEYDGVGALIISPTRELAMQ 126

Query: 212 THRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKS 270
            + V  +        + L+ GG  ++ +    +   +++I TPGR L HL   + L++ +
Sbjct: 127 IYEVLIKIGTHCSFSAGLVIGGKDVKFE-AERISKINILIGTPGRLLQHLDQSVGLNIDN 185

Query: 271 VEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVR 330
           ++ +V DEADR  +MGF++ L+ ++   P  RQTLLFSAT   SL D A+  L++   V 
Sbjct: 186 LQMLVLDEADRCLDMGFKKTLDAIVSNLPPIRQTLLFSATQSQSLNDLARLSLTDYKTVG 245

Query: 331 LDA-----ETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXX 385
             A     + +  E L+  +I ++  ++   L   ++  +K                   
Sbjct: 246 TPANVSGSQPETPETLQQHYIVVELADKLDTLFSFIKTHLKC------------------ 287

Query: 386 XXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRH-HVEYVTQLLKNCGYL 444
                                            K  + F  ++  H  Y T      G  
Sbjct: 288 ---------------------------------KMIVFFSSSKQVHFVYETFRKLQPGIS 314

Query: 445 VSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIH 504
           + +++G   Q AR + L  F       L+ TDV +RG+D P +  V+    P +   +IH
Sbjct: 315 LMHLHGRQKQRARTETLDKFSRAQQVCLIATDVVSRGIDFPAVDWVVQVDCPENVDTYIH 374

Query: 505 RVGRTARAGNRGWAFSIVS 523
           RVGR+AR G +G +  +++
Sbjct: 375 RVGRSARYGKQGKSLIMLT 393

>KLTH0C07964g Chr3 complement(679877..681073) [1197 bp, 398 aa] {ON}
           highly similar to uniprot|Q12099 Saccharomyces
           cerevisiae YDR021W FAL1 Nucleolar protein required for
           maturation of 18S rRNA member of the eIF4A subfamily of
           DEAD-box ATP-dependent RNA helicases
          Length = 398

 Score =  162 bits (410), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/399 (24%), Positives = 198/399 (49%), Gaps = 55/399 (13%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F S  L + +L  +   GF  P+ IQ + I  I+  RD++  A++G+GKTA F + M++
Sbjct: 24  TFESMHLKEDLLRGVYAYGFEAPSAIQSRAITQIISGRDVIAQAQSGTGKTATFTIGMLQ 83

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
            +   S ++  ++++LSP+RELA Q  +V        ++ +   TGG +++     +   
Sbjct: 84  VIDFKSREL--QSLVLSPTRELAKQISQVVGNLGDYMNISAHACTGGKAMQTDTKKLTHG 141

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFE--MGFQEQLNELLVAFPTNRQT 304
             VV  TPGR L +     L+ + ++ ++ DEAD L    +GF++Q+ ++    P + Q 
Sbjct: 142 CHVVSGTPGRVLDMIKRRILNTRHLKMLILDEADELLSETLGFKQQIYDIFAKLPKSVQV 201

Query: 305 LLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEA 364
           ++ SAT+   +++  K  +S+PV + +  +    E ++   +++ ++E + + L  L ++
Sbjct: 202 VVVSATMSKDILEITKKFMSDPVKILVKRDEISLEGIKQYHVNVDREEWKFDTLCDLYDS 261

Query: 365 IKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVF 424
           + +                                                      ++F
Sbjct: 262 LTIT---------------------------------------------------QCVIF 270

Query: 425 VPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDI 484
             T+  V++++  L    + V+ ++G + Q  R + + +FR+G + +L+ TDV ARG+D+
Sbjct: 271 CNTKKVVDWLSSKLLQANFAVASMHGDMKQEDRDRVMNDFRSGTSRVLISTDVWARGIDV 330

Query: 485 PLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
             ++ VINY LP + + +IHR+GR+ R G +G A + ++
Sbjct: 331 QQVSLVINYDLPDNLENYIHRIGRSGRFGRKGVAINFIT 369

>TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.148
           YBR237W
          Length = 427

 Score =  161 bits (407), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 106/366 (28%), Positives = 176/366 (48%), Gaps = 61/366 (16%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F   G    VL  +  +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP I 
Sbjct: 115 NFDEAGFPDYVLEEVKAEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 174

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      S   G   ++LSP+RELA+Q  +   +F + S +R+  + GG     Q   +
Sbjct: 175 HINAQPLLSPGDGPIVLVLSPTRELAVQIQKECSKFGQSSRIRNTCVYGGVPRGQQIRDL 234

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
           +   ++VIATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 235 IRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 294

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVR-----LDAETKISENLEMLFISIKKDEREANLL 358
           TL++SAT P  +   A+  L++P+ V+     L A   I++ +E++    K+D    +L+
Sbjct: 295 TLMWSATWPKEVQQLARDYLNDPIQVQIGSLELSASHTITQLVEVVSDFEKRDRLNKHLV 354

Query: 359 YLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSE 418
                      A+E +                                           E
Sbjct: 355 ----------TASEDK-------------------------------------------E 361

Query: 419 KATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVA 478
              ++F  T+   + +T+ L+  G+    I+G  +Q  R   L  FR G + I+V TDVA
Sbjct: 362 SKILIFASTKRTCDEITKYLREDGWPALAIHGDKDQRERDWVLQEFRDGRSPIMVATDVA 421

Query: 479 ARGVDI 484
           ARG+ +
Sbjct: 422 ARGIGM 427

>KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} similar
           to uniprot|P25808 Saccharomyces cerevisiae YFL002C SPB4
           involved in the maturation of 25S ribosomal RNA
           ATP-dependent RNA helicase
          Length = 598

 Score =  164 bits (415), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 120/416 (28%), Positives = 193/416 (46%), Gaps = 75/416 (18%)

Query: 131 FGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK--- 187
           + L   +   I   GF   TP+Q  TIP+    +D+V  + TGSGKT AF +P++EK   
Sbjct: 12  YELQPWIRTAIDAMGFEIMTPVQASTIPMFSGNKDVVVESVTGSGKTIAFTIPILEKVVK 71

Query: 188 --LKTHSAKIG-VRAVILSPSRELAIQTHRVFKEF-----SKGSDLRSILLTGGDSL--- 236
             L     K G   ++I+SP+REL+ Q   V + F     S+   ++S L+ G  S    
Sbjct: 72  EVLSGSPLKRGHFYSLIISPTRELSKQIQDVVEAFLAYYPSESCPIKSQLIVGTSSCSVR 131

Query: 237 EDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLV 296
           +D    +   P ++I TPGR L       +   S   VV DEADRL ++ F++ +  +L 
Sbjct: 132 DDVSKFLENAPQILIGTPGRVLDFMKASTVKTSSCGVVVLDEADRLLDVSFEKDVESILG 191

Query: 297 AFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREAN 356
             P  R+T LFSAT+ S+     + G+ NPV + + ++ +  E+L++ +I +K +E+  +
Sbjct: 192 MLPKQRRTGLFSATISSAGNQIYRTGMRNPVKIAVKSKVQNPESLQINYIVVKPEEKLHH 251

Query: 357 LLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMP 416
           LL ++                                                   N M 
Sbjct: 252 LLNII---------------------------------------------------NNMR 260

Query: 417 SEKATIVFVPTRHHVEYVTQLLKNCGYL--------VSYIYGALNQHARKQQLYNFRAGL 468
             K  IV+ PT   V Y    LK+   +        V  ++G L  ++R   L  F   L
Sbjct: 261 YRKC-IVYFPTCQAVTYFYSFLKHLSDISKTRDDLEVYSLHGKLQTNSRIGTLAKFSTSL 319

Query: 469 T-SILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
             ++L+ TDVAARG+DIP +  V+ +  P ++++F+HR GRT RA   G A + ++
Sbjct: 320 NIAVLLTTDVAARGIDIPEVDLVLQFDPPTNAEMFLHRCGRTGRANRAGKAITFIN 375

>KNAG0I02050 Chr9 complement(399547..399554,399758..401021) [1272
           bp, 423 aa] {ON} Anc_2.164 YNL112W
          Length = 423

 Score =  160 bits (405), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 107/361 (29%), Positives = 171/361 (47%), Gaps = 53/361 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F   G    VL  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 111 TFDEAGFPDYVLTEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 170

Query: 187 KLKTHS---AKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +   +      G   ++L+P+RELA+Q  +   +F   S +R+  + GG     Q   +
Sbjct: 171 HINAQALLQPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDL 230

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
               ++VIATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 231 NRGSEIVIATPGRLIDMLELGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDA-ETKISENLEMLFISIKKDEREANLLYLLQ 362
           TL++SAT P  +   A   LS+P+ V++ + E   S  +      +   E+   L   ++
Sbjct: 291 TLMWSATWPKEVKQLAADYLSDPIQVQIGSLELAASHTITQRVEVVSGFEKRDRLAKHVE 350

Query: 363 EAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATI 422
            A + P   ES+I                                              +
Sbjct: 351 TASQNP---ESKI----------------------------------------------L 361

Query: 423 VFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGV 482
           VF  T+   + +T+ L+  G+    I+G  +Q  R   L  FR G + I+V TDVAARG+
Sbjct: 362 VFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLNEFRTGRSPIMVATDVAARGI 421

Query: 483 D 483
           D
Sbjct: 422 D 422

>TDEL0B01670 Chr2 (297786..299525) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  163 bits (413), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 115/409 (28%), Positives = 201/409 (49%), Gaps = 78/409 (19%)

Query: 137 VLINISKKGFRQPTPIQRKTIPLILQK--RDIVGMARTGSGKTAAFVLPMIEKLKTHSAK 194
           V++N  K  +++PTPIQR  IP I ++  RD +G+A TGSGKT AFV+P++ K+ +   +
Sbjct: 179 VIVNSLK--YKEPTPIQRIAIPNICKRGSRDFLGVASTGSGKTLAFVIPILIKMISSEPR 236

Query: 195 I-------GVRAVILSPSRELAIQTHRVFKEFSKGSDL-------RSILLTGGDSLEDQF 240
                   G +A+IL+P+RELA Q     ++ +K  ++       R + + GG SLE+  
Sbjct: 237 PPALKSIEGPKALILAPTRELAQQIQAESEKITKLWNVKNPEYSCRVVSVVGGHSLEETT 296

Query: 241 GMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPT 300
             +    D+++ATPGR +       L +K VE +V DEADR+ ++GF+EQ+ ++     +
Sbjct: 297 YNLQKGCDILVATPGRLIDSLESHILTIKQVETLVLDEADRMIDLGFEEQVTKIFNILES 356

Query: 301 NR-----QTLLFSATLPSSLVDFAKAGLSNPVLVRLD-AETKISENLEMLFISIKKDERE 354
                  Q L+F+AT+  S+   A   L  P    +   E  I +  ++++ S  ++ R 
Sbjct: 357 TSEQGKIQKLMFTATMSGSIERIANGYLQKPSYATIGRGEGSIPQIQQLVYYSGSEERRF 416

Query: 355 ANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANE 414
             +  LL++   MP                                              
Sbjct: 417 RRVKSLLEQY--MP---------------------------------------------- 428

Query: 415 MPSEKATIVFVPTRHHVEYVTQLL-KNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILV 473
                  IVFV  +   +++ Q   +   + V+ ++G+ +Q  R+  L   R+G   +++
Sbjct: 429 -----PIIVFVTYKKTADWLVQKFNQETSFRVTVLHGSKSQDQREHSLQLLRSGKAQVMI 483

Query: 474 VTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
            T+VAARG+DIP ++ V+N+ +    + +IHR+GRT RAG +G A + +
Sbjct: 484 ATNVAARGLDIPNVSLVVNFQISKQFEDYIHRIGRTGRAGMKGTAITFL 532

>TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.469
           YDR243C
          Length = 607

 Score =  163 bits (413), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 114/404 (28%), Positives = 195/404 (48%), Gaps = 76/404 (18%)

Query: 143 KKGFRQPTPIQRKTIPLIL------QKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKI- 195
           K  F  PTPIQR  IP I        K D +G+A TGSGKT +FVLP++ KL     +  
Sbjct: 192 KLNFETPTPIQRIAIPNICGKVGHSTKNDFMGIAETGSGKTFSFVLPILIKLSRSEFRPM 251

Query: 196 ------GVRAVILSPSRELAIQTHRVFKEF-----SKGSDLRSILLTGGDSLEDQFGMMM 244
                 G +A+IL+P+RELA Q     + F      K  +  S+ + GG S+E+    + 
Sbjct: 252 SIKKMDGPKALILAPTRELAQQIQSEIEHFIQYWGGKSLEYTSVSIVGGYSIEELTFKIS 311

Query: 245 GNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNR-- 302
              D+++ATPGR +       + L  +E +V DEAD++ ++GF+EQL+ +L    + +  
Sbjct: 312 KGMDILVATPGRLIDCLESKLIVLNDIETLVLDEADKMIDLGFEEQLSTILSYVASYKSK 371

Query: 303 ---QTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLY 359
              QT++FSAT+   +     + L  P+  ++ +     E +E +   ++  E E     
Sbjct: 372 DTVQTIMFSATMSPDIEKLTTSYLHKPIFAKVGSPKSAIERIEQI---VRYSETE----- 423

Query: 360 LLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEK 419
                       ES   K+K+                            L    + P   
Sbjct: 424 ------------ESTFDKIKE----------------------------LLYGFDSP--- 440

Query: 420 ATIVFVPTRHHVEYV-TQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVA 478
             I+F+  +   +++  ++ +   +  + ++G+ +Q  R+  +   ++G   +++ T+VA
Sbjct: 441 -IIIFINYKRTADWLYKKIQEETSFHATILHGSKSQDQREHSVKLLKSGKVQVMIATNVA 499

Query: 479 ARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIV 522
           ARG+DIP ++ VIN+ +P S + +IHR+GRT RAGN G A S +
Sbjct: 500 ARGIDIPNVSLVINFQIPSSFEDYIHRIGRTGRAGNSGTAVSFM 543

>TBLA0D03400 Chr4 (844529..846856) [2328 bp, 775 aa] {ON} Anc_5.241
           YJL033W
          Length = 775

 Score =  165 bits (417), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 113/409 (27%), Positives = 192/409 (46%), Gaps = 66/409 (16%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    +S   L  + +  F + T IQ+ +IP+ L+  D++G A+TGSGKT AF++P++EK
Sbjct: 44  FKDLPISNATLRGLKEASFVKLTEIQKNSIPISLKGYDVLGAAKTGSGKTLAFLIPVLEK 103

Query: 188 L--KTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMG 245
           L  +  +   G+ A+I+SP+RELAIQ + V  +    +   + L+ GG  ++ +    + 
Sbjct: 104 LYRENWTEFDGLGALIISPTRELAIQIYEVLLKIGSRTSFSAGLVIGGKDVKFE-SERIS 162

Query: 246 NPDVVIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQT 304
             +++I TPGR L H+   + L+L +++ +V DEADR  +MGF++ L+ ++   P +RQT
Sbjct: 163 RINILIGTPGRILQHMDQAVGLNLNNLQMLVLDEADRCLDMGFKKTLDAIVNNLPISRQT 222

Query: 305 LLFSATLPSS--------LVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREAN 356
           LLFSAT   S        L D+   G  + V       +   E L+  +I +   ++   
Sbjct: 223 LLFSATQSQSLDDLARLSLTDYKSIGTLDIVKENETGASATPETLQQSYIDVPLQDKLDT 282

Query: 357 LLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMP 416
           L   ++  +K                                              N+M 
Sbjct: 283 LFSFIKTHLK----------------------------------------------NKM- 295

Query: 417 SEKATIVFVPTRHHVEYVTQLLKNC--GYLVSYIYGALNQHARKQQLYNFRAGLTSILVV 474
                I+F+ +   V +V +  +    G  + +++G   Q AR + L  F       L  
Sbjct: 296 -----IIFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQQVCLFA 350

Query: 475 TDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           TDV ARG+D P +  V+    P     +IHRVGR AR G +G +  +++
Sbjct: 351 TDVVARGIDFPSVDWVVQVDCPEDVDTYIHRVGRCARYGKQGKSLIMLT 399

>Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112W
           (REAL)
          Length = 435

 Score =  158 bits (400), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 109/366 (29%), Positives = 172/366 (46%), Gaps = 61/366 (16%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF   G    VL  +  +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP I 
Sbjct: 114 SFEEAGFPDYVLKEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 187 KLKTH---SAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +      +   G   ++LSP+RELA+Q      +F   S +R+  + GG     Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLSPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL 233

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
               ++VIATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++     +RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVR-----LDAETKISENLEMLFISIKKDEREANLL 358
           TL++SAT P  +   A   L++P+ V+     L A   I++ +E++    K+D    +L 
Sbjct: 294 TLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHTITQVVEVVSDFEKRDRLNKHL- 352

Query: 359 YLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSE 418
                       T SQ  + K                                       
Sbjct: 353 -----------ETASQDDEYK--------------------------------------- 362

Query: 419 KATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVA 478
             T+VF  T+   + +T+ L+  G+    I+G  +Q  R   L  FR G + ++V TDVA
Sbjct: 363 --TLVFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPVMVATDVA 420

Query: 479 ARGVDI 484
           ARG+ +
Sbjct: 421 ARGIGM 426

>Smik_15.224 Chr15 complement(380539..381972) [1434 bp, 477 aa] {ON}
           YOR046C (REAL)
          Length = 477

 Score =  159 bits (403), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 117/405 (28%), Positives = 190/405 (46%), Gaps = 66/405 (16%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQK--RDIVGMARTGSGKTAAFVLPM 184
           SF   GL+  +L  I    F++P+ IQ + +PL+L    R+++  +++G+GKTAAF L M
Sbjct: 88  SFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTM 147

Query: 185 IEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMM 244
           + ++    A    +A+ L+PSRELA QT  V +E  K + + S L+   DS E    +  
Sbjct: 148 LTRVNPEDA--SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIV-PDSFEKNKQI-- 202

Query: 245 GNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLVAFPTNRQ 303
            N  +++ TPG  L L     + L+ ++  V DEAD +  + G  +Q   +    P + Q
Sbjct: 203 -NSQIIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQ 261

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQE 363
            +LFSAT   ++  +AK  + N   + L       + ++ L++  K             E
Sbjct: 262 LVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCK------------NE 309

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
           A K  V TE                                          + +  ++I+
Sbjct: 310 ADKFDVLTE---------------------------------------LYGLMTIGSSII 330

Query: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483
           FV T+     +   LKN G+ VS ++G L    R + + +FR G + +L+ T+V ARG+D
Sbjct: 331 FVATKKTANVLYGKLKNEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGID 390

Query: 484 IPLLANVINYSLP------GSSKIFIHRVGRTARAGNRGWAFSIV 522
           IP ++ V+NY LP           +IHR+GRT R G +G A S V
Sbjct: 391 IPTVSMVVNYDLPTLANGKADPATYIHRIGRTGRFGRKGVAISFV 435

>Skud_15.210 Chr15 complement(374410..375858) [1449 bp, 482 aa] {ON}
           YOR046C (REAL)
          Length = 482

 Score =  159 bits (402), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 118/405 (29%), Positives = 191/405 (47%), Gaps = 66/405 (16%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQK--RDIVGMARTGSGKTAAFVLPM 184
           SF   GL+  +L  I    F++P+ IQ + +PL+L    R+++  +++G+GKTAAF L M
Sbjct: 93  SFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTM 152

Query: 185 IEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMM 244
           + ++    A    +A+ L+PSRELA QT  V +E  K +++ S L+   DS E    +  
Sbjct: 153 LTRVNPEDA--SPQAICLAPSRELARQTLDVIQEMGKFTEITSQLIV-PDSFEKNKQI-- 207

Query: 245 GNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLVAFPTNRQ 303
            N  V++ TPG  L L     + L+ ++  V DEAD +  + G  +Q   +    P + Q
Sbjct: 208 -NAQVIVGTPGTVLDLMRRKLVQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDAQ 266

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQE 363
            +LFSAT   ++  +AK  + N   + L       + ++ L++  K             E
Sbjct: 267 LVLFSATFAEAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCK------------NE 314

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
           A K  V TE                                          + +  ++I+
Sbjct: 315 ADKFEVLTE---------------------------------------LYGLMTIGSSII 335

Query: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483
           FV T+     +   LKN G+ VS ++G L    R + + +FR G + +L+ T+V ARG+D
Sbjct: 336 FVATKKTANVLYGKLKNEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGID 395

Query: 484 IPLLANVINYSLP------GSSKIFIHRVGRTARAGNRGWAFSIV 522
           IP ++ V+NY LP           +IHR+GRT R G +G A S V
Sbjct: 396 IPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFV 440

>Suva_8.98 Chr8 complement(177272..178720) [1449 bp, 482 aa] {ON}
           YOR046C (REAL)
          Length = 482

 Score =  159 bits (402), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 118/405 (29%), Positives = 190/405 (46%), Gaps = 66/405 (16%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQK--RDIVGMARTGSGKTAAFVLPM 184
           SF   GL+  +L  I    F++P+ IQ + +PL+L    R+++  +++G+GKTAAF L M
Sbjct: 93  SFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPARNMIAQSQSGTGKTAAFSLTM 152

Query: 185 IEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMM 244
           + ++    A    +A+ L+PSRELA QT  V +E  K + + S L+   DS E    +  
Sbjct: 153 LTRVNPEDA--SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIV-PDSFEKNKQI-- 207

Query: 245 GNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLVAFPTNRQ 303
            N  V++ TPG  L L     + L+ ++  V DEAD +  + G  +Q   +    P + Q
Sbjct: 208 -NAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQ 266

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQE 363
            +LFSAT   ++  +AK  + N   + L       + ++ L++  K             E
Sbjct: 267 LVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCK------------NE 314

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
           A K  V TE                                          + +  ++I+
Sbjct: 315 ADKFEVLTE---------------------------------------LYGLMTIGSSII 335

Query: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483
           FV T+     +   LKN G+ VS ++G L    R + + +FR G + +L+ T+V ARG+D
Sbjct: 336 FVATKKTANVLYGKLKNEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGID 395

Query: 484 IPLLANVINYSLP------GSSKIFIHRVGRTARAGNRGWAFSIV 522
           IP ++ V+NY LP           +IHR+GRT R G +G A S V
Sbjct: 396 IPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFV 440

>SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} similar
           to uniprot|P23394 Saccharomyces cerevisiae YDR243C PRP28
           RNA helicase in the DEAD-box family involved in RNA
           isomerization at the 5' splice site
          Length = 566

 Score =  160 bits (406), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 116/428 (27%), Positives = 217/428 (50%), Gaps = 71/428 (16%)

Query: 111 DYFNTTADAAAKHKKGSFASFGL--SKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVG 168
           D+  +T   + +    +++  G+   +L+ I I K  + +PTPIQR TIP +   RD +G
Sbjct: 147 DFNISTKGGSIRQPLRNWSELGIIPEELLHIIIRKLHYTEPTPIQRVTIPNVDNGRDFLG 206

Query: 169 MARTGSGKTAAFVLPMIEKLKT-----HSAKI-GVRAVILSPSRELAIQ----THRVFKE 218
           +A TGSGKT AF++P+I KL T        K+ G  ++IL+P+RELA Q      ++ + 
Sbjct: 207 VAVTGSGKTLAFLIPIIIKLNTLPPLTEITKLNGPYSLILAPTRELAQQIEAEARKLTQY 266

Query: 219 FSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDE 278
           +S+  ++ SI+  GG ++E+    +    ++++ATPGR +       L L+ V  +V DE
Sbjct: 267 WSRPCNVVSIV--GGHAIEEISYNLSRGCEILVATPGRLIDCLENHVLVLEQVNILVLDE 324

Query: 279 ADRLFEMGFQEQLNELL--VAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETK 336
           ADR+ + GF++QL  +L   +    RQT++F+AT+  ++   A   L+ P          
Sbjct: 325 ADRMIDYGFEDQLTTILSKTSSSNKRQTMMFTATMSPTIEKIADGYLNKPA--------- 375

Query: 337 ISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXX 396
                   +++I  +E +  +  +L+    +P + E +  KL +                
Sbjct: 376 --------YVTIGGEETKPQITQILE---YLP-SEEKRFLKLSK---------------- 407

Query: 397 XXXXXXXXXXRRLPNANEMPSEKA-TIVFVPTRHHVEYVTQLLKN-CGYLVSYIYGALNQ 454
                           + +P   A  I+F+  +   +++ +  ++   Y  + ++G+ +Q
Sbjct: 408 ----------------DILPHYPAPIIIFINYKRTADWLAKKFQDETKYRTTTLHGSKSQ 451

Query: 455 HARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGN 514
             R+  L   R+G   I++ T+VA RG+DIP ++ V+N+ +    + +IHR+GRT RAG 
Sbjct: 452 EQRENSLNLLRSGKADIMIATNVAGRGIDIPNVSLVVNFQMATKLEDYIHRIGRTGRAGK 511

Query: 515 RGWAFSIV 522
            G++ + +
Sbjct: 512 EGYSITFL 519

>KAFR0E02810 Chr5 complement(567875..569581) [1707 bp, 568 aa] {ON}
           Anc_8.469 YDR243C
          Length = 568

 Score =  160 bits (406), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 115/383 (30%), Positives = 187/383 (48%), Gaps = 64/383 (16%)

Query: 146 FRQPTPIQRKTIP-LILQKRDIVGMARTGSGKTAAFVLPMIEKL--KTHSAKI--GVRAV 200
           F++PTPIQR  IP  I   RD +G+A TGSGKT AF++P++ +L  +  S KI  G +++
Sbjct: 185 FQEPTPIQRVAIPNTIKTNRDFLGVASTGSGKTLAFIIPILIRLPQRPKSLKILDGPKSL 244

Query: 201 ILSPSRELAIQTHRVFKEFSK---GSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRF 257
           I+ P+RELA Q     KE +K    ++   + + GG S+E     +    D+++ATPG+ 
Sbjct: 245 IIVPTRELAQQIETSAKEITKRWKSNECNVLSIVGGHSIEKITLDLSIGCDILVATPGKL 304

Query: 258 LHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNR---QTLLFSATLPSS 314
           +       L L  V+ +V DEAD++ ++GF++Q+  +L      R   QT++F+      
Sbjct: 305 IECLQSHILTLNQVDTLVMDEADKMIDLGFEDQITAILARLSMERSSLQTMMFT------ 358

Query: 315 LVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQ 374
                 A LS  +        KIS N                  YL    I    + E Q
Sbjct: 359 ------ATLSQSI-------EKISNN------------------YLNSPIIVKIGSEEDQ 387

Query: 375 IKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYV 434
           + K++Q                          + L N +        I+F+  +   +Y+
Sbjct: 388 VPKIQQ----------TVEYSENEENRFKQIIKTLKNCSP-----PIIIFINYKSTADYL 432

Query: 435 TQLLKN-CGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINY 493
           T+  +N   +  + ++G+ NQ  R+  +   R G   +L+ T+VAARG+DIP ++ VIN+
Sbjct: 433 TKKFRNETNFKFTILHGSKNQEQREHSINLLRTGAVQVLIATNVAARGIDIPNVSLVINF 492

Query: 494 SLPGSSKIFIHRVGRTARAGNRG 516
            +P   + +IHR+GRT RAGN G
Sbjct: 493 QMPKHFEDYIHRIGRTGRAGNLG 515

>CAGL0L08976g Chr12 complement(981008..982861) [1854 bp, 617 aa]
           {ON} highly similar to uniprot|P25808 Saccharomyces
           cerevisiae YFL002c SPB4
          Length = 617

 Score =  160 bits (405), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 125/408 (30%), Positives = 185/408 (45%), Gaps = 83/408 (20%)

Query: 139 INISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSA----- 193
           IN+S  GF   TP+Q  TIP+  + +D+V  + TGSGKT AFV+P++EK+ +        
Sbjct: 22  INVS--GFDSMTPVQASTIPMFAKNKDVVVESVTGSGKTIAFVIPILEKIISEGINNSKF 79

Query: 194 -KIGVRAVILSPSRELAIQTHRVFKEF-----SKGSDLRSILLTGGD--SLEDQFGMMMG 245
            K    ++IL+P+REL++Q   V   F          +RS L+ G +  S+ D    ++ 
Sbjct: 80  KKGHFYSLILAPTRELSMQIQNVVSSFLEHYPEDQYPIRSQLVVGTNEKSVRDDVNTLLD 139

Query: 246 N-PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQT 304
             P ++I TPGR L      ++   S   VV DEADRL ++ F + + ++L   P  R+T
Sbjct: 140 ERPQILIGTPGRVLDFLQSPSVKTSSCGMVVLDEADRLLDVSFFKDVEKILNVLPKQRRT 199

Query: 305 LLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEA 364
            LFSAT+ S+     K GL NPV + ++++ K +     LF S+ K E +   L  +   
Sbjct: 200 GLFSATISSAGTLIFKTGLRNPVKITVNSQGKNAPTTLNLFYSVMKPEEKLQNLIHIMNN 259

Query: 365 IKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVF 424
           I+                                                    K  IV+
Sbjct: 260 IRF---------------------------------------------------KKCIVY 268

Query: 425 VPTRHHVEYVTQLLKNCGYL------------VSYIYGALNQHARKQQLYNFRAGLT-SI 471
             T   V +  Q LK   YL            V  I+G L   +R++ L  F   L+  I
Sbjct: 269 FSTCVSVTFFYQYLK---YLQQTDKTLREDLQVISIHGKLTTQSRRKALSTFTESLSDCI 325

Query: 472 LVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAF 519
           L+ TDVAARG+DIP +  V+    P  + IF+HR GRT RA   G A 
Sbjct: 326 LLTTDVAARGIDIPDVDLVLQIDPPTDADIFLHRCGRTGRANKIGRAI 373

>Kpol_1058.43 s1058 complement(121252..123075) [1824 bp, 607 aa]
           {ON} complement(121252..123075) [1824 nt, 608 aa]
          Length = 607

 Score =  159 bits (403), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 118/402 (29%), Positives = 190/402 (47%), Gaps = 75/402 (18%)

Query: 145 GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKL------KTHSAKIGVR 198
           GF   TP+Q  TIPL  + +D+V  + TGSGKT +FV+P+ EK+       T   K    
Sbjct: 26  GFENMTPVQAATIPLFARNKDVVVDSVTGSGKTVSFVIPIFEKIVQEEANTTKMKKGHFH 85

Query: 199 AVILSPSRELAIQTHRVFKEFSKGSD-----LRSILLTGGD--SLEDQFGMMMGN-PDVV 250
           ++I+SP++ELA Q H VF+ F +        +RS LL G +  ++ D     M N P ++
Sbjct: 86  SLIVSPTKELAKQIHSVFESFLEHYPENLYPIRSQLLVGTNVKTVRDDVSDFMENKPQIL 145

Query: 251 IATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSAT 310
           I TPGR L      ++       V+ DEADRL ++ F + +  ++   P  R+T LFSAT
Sbjct: 146 IGTPGRILDFLKIPSVKTSMCSMVILDEADRLLDVSFLKDMENIMNILPKQRRTGLFSAT 205

Query: 311 LPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVA 370
           + S+  +  K GL NPV V ++++++   +L++    ++ D++       L++ I   + 
Sbjct: 206 ITSAGDNIFKTGLRNPVKVTVNSKSQAPSSLKIDCAVVETDKK-------LEQVIS--II 256

Query: 371 TESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHH 430
              + KK                                            I + PT H 
Sbjct: 257 NNYKFKK-------------------------------------------CIAYFPTCHS 273

Query: 431 VEY---VTQLLKNCGYL-----VSYIYGALNQHARKQQLYNFRAGLT-SILVVTDVAARG 481
           V Y     Q L   G +     +  ++G L   AR + L  F   ++ ++L+ TDVAARG
Sbjct: 274 VTYFYSFMQYLLKKGIIKEEIQIYSLHGKLQTSARIKTLETFTETISNAVLLTTDVAARG 333

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +DIP +  V+    P   ++F+HR GRT RA   G A + ++
Sbjct: 334 IDIPDVDLVLQLDPPTDPEVFLHRCGRTGRANKLGKAITFLT 375

>Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa]
           {ON} YFL002C (SPB4) - ATP-dependent RNA helicase [contig
           7] FULL
          Length = 598

 Score =  159 bits (401), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 118/406 (29%), Positives = 189/406 (46%), Gaps = 75/406 (18%)

Query: 141 ISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTH-----SAKI 195
           I   G+   TP+Q  TIPL    +D+V  + TGSGKT AFV+P++EK+        S K 
Sbjct: 22  IDAMGYETMTPVQASTIPLFSGNKDVVVESVTGSGKTVAFVIPVLEKVMKDIINGVSLKK 81

Query: 196 G-VRAVILSPSRELAIQTHRVFKEF-----SKGSDLRSILLTG--GDSLEDQFGMMMGN- 246
           G   ++I+SP+REL+ Q   VF  F     S    ++S LL G    S+ D       N 
Sbjct: 82  GHFHSLIISPTRELSKQIQSVFDSFLEFYPSTPCPIKSQLLVGTSASSVRDDVNAFTENK 141

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLL 306
           P +++ TPGR         +   S   V+ DEADRL ++ F++++  +L   P  R+T L
Sbjct: 142 PQILVGTPGRTFEFLKSTAVKSTSCSVVILDEADRLLDVSFEKEVESILNLLPKQRRTGL 201

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIK 366
           FSAT+ S+     + G+ NPV + + A+ +  E+L++ ++ +K +++   LL +L     
Sbjct: 202 FSATISSAGDQIFRTGMRNPVKIAVRAKGQNPESLKINYLVVKPEDKLQQLLNIL----- 256

Query: 367 MPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVP 426
                                                         N     K  + F P
Sbjct: 257 ----------------------------------------------NNFRYRKCIVYF-P 269

Query: 427 TRHHVEYVTQLLKNCGYL--------VSYIYGALNQHARKQQLYNFRAGL-TSILVVTDV 477
           T   V Y    +K+   L        +  ++G L  ++R   L  F   L +S+L+ TDV
Sbjct: 270 TCQAVTYFYSFIKHLCELGIIGASLQIFSLHGKLQTNSRLGTLTKFSQSLDSSVLLTTDV 329

Query: 478 AARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           AARG+DIP +  V+ +  P ++++F+HR GRT RA   G A + ++
Sbjct: 330 AARGIDIPEVDLVLQFDPPPNAEMFLHRCGRTGRANRVGKAVTFLN 375

>KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {ON}
           Anc_5.337 YHR065C
          Length = 487

 Score =  157 bits (396), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 98/271 (36%), Positives = 144/271 (53%), Gaps = 7/271 (2%)

Query: 98  EKKATNESDDDLNDYFNTTADAAAKHKKGSFASFGLSKLV--LINISKK-GFRQPTPIQR 154
           E +A N SD++        A         +F SF    LV  LI   K   + +PTPIQ 
Sbjct: 36  EDEAINSSDEEKGIIVKNNAAEEDAGNDETFESFTELNLVPELIQACKNLNYEKPTPIQS 95

Query: 155 KTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHR 214
           K+IP  L  +DI+G+A+TGSGKTAAF +P++  L     ++   A ILSP+RELA Q   
Sbjct: 96  KSIPPALNGKDIIGLAQTGSGKTAAFAIPILNSL--WHDQLPYYACILSPTRELAQQIKE 153

Query: 215 VFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFL-HLKVEMNLDLKSVEY 273
            F        +R++ + GG ++ DQ   +M  P ++IATPGR + HL+      L+ + Y
Sbjct: 154 TFDSLGSLMGVRTVCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTRGFSLRKLRY 213

Query: 274 VVFDEADRLFEMGFQEQLNELLVAFPT-NRQTLLFSATLPSSLVDFAKAGLSNPVLVRLD 332
           +V DEADRL +M F   L+ +L   PT  R T LFSAT+ S +    +A L+NPV   + 
Sbjct: 214 LVMDEADRLLDMEFGPVLDRILKILPTEGRTTYLFSATMTSKIDKLQRASLTNPVKCAVS 273

Query: 333 AETKISENLEMLFISIKKDEREANLLYLLQE 363
            + +  + L    + +    +   L+YLL E
Sbjct: 274 NKYQTVDTLVQTLMVVPGGLKNTFLIYLLNE 304

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 71/123 (57%)

Query: 419 KATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVA 478
           K  I+F  T+ + E +  L     +  + ++G LNQ+ R   L  F+AG  SILV TDVA
Sbjct: 308 KTFIIFTRTKANAERIAGLANLLEFNATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 367

Query: 479 ARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVSXXXXXXXXXXXXXXG 538
           ARG+DIP +  VINY +P  SK +IHRVGRTARAG  G + S+VS              G
Sbjct: 368 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 427

Query: 539 KKI 541
           KK+
Sbjct: 428 KKL 430

>TPHA0B03040 Chr2 complement(690810..692000) [1191 bp, 396 aa] {ON}
           Anc_1.211 YJL138C
          Length = 396

 Score =  154 bits (389), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 102/379 (26%), Positives = 183/379 (48%), Gaps = 56/379 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F    L + +L  +   GF +P+ IQ++ I  I++K D++  A++G+GKT  F +  +E
Sbjct: 24  NFDDMNLKEELLKGVYGYGFEEPSAIQQRAILPIVEKHDVLAQAQSGTGKTGTFSIAALE 83

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDS-LEDQFGMMMG 245
           ++   S+    +A+IL+P+RELA+Q  +V    +   D++     GG S +ED  G+   
Sbjct: 84  RID--SSIKSPQALILAPTRELALQIQKVVIALALHMDVKVHACIGGTSFVEDSEGLR-- 139

Query: 246 NPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTL 305
           +  +V+ TPGR             +++  + DEAD +   GF+EQ+ ++    P   Q +
Sbjct: 140 DAQIVVGTPGRVSDNIQRRRFKTDNIKMFILDEADEMLSSGFREQIYQIFTMLPPTTQVV 199

Query: 306 LFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAI 365
           L SATLP+ +++     + NPV + +  +    E ++  +I++++D+ + + L  L ++I
Sbjct: 200 LLSATLPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYINVEEDDYKFDCLTDLYDSI 259

Query: 366 KMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFV 425
            +  A                                                   ++F 
Sbjct: 260 SVTQA---------------------------------------------------VIFC 268

Query: 426 PTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIP 485
            TR  VE +TQ L    + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+ 
Sbjct: 269 NTRRKVEELTQKLTENNFTVSSIYSDLPQQERDVIMKEFRSGSSRILISTDLLARGIDVQ 328

Query: 486 LLANVINYSLPGSSKIFIH 504
            ++ VINY LP + + +IH
Sbjct: 329 QVSLVINYDLPTNKENYIH 347

>ZYRO0E02530g Chr5 (197126..198796) [1671 bp, 556 aa] {ON} highly
           similar to uniprot|P45818 Saccharomyces cerevisiae
           YGL171W ROK1 ATP-dependent RNA helicase of the DEAD box
           family required for 18S rRNA synthesis
          Length = 556

 Score =  157 bits (396), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 121/413 (29%), Positives = 199/413 (48%), Gaps = 74/413 (17%)

Query: 126 GSF----ASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFV 181
           GSF    + F   K +L N+    F +PTPIQ + IPL L  RD++  A TGSGKT AF+
Sbjct: 116 GSFEDLISRFSFDKRLLNNLIDNDFTEPTPIQCEGIPLALHGRDLLSCAPTGSGKTLAFL 175

Query: 182 LPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLE---- 237
           +P+++++       G++ +I+SP++ELA QT   F E  K S  R I L     L+    
Sbjct: 176 IPLLQQIIDSKDVQGLKGLIISPTKELASQT---FVECVKLS--RKIFLDKKRPLQVAIL 230

Query: 238 -DQFGMMMGNP-------DVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQE 289
                  + N        D++I+TP R + L     LDL +V ++VFDEAD+LF+  F E
Sbjct: 231 SKSLSAKLRNKVVSDKKYDIIISTPLRLIDLVKNEALDLSNVRHLVFDEADKLFDKTFVE 290

Query: 290 QLNELLVAF--PTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFIS 347
           Q +++L A   P  R++ +FSAT+PS++ + A++ +++PV V +  +   + N+      
Sbjct: 291 QTDDILSACSDPRLRKS-MFSATIPSNVEEIAQSIMTDPVRVIIGHKEGANANI------ 343

Query: 348 IKKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXR 407
              D+R   L+Y   E  K+                                       R
Sbjct: 344 ---DQR---LVYCGNEEGKL------------------------------------IAIR 361

Query: 408 RLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAG 467
           R+    E   +   I+F+ +    + +   L   G  V  ++    Q  R + +  F+ G
Sbjct: 362 RMVQEGEF--KPPVIIFLESITRAKALYHELMYDGLNVDVLHAERTQMQRDKIIERFKTG 419

Query: 468 LTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFS 520
               L+ TDV ARG+D   +  V+NY +P +++ ++HR+GRT R   +G A +
Sbjct: 420 DLWCLICTDVLARGIDFKGINLVVNYDVPQTAQAYVHRIGRTGRNNRQGKAVT 472

>Skud_6.72 Chr6 complement(140844..142664) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  157 bits (398), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 124/416 (29%), Positives = 191/416 (45%), Gaps = 75/416 (18%)

Query: 131 FGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKT 190
           F L   +   +   GF   TP+Q  TIP++   +D+V  + TGSGKTAAFV+P++EK+  
Sbjct: 12  FSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVK 71

Query: 191 HSA------KIGVRAVILSPSRELAIQTHRVFKEFSKG--SDLRSI---LLTGGD--SLE 237
             A      K    ++I++P+REL+ Q   V   F +   SDL  +   LL G +  S+ 
Sbjct: 72  EEANTFKFKKAHFHSLIIAPTRELSRQIETVVLSFLEHYPSDLFPVKCQLLVGTNEGSVR 131

Query: 238 DQFGMMMGN-PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLV 296
           D   + + N P +++ TPGR L       +   +   V+ DEADRL +M F + +  +L 
Sbjct: 132 DDVSIFLENRPQILVGTPGRVLDFLQMPAVKTSACSMVILDEADRLLDMSFIKDIERILR 191

Query: 297 AFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREAN 356
             P  R+T LFSAT+ S+  D  K GL NPV + ++++ +   +L++ +  +   E+   
Sbjct: 192 LLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKHQAPSSLKLDYCVVNPLEKLQL 251

Query: 357 LLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMP 416
           L+ +L                                                   N   
Sbjct: 252 LVSIL---------------------------------------------------NNYK 260

Query: 417 SEKATIVFVPTRHHVEY---VTQLLKNCGYLVS-----YIYGALNQHARKQQLYNFRAGL 468
            +K  + F PT   V Y     Q L     L+S      ++G L   AR + L +F   L
Sbjct: 261 FKKCIVYF-PTCVSVSYFYSFIQRLSKKNILISELEVFSLHGKLQTSARTKTLASFTESL 319

Query: 469 -TSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
             S+L  TDVAARG+DIP +  VI    P +S +F+HR GRT RA   G A + ++
Sbjct: 320 NNSVLFTTDVAARGIDIPEVDLVIQLDPPTNSDMFMHRCGRTGRANRIGKAITFLN 375

>KLTH0H15686g Chr8 complement(1353647..1354725,1354841..1355081)
           [1320 bp, 439 aa] {ON} similar to uniprot|Q07478
           Saccharomyces cerevisiae YDL084W SUB2 Suppresses the
           cold-sensitive snRNP biogenesis brr1-1 mutation RNA
           helicase
          Length = 439

 Score =  154 bits (388), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 124/449 (27%), Positives = 202/449 (44%), Gaps = 71/449 (15%)

Query: 92  LELSDDEKKA------TNESDDDLNDYFNTTADAAAK------HKKGSFASFGLSKLVLI 139
           LE SD+E++         E+  D  D   TT +A  K      H  G F  F L   +  
Sbjct: 10  LEYSDNEQEIQVEASKAAEAGADTKDSGETTGEADKKGSYVGIHSTG-FKDFLLKPELSR 68

Query: 140 NISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRA 199
            I   GF  P+ +Q+ TIP  +   D++  A++G GKTA FVL  +++L     ++ V  
Sbjct: 69  AIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVSV-- 126

Query: 200 VILSPSRELAIQTHRVFKEFSK-GSDLRSILLTGGDSLEDQFGMMMGN---PDVVIATPG 255
           V++  +RELA Q    +  FSK   D+++ +  GG  +     ++      P +V+ATPG
Sbjct: 127 VVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPITKDAELLKNKETAPHIVVATPG 186

Query: 256 RFLHLKVEMNLDLKSVEYVVFDEADRLFE-MGFQEQLNELLVAFPTNRQTLLFSATLPSS 314
           R   L  +  +DL SV+  V DE D++ E +G ++ + ++  A P ++Q ++FSATL   
Sbjct: 187 RLKALVRDKIIDLSSVKNFVIDECDKVLEELGMRKDVQDIFRATPRDKQVMMFSATLSQE 246

Query: 315 LVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQ 374
           +    +  L NP+ + +D                  DE +  L  L Q  IK+       
Sbjct: 247 MRPICRRFLQNPLEIFVD------------------DEAKLTLHGLQQYYIKL------- 281

Query: 375 IKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYV 434
             + +++N                        R+L    +       I+FV + +    +
Sbjct: 282 --EEREKN------------------------RKLAQLLDDLEFNQVIIFVKSTNRANEL 315

Query: 435 TQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYS 494
           T+LL    +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   INY 
Sbjct: 316 TKLLNASNFPAITVHGGMKQEERIARYKAFKEFEKRICVSTDVFGRGIDIERINLAINYD 375

Query: 495 LPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           LP  +  ++HRVGR  R G +G A S V+
Sbjct: 376 LPSEADQYLHRVGRAGRFGTKGLAISFVA 404

>YOR046C Chr15 complement(414459..415907) [1449 bp, 482 aa] {ON}
           DBP5Cytoplasmic ATP-dependent RNA helicase of the
           DEAD-box family; involved in mRNA export from the
           nucleus; involved in translation termination; ATP/ADP
           cycling is regulated by Gle1p and Nup159p
          Length = 482

 Score =  154 bits (390), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 116/405 (28%), Positives = 187/405 (46%), Gaps = 66/405 (16%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQK--RDIVGMARTGSGKTAAFVLPM 184
           SF   GL+  +L  I    F++P+ IQ + +PL+L    R+++  +++G+GKTAAF L M
Sbjct: 93  SFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTM 152

Query: 185 IEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMM 244
           + ++    A    +A+ L+PSRELA QT  V +E  K + + S L+   DS E    +  
Sbjct: 153 LTRVNPEDA--SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIV-PDSFEKNKQI-- 207

Query: 245 GNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLVAFPTNRQ 303
            N  V++ TPG  L L     + L+ ++  V DEAD +  + G  +Q   +    P + Q
Sbjct: 208 -NAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQ 266

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQE 363
            +LFSAT   ++  +AK  + N   + L       + ++ L++  K    EA+   +L E
Sbjct: 267 LVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCK---NEADKFDVLTE 323

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
              +     S I                                                
Sbjct: 324 LYGLMTIGSSII------------------------------------------------ 335

Query: 424 FVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVD 483
           FV T+     +   LK+ G+ VS ++G L    R + + +FR G + +L+ T+V ARG+D
Sbjct: 336 FVATKKTANVLYGKLKSEGHEVSILHGDLQTQERDRLIDDFREGRSKVLITTNVLARGID 395

Query: 484 IPLLANVINYSLP------GSSKIFIHRVGRTARAGNRGWAFSIV 522
           IP ++ V+NY LP           +IHR+GRT R G +G A S V
Sbjct: 396 IPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFV 440

>AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR194C
           (MSS116)
          Length = 658

 Score =  157 bits (398), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 123/398 (30%), Positives = 194/398 (48%), Gaps = 71/398 (17%)

Query: 141 ISKKGFRQPTPIQRKTIPLILQ-KRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRA 199
           +  +GF + TP+Q+KT+  ILQ + D+V  A+TG+GKT AF++P+ ++L        V+A
Sbjct: 141 LQSRGFDKLTPVQQKTLKPILQTEHDVVARAKTGTGKTLAFLMPLFQRLLEGPPSENVKA 200

Query: 200 VILSPSRELAIQTHRVFKEFSKGS----DLRSILLTGGDSLEDQF-GMMMGNPDVVIATP 254
           V+++P+R+LA Q      E    +       ++++ GG S  + F  +    P++V+ATP
Sbjct: 201 VVIAPTRDLAAQIFNEINEMRNANRKLRRFNAVVMMGGSSRTETFRSLERRRPNIVVATP 260

Query: 255 GRFLHLKVEMNLD-LKSVEYVVFDEADRLFEMGFQ---EQLNELLVAF----PTNRQTLL 306
           GR + +           V++ V DEAD L E+GF+   EQ+N++L        T+ +TLL
Sbjct: 261 GRLIDMLEACGPKYFTEVDFKVLDEADTLLEIGFKQALEQINDILNQLNQKGTTHIRTLL 320

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDA----ETKISENLEMLFISIK--KDEREANLLYL 360
            SATL   +   A + +++   + +D     E   +EN+    +  K   D   A+L  +
Sbjct: 321 VSATLDDKVQSLANSIMNHAKCLFIDTVDPNEQATNENIAQKVVISKDFADNITASLYKI 380

Query: 361 LQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKA 420
            +EA   P        KLK                                         
Sbjct: 381 REEASANP--------KLK----------------------------------------- 391

Query: 421 TIVFVPTRHHVEYVTQLLKN-C-GYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVA 478
            IVF+PT   VEY  +LL++ C G  V   +G L+Q  R   +  FRA  + ILV TDVA
Sbjct: 392 AIVFMPTIVAVEYWGELLQSQCRGTPVLLFHGGLSQGRRNSTMKRFRAMDSGILVCTDVA 451

Query: 479 ARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRG 516
           ARG+D+  + +V    +P S   +IHR+GRT RAG +G
Sbjct: 452 ARGMDVSDVQHVYQVGVPTSPDNYIHRIGRTGRAGRKG 489

>Ecym_7324 Chr7 complement(689228..691021) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii AGL004C
          Length = 597

 Score =  156 bits (395), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 115/408 (28%), Positives = 191/408 (46%), Gaps = 59/408 (14%)

Query: 131 FGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKT 190
           + L   + + +   GF   TP+Q  TIPL    +D+V  + TGSGKT AFV+P++EK+  
Sbjct: 12  YELQPWIKLAVEAMGFEAMTPVQASTIPLFAGNKDVVVESVTGSGKTVAFVIPILEKIIK 71

Query: 191 HSA------KIGVRAVILSPSRELAIQTHRVFKEF-----SKGSDLRSILLTGGDSL--- 236
             A      K    ++I+SP+RELA Q   V + F          +RS ++ G + +   
Sbjct: 72  DGANSAAFRKGHFHSLIVSPTRELASQIQLVVQSFLNYYPDNCYPIRSQIIVGTNQVTVR 131

Query: 237 EDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLV 296
           +D    M   P ++I TPGR L     + +   S   VV DEAD+L +  F + ++ +L 
Sbjct: 132 DDVAEFMQNRPQILIGTPGRLLDFLKMVGVKTTSCGIVVLDEADKLLDYNFGKDVDNILK 191

Query: 297 AFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREAN 356
             P  R+T LFSAT+ S+  +  K G+ NPV + + +  K  ++L+M ++ ++ +++   
Sbjct: 192 FLPKQRRTGLFSATISSAGDEVFKTGMRNPVKISVKSHKKAPQSLKMNYVVVEPEKKFEL 251

Query: 357 LLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMP 416
           LL +L            + KK                                     +P
Sbjct: 252 LLSILNYY---------RFKKC---------------------------------IVYLP 269

Query: 417 SEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLT-SILVVT 475
           +  +   F     H+  + Q+ ++    +  ++G L   +R + L  F   L  S+L+ T
Sbjct: 270 TCISVTYFYAIIQHLTKLGQMDEDLK--IYSLHGKLQTTSRMKTLEKFTQDLNKSVLLTT 327

Query: 476 DVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           DVAARG+DIP +  V+    P  + IF+HR GRT RA   G A  +++
Sbjct: 328 DVAARGIDIPNIDLVLQMDPPTDTDIFLHRCGRTGRANRVGKAIVLLN 375

>KLLA0A05731g Chr1 (536243..537433) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P10081 Saccharomyces cerevisiae
           YKR059W TIF1 translation initiation factor eIF4A
          Length = 396

 Score =  152 bits (384), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 97/379 (25%), Positives = 178/379 (46%), Gaps = 55/379 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           SF    L + +L  I   GF +P+ IQ++ I  I++ +D++  A++G+GKT  F    I 
Sbjct: 23  SFDDLKLKEELLRGIFGYGFVEPSAIQQRAILPIIEGKDVLAQAQSGTGKTGTF---SIA 79

Query: 187 KLKTHSAKIGV-RAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMG 245
            L+    KI   + +IL+P+RELA+Q  +V    +   D++     GG SL++    + G
Sbjct: 80  ALQNIDEKIKAPQGLILAPTRELALQIQKVVMALAIHMDVKVHACIGGTSLQEDSEALRG 139

Query: 246 NPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTL 305
              +++ TPGR   +         +++  + DEAD +   GF+EQ+  +    P   Q +
Sbjct: 140 GAQIIVGTPGRVFDMIDRRIFKTDNIKMFILDEADEMLSTGFKEQIYNIFTMLPPTSQVV 199

Query: 306 LFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAI 365
           L SAT+P  +++     + +PV + +  +    E +   ++++++++ + + L  L ++I
Sbjct: 200 LLSATMPGDVLEVTSKFMKDPVRILVKKDELTLEGIGQYYVNVEEEQYKYDCLTDLYDSI 259

Query: 366 KMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFV 425
            +  A                                                   ++F 
Sbjct: 260 SVTQA---------------------------------------------------VIFC 268

Query: 426 PTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIP 485
            TR  VE +T+ L+   + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+ 
Sbjct: 269 NTRRKVEELTERLRENNFTVSAIYSDLQQQERDTIMKEFRSGSSRILISTDLLARGIDVQ 328

Query: 486 LLANVINYSLPGSSKIFIH 504
            ++ VINY LP + + +IH
Sbjct: 329 QVSLVINYDLPSNKENYIH 347

>ACR253C Chr3 complement(802236..803426) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL138C
           (TIF2) and YKR059W (TIF1)
          Length = 396

 Score =  152 bits (383), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 109/397 (27%), Positives = 191/397 (48%), Gaps = 55/397 (13%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    L +++L  I   GF  P+ IQ++ I  I++  D++  A++G+GKT  F +  +++
Sbjct: 24  FDELKLKEVLLRGIYGYGFVDPSAIQQRAILPIIEGHDVLAQAQSGTGKTGTFSIAALQR 83

Query: 188 LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGG-DSLEDQFGMMMGN 246
           +   S K   +A+IL+P+RELA+Q  +V    +   D++     GG D  ED   +  G 
Sbjct: 84  ID-ESIK-APQALILAPTRELALQIQKVVMALALHMDVKVHACIGGTDPREDAEALRAG- 140

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLL 306
             +V+ TPGR   +    N     ++  + DEAD +   GF+EQ+ ++    P   Q +L
Sbjct: 141 AQIVVGTPGRVFDMIERRNFKTDHIKMFILDEADEMLSSGFKEQIYKIFTMLPPTTQVVL 200

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIK 366
            SAT+P  ++D     ++ PV + +  +    E ++  +I+++ +E + + L  L ++I 
Sbjct: 201 LSATMPKEVLDVTDKFMNKPVRILVKKDALTLEGIQQYYINVESEEYKYDCLSDLYDSIS 260

Query: 367 MPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVP 426
           +  A                                                   ++F  
Sbjct: 261 VTQA---------------------------------------------------VIFCN 269

Query: 427 TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPL 486
           TR  VE +T+ L +  + VS IY  L Q  R   +  FR G + IL+ TD+ ARG+D+  
Sbjct: 270 TRRKVEELTKRLTDDSFTVSAIYSDLPQAQRDTIMKEFRTGSSRILISTDLLARGIDVQQ 329

Query: 487 LANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           ++ VINY LP + + +IHR+GR  R G +G A ++V+
Sbjct: 330 VSLVINYDLPNNKENYIHRIGRGGRFGRKGVAINLVT 366

>NCAS0J00580 Chr10 (87108..88943) [1836 bp, 611 aa] {ON} Anc_8.87
          Length = 611

 Score =  156 bits (394), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 119/406 (29%), Positives = 187/406 (46%), Gaps = 75/406 (18%)

Query: 141 ISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSA------K 194
           I   GF Q TP+Q  TIPL  + +D+V  + TGSGKT +FV+P++EK+   +A      K
Sbjct: 22  IEVMGFDQMTPVQASTIPLFAKNKDVVVESVTGSGKTVSFVIPILEKVIAENANTKNFKK 81

Query: 195 IGVRAVILSPSRELAIQTHRVFKEF-----SKGSDLRSILLTGGD--SLEDQFGMMMGN- 246
                +I+SP+REL+ Q   V  +F          +R+ LL G +  ++ D    ++ N 
Sbjct: 82  AHFHTLIVSPTRELSKQIKSVIDQFLEHYPEDQYPIRAQLLVGTNESTVRDDVNDLIENR 141

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLL 306
           P +++ TPGR L       +   S   V+ DEADRL ++ F + +  +L   P  R+T L
Sbjct: 142 PQILVGTPGRILDFLQMPVVKTTSCSMVILDEADRLLDVSFVKDVERILSVLPKQRRTGL 201

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIK 366
           FSAT+ S+     K GL NPV + ++++     +L++ +I +  + +   LL ++     
Sbjct: 202 FSATISSAGNTIFKTGLRNPVKITVNSKNHAPSSLKLNYIVVDPELKFQQLLSIV----- 256

Query: 367 MPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVP 426
                                                         N    +K  + F P
Sbjct: 257 ----------------------------------------------NNYRYKKCIVYF-P 269

Query: 427 TRHHVEY---VTQLLKNCGYL-----VSYIYGALNQHARKQQLYNFRAGL-TSILVVTDV 477
           T   V Y     Q L++ G +     +  ++G L   +R + L  F   L  S+L+ TDV
Sbjct: 270 TCISVTYFYSFIQFLQSKGIINENLSIFSLHGKLQTVSRMKTLEKFTETLDNSVLLTTDV 329

Query: 478 AARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           AARG+DIP +  VI    P  S IF+HR GRT RA   G A + ++
Sbjct: 330 AARGIDIPDVDLVIQLDPPTDSDIFLHRCGRTGRANRIGKAITFLN 375

>Smik_6.81 Chr6 complement(152467..154287) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  156 bits (394), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 122/416 (29%), Positives = 188/416 (45%), Gaps = 75/416 (18%)

Query: 131 FGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKT 190
           F L   +   +   GF   TP+Q  TIP++   +D+V  + TGSGKTAAFV+P++EK+  
Sbjct: 12  FSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVK 71

Query: 191 HSA------KIGVRAVILSPSRELAIQTHRVFKEFSKG--SDL---RSILLTGGDSL--- 236
             A      K    ++I++P+REL+ Q   V   F +   SDL   R  LL G +     
Sbjct: 72  EEANSSKFKKAQFHSLIVAPTRELSRQIESVVLSFLEHYPSDLFPIRCQLLIGTNEATVR 131

Query: 237 EDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLV 296
           +D    +   P ++I TPGR L       +   +   VV DEADRL ++ F + +  +L 
Sbjct: 132 DDVSDFLRNRPQILIGTPGRVLDFLQMPAVKTSACSMVVLDEADRLLDVSFIKDIERILR 191

Query: 297 AFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREAN 356
             P  R+T LFSAT+ S+  D  K GL NPV + ++++ +   +L+M +  +   E+   
Sbjct: 192 LLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKMNYCVVNPVEKLQL 251

Query: 357 LLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMP 416
           L+ +L                                                   N   
Sbjct: 252 LVSIL---------------------------------------------------NNYK 260

Query: 417 SEKATIVFVPTRHHVEYVTQLLKNCG--------YLVSYIYGALNQHARKQQLYNFRAGL 468
            +K+ + F PT   V Y    +++            V  ++G L   AR + L  F   L
Sbjct: 261 FKKSIVYF-PTCVSVSYFYSFVQHLAKRKTLINEVEVFSLHGKLQTSARTKTLAAFTNSL 319

Query: 469 T-SILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           + S+L  TDVAARG+DIP +  VI    P +S +F+HR GRT RA   G A + ++
Sbjct: 320 SNSVLFTTDVAARGIDIPQVDLVIQLDPPTNSDMFMHRCGRTGRANRVGKAITFLN 375

>YFL002C Chr6 complement(145114..146934) [1821 bp, 606 aa] {ON}
           SPB4Putative ATP-dependent RNA helicase, nucleolar
           protein required for synthesis of 60S ribosomal subunits
           at a late step in the pathway; sediments with 66S
           pre-ribosomes in sucrose gradients
          Length = 606

 Score =  155 bits (393), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 123/416 (29%), Positives = 189/416 (45%), Gaps = 75/416 (18%)

Query: 131 FGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKT 190
           F L   +   +   GF   TP+Q  TIP++   +D+V  + TGSGKTAAFV+P++EK+  
Sbjct: 12  FSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPVLEKVVK 71

Query: 191 HSA------KIGVRAVILSPSRELAIQTHRVFKEFSKG--SDLRSI---LLTGGDSL--- 236
             A      K    ++I++P+REL+ Q   V   F +   SDL  I   LL G +     
Sbjct: 72  EEANTSKFKKAHFHSLIIAPTRELSRQIESVVLSFLEHYPSDLFPIKCQLLVGTNEATVR 131

Query: 237 EDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLV 296
           +D    +   P ++I TPGR L       +   +   VV DEADRL +M F +   ++L 
Sbjct: 132 DDVSNFLRNRPQILIGTPGRVLDFLQMPAVKTSACSMVVMDEADRLLDMSFIKDTEKILR 191

Query: 297 AFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREAN 356
             P  R+T LFSAT+ S+  D  K GL NPV + ++++ +   +L++ +  +   E+   
Sbjct: 192 LLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKLNYCVVNPAEKLQL 251

Query: 357 LLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMP 416
           L+ +L                                                   N   
Sbjct: 252 LVSIL---------------------------------------------------NNYK 260

Query: 417 SEKATIVFVPTRHHVEYVTQLLKNCG---YLVSYI-----YGALNQHARKQQLYNFRAGL 468
            +K  + F PT   V Y    ++  G    LV+ +     +G L   AR + L  F   L
Sbjct: 261 FKKCIVYF-PTCVSVSYFYSFIQYLGKRNILVNEVEIFSLHGKLQTSARTKTLTAFTDSL 319

Query: 469 T-SILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           + S+L  TDVAARG+DIP +  VI    P ++ +F+HR GRT RA   G A + ++
Sbjct: 320 SNSVLFTTDVAARGIDIPDVDLVIQLDPPTNTDMFMHRCGRTGRANRVGKAITFLN 375

>KAFR0G00650 Chr7 complement(164087..165274) [1188 bp, 395 aa] {ON}
           Anc_1.211 YJL138C
          Length = 395

 Score =  150 bits (380), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 100/379 (26%), Positives = 181/379 (47%), Gaps = 56/379 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F    L + +L  +   GF  P+ IQ++ I  I++  D++  A++G+GKT  F +  ++
Sbjct: 23  TFDDMNLDEKLLRGVYGYGFENPSAIQQRAIMPIIESHDVLAQAQSGTGKTGTFSIAALQ 82

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDS-LEDQFGMMMG 245
           ++ T S K   +A++L+P+RELA+Q  +V    S   D++     GG S +ED  G+   
Sbjct: 83  RIDT-SIK-APQALMLAPTRELALQIQKVVMALSFHMDVKVHACIGGTSFVEDAEGLR-- 138

Query: 246 NPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTL 305
           +  +V+ TPGR             +++  + DEAD +   GF+EQ+ ++    P   Q +
Sbjct: 139 DAQIVVGTPGRVFDNIQRRKFKTDNIKMFILDEADEMLSSGFKEQIYQIFTMLPPTTQVV 198

Query: 306 LFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAI 365
           L SAT+PS +++     + NPV + +  +    E ++  ++++++++ +   L  L ++I
Sbjct: 199 LLSATMPSDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEQYKYECLTDLYDSI 258

Query: 366 KMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFV 425
            +  A                                                   ++F 
Sbjct: 259 SVTQA---------------------------------------------------VIFC 267

Query: 426 PTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIP 485
            TR  VE +TQ L    + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+ 
Sbjct: 268 NTRRKVEELTQKLTADNFTVSSIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQ 327

Query: 486 LLANVINYSLPGSSKIFIH 504
            ++ VINY LP + + +IH
Sbjct: 328 QVSLVINYDLPTNKENYIH 346

>KLLA0E21935g Chr5 (1959770..1961083) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|Q07478 Saccharomyces cerevisiae
           YDL084W SUB2 Suppresses the cold-sensitive snRNP
           biogenesis brr1-1 mutation RNA helicase
          Length = 437

 Score =  151 bits (382), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 120/446 (26%), Positives = 201/446 (45%), Gaps = 67/446 (15%)

Query: 92  LELSDDEKKA-TNESDDDLNDYFNTTADAAAKHKKGSFA---SFGLSKLVLI-----NIS 142
           LE SD+E++   +    ++N   N  + A    KKGS+    S G    +L       I 
Sbjct: 10  LEYSDNEQEVQVDNKATEVNAEGNGESQAKDSDKKGSYVGIHSTGFKDFLLKPELSRAII 69

Query: 143 KKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVIL 202
             GF  P+ +Q+ TIP  +   D++  A++G GKTA FVL  +++L     ++ V  V+L
Sbjct: 70  DCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVQGEVSV--VVL 127

Query: 203 SPSRELAIQTHRVFKEFSK-GSDLRSILLTGGDSLEDQFGMMMGN---PDVVIATPGRFL 258
             +RELA Q    +  FSK   D+++ +  GG   ++   ++      P +++ATPGR  
Sbjct: 128 CNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTEYKNDIDLLSKKETVPHIIVATPGRLK 187

Query: 259 HLKVEMNLDLKSVEYVVFDEADRLFE-MGFQEQLNELLVAFPTNRQTLLFSATLPSSLVD 317
            L  + ++DL  V+  V DE D++ E +  +  + ++  A P ++Q ++FSATL   +  
Sbjct: 188 ALVRDKHIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRATPRDKQVMMFSATLSQEIRP 247

Query: 318 FAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKK 377
             +  L NP+ + +D                  DE +  L  L Q  IK+          
Sbjct: 248 ICRRFLQNPLEIFVD------------------DEAKLTLHGLQQYYIKL---------N 280

Query: 378 LKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQL 437
            K++N                        R+L    +       I+FV +      +T+L
Sbjct: 281 EKEKN------------------------RKLAQLLDDLEFNQVIIFVKSTVRANELTKL 316

Query: 438 LKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPG 497
           L    +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   INY +P 
Sbjct: 317 LNASNFPAITVHGHMKQEERIARYKAFKEFEKRICVSTDVFGRGIDIERINLAINYDMPN 376

Query: 498 SSKIFIHRVGRTARAGNRGWAFSIVS 523
            +  ++HRVGR  R G +G A S++S
Sbjct: 377 EADQYLHRVGRAGRFGTKGLAISMIS 402

>ZYRO0F04312g Chr6 complement(366863..368671) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P25808 Saccharomyces
           cerevisiae YFL002C SPB4 involved in the maturation of
           25S ribosomal RNA ATP-dependent RNA helicase
          Length = 602

 Score =  154 bits (390), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 122/406 (30%), Positives = 188/406 (46%), Gaps = 82/406 (20%)

Query: 145 GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSA------KIGVR 198
           GF   TP+Q  TIP+  + +D+V  + TGSGKT AFV+P++EK+    A      K    
Sbjct: 26  GFDTMTPVQTSTIPMFARNKDVVVESVTGSGKTVAFVIPILEKIIAEEANTPNLKKGHFH 85

Query: 199 AVILSPSRELAIQTHRVFKEFSKG-----SDLRSILLTGGD--SLEDQFGMMMGN-PDVV 250
           ++I++P+REL+ Q   V + F +        +RS LL G +  S+ D     + N P ++
Sbjct: 86  SLIVTPTRELSNQIQSVIQSFLEHYPDDEHPIRSQLLVGTNQSSVRDDLANFLQNRPQIL 145

Query: 251 IATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSAT 310
           + TPGR L       +  KS   +V DEADRL ++ F   + ++L   P  R+T LFSAT
Sbjct: 146 VGTPGRVLDFLQMSAVQTKSCSVLVLDEADRLLDLSFFGDIEKILKTLPKQRRTGLFSAT 205

Query: 311 LPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVA 370
           + S+     K GL NPV + + ++TK   +L               L Y + E       
Sbjct: 206 IGSAGSQIFKTGLRNPVKITVSSKTKAPTSL--------------GLFYTVIEP------ 245

Query: 371 TESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHH 430
            E++I++L                              L   N    +K  IV+ PT   
Sbjct: 246 -EAKIQQL------------------------------LSIMNNYKFKKC-IVYFPTCIS 273

Query: 431 VEYVTQLLKNCGYL----------VSY--IYGALNQHARKQQLYNFRAGL-TSILVVTDV 477
           V Y    ++   YL          V +  ++G L   +R++ L +F      ++L  TDV
Sbjct: 274 VTYFYSFMQ---YLQRDKKLLDEEVEFFSLHGKLQTSSRQKTLDSFGKSFGKAVLFTTDV 330

Query: 478 AARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           AARG+DIP +  VI    P  + +F+HR GRT RA   G A + ++
Sbjct: 331 AARGIDIPDVDLVIQLDPPSDTTMFLHRCGRTGRANKEGRAITFLN 376

>YJL138C Chr10 complement(153504..154691) [1188 bp, 395 aa] {ON}
           TIF2Translation initiation factor eIF4A, identical to
           Tif1p; DEA(D/H)-box RNA helicase that couples ATPase
           activity to RNA binding and unwinding; forms a dumbbell
           structure of two compact domains connected by a linker;
           interacts with eIF4G
          Length = 395

 Score =  149 bits (377), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 99/378 (26%), Positives = 181/378 (47%), Gaps = 56/378 (14%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    L + +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  +++
Sbjct: 24  FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQR 83

Query: 188 LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDS-LEDQFGMMMGN 246
           + T S K   +A++L+P+RELA+Q  +V    +   D++     GG S +ED  G+   +
Sbjct: 84  IDT-SVK-APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLR--D 139

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLL 306
             +V+ TPGR              ++  + DEAD +   GF+EQ+ ++    P   Q +L
Sbjct: 140 AQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVL 199

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIK 366
            SAT+P+ +++     + NPV + +  +    E ++  +++++++E +   L  L ++I 
Sbjct: 200 LSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSIS 259

Query: 367 MPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVP 426
           +  A                                                   ++F  
Sbjct: 260 VTQA---------------------------------------------------VIFCN 268

Query: 427 TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPL 486
           TR  VE +T  L+N  + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  
Sbjct: 269 TRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQ 328

Query: 487 LANVINYSLPGSSKIFIH 504
           ++ VINY LP + + +IH
Sbjct: 329 VSLVINYDLPANKENYIH 346

>YKR059W Chr11 (554987..556174) [1188 bp, 395 aa] {ON}
           TIF1Translation initiation factor eIF4A, identical to
           Tif2p; DEA(D/H)-box RNA helicase that couples ATPase
           activity to RNA binding and unwinding; forms a dumbbell
           structure of two compact domains connected by a linker;
           interacts with eIF4G
          Length = 395

 Score =  149 bits (377), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 99/378 (26%), Positives = 181/378 (47%), Gaps = 56/378 (14%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    L + +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  +++
Sbjct: 24  FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQR 83

Query: 188 LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDS-LEDQFGMMMGN 246
           + T S K   +A++L+P+RELA+Q  +V    +   D++     GG S +ED  G+   +
Sbjct: 84  IDT-SVK-APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLR--D 139

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLL 306
             +V+ TPGR              ++  + DEAD +   GF+EQ+ ++    P   Q +L
Sbjct: 140 AQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVL 199

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIK 366
            SAT+P+ +++     + NPV + +  +    E ++  +++++++E +   L  L ++I 
Sbjct: 200 LSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDLYDSIS 259

Query: 367 MPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVP 426
           +  A                                                   ++F  
Sbjct: 260 VTQA---------------------------------------------------VIFCN 268

Query: 427 TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPL 486
           TR  VE +T  L+N  + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  
Sbjct: 269 TRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQ 328

Query: 487 LANVINYSLPGSSKIFIH 504
           ++ VINY LP + + +IH
Sbjct: 329 VSLVINYDLPANKENYIH 346

>Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON}
           (185153..186607) [1455 nt, 485 aa]
          Length = 484

 Score =  151 bits (381), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 122/208 (58%), Gaps = 2/208 (0%)

Query: 124 KKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLP 183
           K  +F  F L + +L+ I + GF +P+PIQ ++IP+ L  RDI+  A+ G+GKTAAFV+P
Sbjct: 32  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEESIPVALAGRDILARAKNGTGKTAAFVIP 91

Query: 184 MIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            +EK+K+   KI  +A+I+ P+RELA+QT +V +   K   +  ++ TGG +L D    +
Sbjct: 92  TLEKVKSKHNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 149

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
                +++ TPGR L L      DL      + DEAD++    F+  + ++LV  P N Q
Sbjct: 150 NETVHILVGTPGRVLDLASRKVADLSECNLFIMDEADKMLSRDFKSIIEQILVFLPKNHQ 209

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRL 331
           +LLFSAT P S+ +F    L  P  + L
Sbjct: 210 SLLFSATFPLSVKEFMVNHLHKPYEINL 237

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 59/102 (57%)

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           I+F  + + VE + + + + GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 275 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 334

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 335 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 376

>SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {ON}
           highly similar to uniprot|P39517 Saccharomyces
           cerevisiae YDL160C DHH1 Cytoplasmic DExD/H-box helicase
           stimulates mRNA decapping coordinates distinct steps in
           mRNA function and decay interacts with both the
           decapping and deadenylase complexes may have a role in
           mRNA export and translation
          Length = 497

 Score =  151 bits (382), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 123/215 (57%), Gaps = 2/215 (0%)

Query: 117 ADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGK 176
            D     K  +F  F L + +L+ I + GF +P+PIQ + IP+ L  RDI+  A+ G+GK
Sbjct: 20  TDDVLSTKGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPIALAGRDILARAKNGTGK 79

Query: 177 TAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSL 236
           TAAFV+P +EK+K    KI  +A+IL P+RELA+QT +V +   K   +  ++ TGG +L
Sbjct: 80  TAAFVIPTLEKIKPKVNKI--QALILVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNL 137

Query: 237 EDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLV 296
            D    +     V++ TPGR L L      DL      V DEAD++    F+  + ++L 
Sbjct: 138 RDDIMRLHEPVHVLVGTPGRVLDLASRKVADLSECPLFVMDEADKMLSRDFKSIIEQILS 197

Query: 297 AFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRL 331
            FP +RQ+LLFSAT P ++ +F    L+ P  + L
Sbjct: 198 FFPQSRQSLLFSATFPLTVKEFMVNHLNKPYEINL 232

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 59/102 (57%)

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           I+F  + + VE + + + + GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 371

>TDEL0H00930 Chr8 complement(152864..154051) [1188 bp, 395 aa] {ON}
           Anc_1.211 YJL138C
          Length = 395

 Score =  148 bits (374), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 101/378 (26%), Positives = 177/378 (46%), Gaps = 56/378 (14%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    L   +L  +   GF  P+ IQ++ I  I++  D++  A++G+GKT  F +  +++
Sbjct: 24  FDDMNLKNELLRGVFGYGFEDPSAIQQRAILPIIEGHDVLAQAQSGTGKTGTFSIAALQR 83

Query: 188 LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSL-EDQFGMMMGN 246
           +   SA    +A+IL+P+RELA+Q  +V    +   D++     GG S  ED  G+   +
Sbjct: 84  ID--SALKSPQALILAPTRELALQIQKVVIALAFHMDIKVHACIGGTSFQEDAEGLR--D 139

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLL 306
             +V+ TPGR             S++  + DEAD +   GF+EQ+ ++    P   Q +L
Sbjct: 140 AQIVVGTPGRVFDNIQRRKFKTDSIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVL 199

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIK 366
            SAT+P  +++     + NPV + +  +    E ++  +I+++++  + + L  L ++I 
Sbjct: 200 LSATMPKDVLEVTTKFMRNPVRILVKKDELTLEGIQQFYINVEQELYKYDCLTDLYDSIS 259

Query: 367 MPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVP 426
           +  A                                                   ++F  
Sbjct: 260 VTQA---------------------------------------------------VIFCN 268

Query: 427 TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPL 486
           TR  VE +TQ LK   + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  
Sbjct: 269 TRRKVEELTQKLKADNFTVSSIYSDLPQQERDIIMKEFRSGSSRILISTDLLARGIDVQQ 328

Query: 487 LANVINYSLPGSSKIFIH 504
           ++ VINY LP + + +IH
Sbjct: 329 VSLVINYDLPTNKENYIH 346

>TPHA0D00940 Chr4 complement(186966..188678) [1713 bp, 570 aa] {ON}
           Anc_8.124 YGL171W
          Length = 570

 Score =  152 bits (383), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 126/459 (27%), Positives = 217/459 (47%), Gaps = 90/459 (19%)

Query: 96  DDEKKATNESDDDLNDYFN-TTADAAAKHKK---------------GSF----ASFGLSK 135
           +DEKK   E++ + ++    TT + A   +K               GSF    + F   K
Sbjct: 74  EDEKKVVTETELNFDETLKITTKEEALALRKSYKGNITGSDVPLPIGSFEDLISRFSFDK 133

Query: 136 LVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKI 195
            +L N+ +  F +PTP+Q + IPL L  RD++  A TGSGKT AF++P+++++     +I
Sbjct: 134 RLLRNLLENHFTEPTPVQSECIPLALHTRDMLACAPTGSGKTLAFLIPLLQQVIEQKEEI 193

Query: 196 GVRAVILSPSRELAIQTHRVFKEFSKGSDL--------RSILLTGGDSLEDQFGMMMGNP 247
           G++ +I+SP++ELA Q   +F E +K ++           I L            ++ + 
Sbjct: 194 GLKGLIISPTKELADQ---IFLECTKLANRLYLDKKRPLQIALLSKSLSSKLKNKVISDK 250

Query: 248 --DVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL--VAFPTNRQ 303
             D++I+TP R + +     LDL +V++++FDEAD+LF+  F EQ +++L   + P+ R+
Sbjct: 251 KYDIIISTPLRLIDVVKNEALDLSTVKHLIFDEADKLFDKTFVEQTDDILNSCSDPSLRK 310

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQE 363
             +FSAT+PS++ + A+  + +P+ V +  +   + N+E              L++   E
Sbjct: 311 A-MFSATIPSNVEEIAQTIMMDPIRVIIGHKEAANANIEQ------------KLIFCGNE 357

Query: 364 AIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIV 423
             K+       IK+L QQ                          R P           I+
Sbjct: 358 EGKLIA-----IKQLVQQGEF-----------------------RPP----------VII 379

Query: 424 FVP--TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           F+   TR    Y   +  N    V  I+       R + +  F+ G    L+ TDV ARG
Sbjct: 380 FLESITRAKALYHELMYDNLN--VDVIHAERTPIQRNKIIEKFKTGELWCLITTDVLARG 437

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFS 520
           +D   +  VINY +P +++ ++HR+GRT R    G A +
Sbjct: 438 IDFKGVNLVINYDVPRTAQAYVHRIGRTGRGNRSGKAVT 476

>Kpol_1060.58 s1060 complement(135570..136760) [1191 bp, 396 aa]
           {ON} complement(135570..136760) [1191 nt, 397 aa]
          Length = 396

 Score =  148 bits (374), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 98/378 (25%), Positives = 180/378 (47%), Gaps = 56/378 (14%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    L   +L  +   GF +P+ IQ++ I  I+++ D++  A++G+GKT  F +  +++
Sbjct: 25  FDDMNLKDELLKGVYGYGFEEPSAIQQRAILPIVEEHDVLAQAQSGTGKTGTFSIAALQR 84

Query: 188 LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDS-LEDQFGMMMGN 246
           +   S+    +A+IL+P+RELA+Q  +V    +   D++     GG S +ED  G+   +
Sbjct: 85  ID--SSIKAPQALILAPTRELALQIQKVVIALAFHMDVKVHACIGGTSFVEDTEGL--KD 140

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLL 306
             +V+ TPGR             +++  + DEAD +   GF+EQ+ ++    P   Q +L
Sbjct: 141 AQIVVGTPGRVSDNIQRHRFKTDNIKMFILDEADEMLSSGFREQIYQIFTMLPPTTQVVL 200

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIK 366
            SATLP  +++     + NP+ + +  +    E ++  +I++++++ + + L  L ++I 
Sbjct: 201 LSATLPGDVLEVTTKFMRNPIRILVKKDELTLEGIKQFYINVEEEQYKFDCLSDLYDSIS 260

Query: 367 MPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVP 426
           +  A                                                   ++F  
Sbjct: 261 VTQA---------------------------------------------------VIFCN 269

Query: 427 TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPL 486
           TR  VE +TQ L    + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  
Sbjct: 270 TRRKVEELTQKLTESNFTVSSIYSDLPQQERDVIMKEFRSGSSRILISTDLLARGIDVQQ 329

Query: 487 LANVINYSLPGSSKIFIH 504
           ++ VINY LP + + +IH
Sbjct: 330 VSLVINYDLPTNKENYIH 347

>ADR260C Chr4 complement(1152257..1153573) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL084W
           (SUB2)
          Length = 438

 Score =  149 bits (376), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 121/447 (27%), Positives = 198/447 (44%), Gaps = 68/447 (15%)

Query: 92  LELSDDEK--KATNESDDDLNDYFNTTADAAAKHKKGSFA---SFGLSKLVLI-----NI 141
           LE SD+E+  +  N    ++       AD     KKGS+    S G    +L       I
Sbjct: 10  LEYSDNEQEIQVDNTKATEVAGNGEEAADGKDGDKKGSYVGIHSTGFKDFLLKPELSRAI 69

Query: 142 SKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVI 201
              GF  P+ +Q+ TIP  +   D++  A++G GKTA FVL  +++L     ++ V  V+
Sbjct: 70  IDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVSV--VV 127

Query: 202 LSPSRELAIQTHRVFKEFSK-GSDLRSILLTGGDSLEDQFGMMMGN---PDVVIATPGRF 257
           L  +RELA Q    +  FSK   D+++ +  GG        ++      P +V+ATPGR 
Sbjct: 128 LCNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTDTRKDIELLKNKDTAPHIVVATPGRL 187

Query: 258 LHLKVEMNLDLKSVEYVVFDEADRLFE-MGFQEQLNELLVAFPTNRQTLLFSATLPSSLV 316
             L  + N+DL  V+  V DE D++ E +  +  + ++  A P ++Q ++FSATL   + 
Sbjct: 188 KALVRDNNIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRATPRDKQVMMFSATLSQEIR 247

Query: 317 DFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIK 376
              +  L NP+ + +D                  DE +  L  L Q  I++         
Sbjct: 248 PICRRFLQNPLEIFVD------------------DEAKLTLHGLQQYYIRL--------- 280

Query: 377 KLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQ 436
           + +++N                        R+L    +       I+FV +      +T+
Sbjct: 281 EEREKN------------------------RKLAQLLDDLEFNQVIIFVKSTLRANELTK 316

Query: 437 LLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLP 496
           LL    +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   INY +P
Sbjct: 317 LLNASNFPAITVHGHMRQEERIARYKAFKEFEKRICVSTDVFGRGIDIERINLAINYDMP 376

Query: 497 GSSKIFIHRVGRTARAGNRGWAFSIVS 523
             +  ++HRVGR  R G +G A S+VS
Sbjct: 377 SEADQYLHRVGRAGRFGTKGLAISLVS 403

>NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON}
           Anc_7.336
          Length = 510

 Score =  150 bits (380), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 78/215 (36%), Positives = 125/215 (58%), Gaps = 2/215 (0%)

Query: 117 ADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGK 176
            D     K  +F  F L + +L+ I + GF +P+PIQ ++IP+ +  RDI+  A+ G+GK
Sbjct: 34  TDDVLNTKGNTFEDFYLKRELLMGIFEAGFEKPSPIQEESIPIAITGRDILARAKNGTGK 93

Query: 177 TAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSL 236
           TAAFV+P +EK+K    KI  +A+I+ P+RELA+QT +V +   K   +  ++ TGG +L
Sbjct: 94  TAAFVIPTLEKIKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNL 151

Query: 237 EDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLV 296
            D    +  +  V++ TPGR L L      DL   +  + DEAD++    F+  + ++L+
Sbjct: 152 RDDILRLNESVHVLVGTPGRVLDLASRKVADLSDCQLFIMDEADKMLSRDFKTIIEQILI 211

Query: 297 AFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRL 331
             P   Q+LLFSAT P ++ +F    L+NP  + L
Sbjct: 212 FLPKKHQSLLFSATFPLTVKEFMVKHLTNPYEINL 246

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 59/102 (57%)

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           I+F  + + VE + + + + GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 284 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 343

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +DI  +  VIN+  P +S+ ++HR+GR+ R G+ G A ++++
Sbjct: 344 IDIQAVNVVINFDFPKTSETYLHRIGRSGRFGHLGLAINLIN 385

>ZYRO0B05852g Chr2 (468295..470550) [2256 bp, 751 aa] {ON} similar
           to uniprot|P38112 Saccharomyces cerevisiae YBR142W MAK5
           Essential nucleolar protein putative DEAD-box RNA
           helicase required for maintenance of M1 dsRNA virus
           involved in biogenesis of large (60S) ribosomal subunits
          Length = 751

 Score =  154 bits (389), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 132/425 (31%), Positives = 203/425 (47%), Gaps = 71/425 (16%)

Query: 133 LSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKL---K 189
           LS  VL  +S++GF +PT IQ++ +PL L+  DI+G A TGSGKT A+ +P++E L    
Sbjct: 192 LSFTVLNGLSQQGFTKPTDIQKEVLPLALKNEDIMGKAATGSGKTLAYGIPLLESLVHEP 251

Query: 190 THSAKIGVRAVILSPSRELAIQTHRVFKEFS----KGSDLRSILLTGGDSLEDQFGMMM- 244
            HS  IG   +I +P+RELA Q  +  K+      + S    + LTGG S++ Q  ++  
Sbjct: 252 DHSKSIG---LIFTPTRELAQQVTQHLKKLGQLIIQKSKFAILPLTGGLSIQKQERILKY 308

Query: 245 -GNPDVVIATPGRFLHLKVEMNLDL----KSVEYVVFDEADRLFEMGFQEQLNELLVAF- 298
             +  +V+ATPGRFL L +E N+DL      +  +V DEADRL + G  ++  ++L    
Sbjct: 309 ENSARIVVATPGRFLEL-IEKNIDLIPRFARINTLVLDEADRLLQDGHFDEFEKILKLLG 367

Query: 299 -------PTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKD 351
                   T  QT++FSAT   SL  F+K   ++                   + S+KKD
Sbjct: 368 GARKSFDKTGWQTMIFSATFSLSL--FSKLATAS-------------------WKSLKKD 406

Query: 352 EREA-NLLYLLQEAIKM---PVATESQI-KKLKQQNXXXXXXXXXXXXXXXXXXXXXXXX 406
           E E   +L  L + I+    PV  ++   +K+K Q                         
Sbjct: 407 EDEMEQVLKHLMQKIRFKSKPVIVDTNSEEKIKSQ----IRESLIECGPMERDLYSYYFL 462

Query: 407 RRLPNANEMPSEKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQL----- 461
              P          T++F  +   V+ +     N       I+ ++ Q  R + L     
Sbjct: 463 AMYPG--------TTLIFCNSIDSVKKLCAYFNNLKIDAFQIHSSMTQKNRLRSLERYLQ 514

Query: 462 ---YNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWA 518
               N      ++LV +DVAARG+DIP + +V++Y LP ++  +IHR GRTARA N G +
Sbjct: 515 KSAQNDSQNKATVLVASDVAARGLDIPGIKHVVHYHLPRTADTYIHRSGRTARADNEGVS 574

Query: 519 FSIVS 523
             I S
Sbjct: 575 VMICS 579

>KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 657

 Score =  152 bits (385), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 133/453 (29%), Positives = 212/453 (46%), Gaps = 85/453 (18%)

Query: 90  PSLELSDDEKKATNESDDDLNDYFNTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQP 149
           P L LS+  + A ++S  D+      T D    H+ G      + K +   +S+  F   
Sbjct: 80  PPLRLSNVVRVADDQSSKDI------TLDGL--HQSGV-----IDKELHKAVSRMNFESL 126

Query: 150 TPIQRKTI-PLILQKRDIVGMARTGSGKTAAFVLPMIEKL---KTHSAKIGVRAVILSPS 205
           TP+Q+KTI P++  + D++  A+TG+GKT AF++P+ E L   +T S  + V+ VI++P+
Sbjct: 127 TPVQQKTIKPILETEHDVIARAKTGTGKTLAFLVPIFEHLIKTRTESPSM-VKCVIVAPT 185

Query: 206 RELAIQTHRVFKEFSKGSD----LRSILLTGGDSLEDQFGMMMGN-PDVVIATPGRFLHL 260
           R+LA+Q     ++  K +      +SI L GG + +     M  + P++V+ATPGR + +
Sbjct: 186 RDLALQIDSEIEKLHKNNHALRKFKSIALIGGSNFQVAIKRMFKDTPNIVVATPGRLMDV 245

Query: 261 KVEMNLD-LKSVEYVVFDEADRLFEMGFQEQ-------LNELLVAFPTNRQTLLFSATLP 312
             + +    K V++ V DEADRL E+GF E        LN +    P + +TLLFSATL 
Sbjct: 246 MSKFSDKFFKHVDFKVLDEADRLLEIGFDEDLRDISKTLNSINATGPEHIRTLLFSATLG 305

Query: 313 SSLVDFAKAGLSNPVLVRLDA----ETKISENLEM-LFISIKKDEREANLLYLLQEAIKM 367
            ++   A   ++    + LD     E +  E ++  L IS    E  A+ LY    AIK 
Sbjct: 306 DNVQKLAAGIMNRKESLFLDTVDVNEPEAHEKIDQRLVIS----ENFASNLYAPISAIKN 361

Query: 368 PVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPT 427
            +AT ++  K                                            I+FVPT
Sbjct: 362 RLATNNEPFK-------------------------------------------AILFVPT 378

Query: 428 RHHVEYVTQLLKNC--GYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIP 485
               ++   +L+       V   +G ++Q  R + +  F+     I V TDV ARG+D P
Sbjct: 379 VKFTKFYCTILERLFPSLPVYEFHGKIDQRKRTKMVGLFKRAHEGIFVCTDVGARGMDFP 438

Query: 486 LLANVINYSLPGSSKIFIHRVGRTARAGNRGWA 518
            +  V+   +P     +IHR+GRTAR G  G A
Sbjct: 439 GVEEVLQLGVPSELSNYIHRIGRTARGGKEGKA 471

>TPHA0D00770 Chr4 (155185..157002) [1818 bp, 605 aa] {ON} Anc_8.87
           YFL002C
          Length = 605

 Score =  152 bits (383), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 115/402 (28%), Positives = 188/402 (46%), Gaps = 75/402 (18%)

Query: 145 GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKL---KTHSAKI---GVR 198
           GF + TP+Q  TIPL  + +D+V  + TGSGKT +FV+P++EK+   + +S+K+      
Sbjct: 26  GFDEMTPVQASTIPLFARNKDVVVDSITGSGKTVSFVIPILEKIIIEEANSSKLKKGHFH 85

Query: 199 AVILSPSRELAIQTHRVFKEF--SKGSDL-----RSILLTGGDSLEDQFGMMMGN-PDVV 250
           ++I+SP+RELA Q   V + F      DL     + I+ T  +++ D     + N P ++
Sbjct: 86  SLIISPTRELAKQIQSVIESFLTHYPEDLYPIKSQLIVGTNTNTVRDNVSEFLDNRPQIL 145

Query: 251 IATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSAT 310
           + TPGR         +  KS   V+ DEADRL ++ F + +  ++   P  R+T LFSAT
Sbjct: 146 VGTPGRIFEFLKSSGIKSKSCSMVILDEADRLLDVSFLKDIENIMQILPKQRRTGLFSAT 205

Query: 311 LPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVA 370
           + S+  +  K GL NPV V ++++      L + + +I + E++  L         + V 
Sbjct: 206 INSAGSNIFKIGLRNPVKVTVNSKILAPVTLSLNY-AITEPEKKFQLF--------LSVL 256

Query: 371 TESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHH 430
              + KK                                            I + PT   
Sbjct: 257 NNYKFKK-------------------------------------------CIAYFPTCIS 273

Query: 431 VEYVTQLLK--------NCGYLVSYIYGALNQHARKQQLYNFRAGLT-SILVVTDVAARG 481
           V+Y    ++        N    +  ++G L   +R + L  F   L+ ++L+ TDVAARG
Sbjct: 274 VQYYYSFIQHLVEKKIVNEDLQIFSLHGKLQTSSRMKTLETFTETLSNAVLITTDVAARG 333

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +DIP +  VI    P  + IF+HR GRT RA   G A + ++
Sbjct: 334 IDIPDVDLVIQLDPPTDADIFLHRCGRTGRANKIGKAITFLN 375

>YBR142W Chr2 (528317..530638) [2322 bp, 773 aa] {ON}  MAK5Essential
           nucleolar protein, putative DEAD-box RNA helicase
           required for maintenance of M1 dsRNA virus; involved in
           biogenesis of large (60S) ribosomal subunits
          Length = 773

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 136/460 (29%), Positives = 205/460 (44%), Gaps = 122/460 (26%)

Query: 133 LSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHS 192
           LS  +L ++    F +PT IQ+K+IP+I+Q  D++G A TGSGKT A+ +P++EKL ++ 
Sbjct: 178 LSMTILQSLQNLNFLRPTEIQKKSIPVIMQGVDVMGKASTGSGKTLAYGIPIVEKLISNF 237

Query: 193 AKIGVR--AVILSPSRELAIQTHRVFKEFSK---GSDLRSIL-LTGGDSLEDQFGMMM-- 244
           ++   +  ++I +P+RELA Q     K+  +        SIL LTGG S++ Q  ++   
Sbjct: 238 SQKNKKPISLIFTPTRELAHQVTDHLKKICEPVLAKSQYSILSLTGGLSIQKQQRLLKYD 297

Query: 245 GNPDVVIATPGRFLHLKVEMNLDLK---SVEYVVFDEADRLFEMG----FQEQLNELLVA 297
            +  +VIATPGRFL L  + N  +K    V  ++ DEADRL + G    F++ +  LLV 
Sbjct: 298 NSGQIVIATPGRFLELLEKDNTLIKRFSKVNTLILDEADRLLQDGHFDEFEKIIKHLLVE 357

Query: 298 FPTNR----------QTLLFSATLPSSLVDFAKAGL------------------------ 323
              NR          QTL+FSAT    L D   +                          
Sbjct: 358 RRKNRENSEGSSKIWQTLIFSATFSIDLFDKLSSSRQVKDRRFKNNEDELNAVIQHLMSK 417

Query: 324 ----SNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLK 379
               S PV++  + E+K+S  ++   I     ER+    Y L      P  T        
Sbjct: 418 IHFNSKPVIIDTNPESKVSSQIKESLIECPPLERDLYCYYFL---TMFPGTT-------- 466

Query: 380 QQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHHVEYVTQLLK 439
                                        L   N + S K   V+             L 
Sbjct: 467 -----------------------------LIFCNAIDSVKKLTVY-------------LN 484

Query: 440 NCGYLVSYIYGALNQHARKQQLYNFR----------------AGLTSILVVTDVAARGVD 483
           N G     I+ ++ Q  R + L  F+                  L+++L+ +DVAARG+D
Sbjct: 485 NLGIPAFQIHSSMTQKNRLKSLERFKQQSAKQKTINHSNPDSVQLSTVLIASDVAARGLD 544

Query: 484 IPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           IP + +VI+Y LP S+ I+IHR GRTARAG+ G +  I S
Sbjct: 545 IPGVQHVIHYHLPRSTDIYIHRSGRTARAGSEGVSAMICS 584

>Ecym_6049 Chr6 (94618..95934) [1317 bp, 438 aa] {ON} similar to
           Ashbya gossypii ADR260C
          Length = 438

 Score =  148 bits (374), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 112/406 (27%), Positives = 183/406 (45%), Gaps = 59/406 (14%)

Query: 123 HKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVL 182
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA FVL
Sbjct: 52  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 110

Query: 183 PMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSK-GSDLRSILLTGGDSLEDQFG 241
             +++L   + ++ V  V+L  +RELA Q    +  FSK   D+++ +  GG        
Sbjct: 111 STLQQLDPVAGEVSV--VVLCNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTDTRKDIE 168

Query: 242 MMMGN---PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFE-MGFQEQLNELLVA 297
           ++      P +V+ATPGR   L  + N+DL  V+  V DE D++ E +  +  + ++  A
Sbjct: 169 LLKNKETAPHIVVATPGRLKALVRDNNIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRA 228

Query: 298 FPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANL 357
            P ++Q ++FSATL   +    +  L NP+ + +D                  DE +  L
Sbjct: 229 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVD------------------DEAKLTL 270

Query: 358 LYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPS 417
             L Q  IK+         + +++N                        R+L    +   
Sbjct: 271 HGLQQYYIKL---------EEREKN------------------------RKLAQLLDDLE 297

Query: 418 EKATIVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDV 477
               I+FV +      +T+LL    +    ++G + Q  R  +   F+     I V TDV
Sbjct: 298 FNQVIIFVKSTLRANELTKLLNASNFPAITVHGHMKQEKRIARYKAFKEFEKRICVSTDV 357

Query: 478 AARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
             RG+DI  +   INY +P  +  ++HRVGR  R G +G A S+VS
Sbjct: 358 FGRGIDIERINLAINYDMPSEADQYLHRVGRAGRFGTKGLAISLVS 403

>Ecym_5196 Chr5 complement(405570..406760) [1191 bp, 396 aa] {ON}
           similar to Ashbya gossypii ACR253C
          Length = 396

 Score =  147 bits (372), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 101/378 (26%), Positives = 176/378 (46%), Gaps = 55/378 (14%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    L +++L  I   GF  P+ IQ++ I  I++  D++  A++G+GKT  F +  +++
Sbjct: 24  FDELKLKEVLLRGIYGYGFVDPSAIQQRAILPIIEGHDVLAQAQSGTGKTGTFSIAALQR 83

Query: 188 LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGG-DSLEDQFGMMMGN 246
           +   S K   +A+IL+P+RELA+Q  +V    +   D++     GG D  ED   +  G 
Sbjct: 84  ID-ESIK-SPQALILAPTRELALQIQKVVMALALHMDVKVHACIGGTDPREDAEALRAG- 140

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLL 306
             +V+ TPGR   +          ++  + DEAD +   GF+EQ+ ++    P   Q +L
Sbjct: 141 AQIVVGTPGRVFDMIERRFFKTDHIKMFILDEADEMLSSGFKEQIYKIFTMLPPTTQVVL 200

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIK 366
            SAT+P  ++D     ++ PV + +  +    E ++  FI+++ +E + + L  L ++I 
Sbjct: 201 LSATMPKEVLDVTDKFMNKPVRILVKKDALTLEGIQQYFINVESEEYKYDCLSDLYDSIS 260

Query: 367 MPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVP 426
           +  A                                                   ++F  
Sbjct: 261 VTQA---------------------------------------------------VIFCN 269

Query: 427 TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPL 486
           TR  VE +T+ L    + VS IY  L Q  R   +  FR G + IL+ TD+ ARG+D+  
Sbjct: 270 TRRKVEELTKRLTEDDFTVSAIYSDLPQAQRDTIMKEFRTGSSRILISTDLLARGIDVQQ 329

Query: 487 LANVINYSLPGSSKIFIH 504
           ++ VINY LP + + +IH
Sbjct: 330 VSLVINYDLPNNKENYIH 347

>KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {ON}
           Anc_7.336 YDL160C
          Length = 513

 Score =  150 bits (378), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 80/218 (36%), Positives = 124/218 (56%), Gaps = 2/218 (0%)

Query: 117 ADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGK 176
            D   K K  +F  F L + +L+ I + GF +P+PIQ + IP+ +  RDI+  A+ G+GK
Sbjct: 25  TDDVLKTKGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGK 84

Query: 177 TAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSL 236
           TAAFV+P +EK+K    KI  +A+I+ P+RELA+QT +V +   K   +  ++ TGG +L
Sbjct: 85  TAAFVIPTLEKVKPKLNKI--QALIMVPTRELALQTSQVVRSLGKHCGVSCMVTTGGTNL 142

Query: 237 EDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLV 296
            D    +     +++ TPGR L L      DL      V DEAD++    F+  + ++L 
Sbjct: 143 RDDILRLNDTIHILVGTPGRVLDLASRKIADLSECGLFVMDEADKMLSRDFKTIIEQILA 202

Query: 297 AFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAE 334
             P N Q+LLFSAT P ++ +F +  L+ P  + L  E
Sbjct: 203 FLPKNHQSLLFSATFPLTVKEFMEKHLNKPYEINLMEE 240

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 59/102 (57%)

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           I+F  + + VE + + + + GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 275 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 334

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 335 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 376

>ACR197W Chr3 (695405..696859) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL160C (DHH1)
          Length = 484

 Score =  149 bits (375), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 89/243 (36%), Positives = 134/243 (55%), Gaps = 16/243 (6%)

Query: 94  LSDDEKKATNESDDDL----NDYFNTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQP 149
           +S+D KK  N    D     +D  NT        K  +F  F L + +L+ I + GF +P
Sbjct: 1   MSEDWKKKLNIPKKDTRPQTDDVLNT--------KGNTFEDFYLRRELLMGIFEAGFERP 52

Query: 150 TPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELA 209
           +PIQ + IP+ L +RDI+  A+ G+GKTAAFV+P +E +K    KI  +A+I+ P+RELA
Sbjct: 53  SPIQEEAIPIALARRDILARAKNGTGKTAAFVIPTLEIVKPKVNKI--QALIMVPTRELA 110

Query: 210 IQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNP-DVVIATPGRFLHLKVEMNLDL 268
           +QT +V +   K   +  ++ TGG +L D   M +  P  V++ TPGR L L      DL
Sbjct: 111 LQTSQVVRTLGKHCGISCMVTTGGTNLRDDI-MRLNEPVHVLVGTPGRVLDLASRKVADL 169

Query: 269 KSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVL 328
                 V DEAD++    F+  + ++L   P N Q+LLFSAT P ++ +F    L+ P  
Sbjct: 170 SECSLFVMDEADKMLSRDFKSLVEQILSFLPQNHQSLLFSATFPLTVKEFMVKHLNKPYE 229

Query: 329 VRL 331
           + L
Sbjct: 230 INL 232

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 59/102 (57%)

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           I+F  + + VE + + + + GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 371

>SAKL0B02794g Chr2 complement(266645..268441) [1797 bp, 598 aa] {ON}
           highly similar to gnl|GLV|KLLA0E14410g Kluyveromyces
           lactis KLLA0E14410g and similar to YFL002C
           uniprot|P25808 Saccharomyces cerevisiae YFL002C SPB4
           involved in the maturation of 25S ribosomal RNA ATP-
           dependent RNA helicase
          Length = 598

 Score =  150 bits (380), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 114/406 (28%), Positives = 188/406 (46%), Gaps = 75/406 (18%)

Query: 141 ISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKL---KTHSAKI-- 195
           I   GF   TP+Q  TIP+    +D+V  + TGSGKT +FV+P++EK+   + H+AK+  
Sbjct: 22  IDTMGFETMTPVQASTIPMFSGNKDVVVESVTGSGKTVSFVIPILEKIIADEAHTAKLKK 81

Query: 196 -GVRAVILSPSRELAIQTHRVFKEF-----SKGSDLRSILLTGGD--SLEDQFGMMMGN- 246
               ++I+SP+REL+ Q   V + F      +   + S LL G +  ++ D     M N 
Sbjct: 82  GHFYSLIISPTRELSSQIQTVIESFLNHYPEENCPISSQLLIGTNKSTVRDDVNSYMENR 141

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLL 306
           P +++ TPGR L       +   S   VV DEAD+L +  F++ +  +L   P  R+T L
Sbjct: 142 PQILVGTPGRILDFLNMPTVKSSSCGVVVLDEADKLLDASFEKDVETILKLLPKQRRTGL 201

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIK 366
           FSAT+ S+     K G+ NPV + + ++ +   +L++    +K + +   LL +L     
Sbjct: 202 FSATINSAGTQIFKTGMRNPVKISVKSKHQAPSSLKIKCAVVKPELKFQLLLTVL----- 256

Query: 367 MPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVP 426
                                                         N    +K  + F P
Sbjct: 257 ----------------------------------------------NHYNYKKCIVYF-P 269

Query: 427 TRHHVEYVTQLLKNCGYL--------VSYIYGALNQHARKQQLYNFRAGL-TSILVVTDV 477
           T   V Y    +++   L        +  ++G L  ++R + L  F   L T++L+ TDV
Sbjct: 270 TCVSVTYFYAFMQHLLKLGLINEDLDIFSLHGKLQTNSRMKTLERFTESLNTAVLLTTDV 329

Query: 478 AARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           AARG+DIP +  V+ +  P  + +F+HR GRT RA   G A + ++
Sbjct: 330 AARGIDIPDVDLVLQFDPPTDADMFLHRCGRTGRASRVGRAITFLN 375

>KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {ON}
           Anc_7.336 YDL160C
          Length = 512

 Score =  149 bits (376), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 123/211 (58%), Gaps = 2/211 (0%)

Query: 124 KKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLP 183
           K  +F  F L + +L+ I + GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAFV+P
Sbjct: 43  KGNTFEDFHLKRELLMGIFEAGFEKPSPIQEESIPVAITGRDILARAKNGTGKTAAFVIP 102

Query: 184 MIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMM 243
            ++K+K    KI  +A+I+ P+RELA+QT +V +   K   +  ++ TGG +L D    +
Sbjct: 103 TLQKIKPKVNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 160

Query: 244 MGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQ 303
                V++ TPGR L L      DL      + DEAD++    F+  + ++L+  P N Q
Sbjct: 161 NDTVHVLVGTPGRVLDLASRKIADLSECALFIMDEADKMLSRDFKTIIEQILIFLPKNHQ 220

Query: 304 TLLFSATLPSSLVDFAKAGLSNPVLVRLDAE 334
           +LLFSAT P ++ +F    L+ P  + L  E
Sbjct: 221 SLLFSATFPLTVKEFMVKHLNKPYEINLMEE 251

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 59/102 (57%)

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           I+F  + + VE + + + + GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 286 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 345

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 346 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 387

>Smik_10.94 Chr10 complement(151257..152444) [1188 bp, 395 aa] {ON}
           YJL138C (REAL)
          Length = 395

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 97/378 (25%), Positives = 181/378 (47%), Gaps = 56/378 (14%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    L + +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  +++
Sbjct: 24  FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQR 83

Query: 188 LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDS-LEDQFGMMMGN 246
           + T S K   +A++L+P+RELA+Q  +V    +   D++     GG S +ED  G+   +
Sbjct: 84  IDT-SVK-APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLR--D 139

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLL 306
             +V+ TPGR              ++  + DEAD +   GF+EQ+ ++    P   Q +L
Sbjct: 140 AQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVL 199

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIK 366
            SAT+P+ +++     + NPV + +  +    E ++  ++++++++ +   L  L ++I 
Sbjct: 200 LSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDYKYECLTDLYDSIS 259

Query: 367 MPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVP 426
           +  A                                                   ++F  
Sbjct: 260 VTQA---------------------------------------------------VIFCN 268

Query: 427 TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPL 486
           TR  VE +T  L++  + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  
Sbjct: 269 TRRKVEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQ 328

Query: 487 LANVINYSLPGSSKIFIH 504
           ++ VINY LP + + +IH
Sbjct: 329 VSLVINYDLPANKENYIH 346

>Smik_11.321 Chr11 (544869..546056) [1188 bp, 395 aa] {ON} YKR059W
           (REAL)
          Length = 395

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 97/378 (25%), Positives = 181/378 (47%), Gaps = 56/378 (14%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    L + +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  +++
Sbjct: 24  FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQR 83

Query: 188 LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDS-LEDQFGMMMGN 246
           + T S K   +A++L+P+RELA+Q  +V    +   D++     GG S +ED  G+   +
Sbjct: 84  IDT-SVK-APQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEGLR--D 139

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLL 306
             +V+ TPGR              ++  + DEAD +   GF+EQ+ ++    P   Q +L
Sbjct: 140 AQIVVGTPGRVFDNIQRRRFRTDKIKMFILDEADEMLSSGFKEQIYQIFTLLPPTTQVVL 199

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIK 366
            SAT+P+ +++     + NPV + +  +    E ++  ++++++++ +   L  L ++I 
Sbjct: 200 LSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEDYKYECLTDLYDSIS 259

Query: 367 MPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVP 426
           +  A                                                   ++F  
Sbjct: 260 VTQA---------------------------------------------------VIFCN 268

Query: 427 TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPL 486
           TR  VE +T  L++  + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  
Sbjct: 269 TRRKVEELTTKLRDDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQ 328

Query: 487 LANVINYSLPGSSKIFIH 504
           ++ VINY LP + + +IH
Sbjct: 329 VSLVINYDLPANKENYIH 346

>ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q75BS4 Ashbya gossypii ACR197W DHH1
           ATP-dependent RNA helicase DHH1 and similar to YDL160C
           uniprot|P39517 Saccharomyces cerevisiae YDL160C DHH1
           Cytoplasmic DExD/H-box helicase stimulates mRNA
           decapping coordinates distinct steps in mRNA function
           and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 523

 Score =  149 bits (376), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 85/239 (35%), Positives = 131/239 (54%), Gaps = 10/239 (4%)

Query: 99  KKATNESDDDLNDYFNTTADAAAKHKKGSFASFGLSKLVLINISKKGFRQPTPIQRKTIP 158
           KK T ++    +D  NT        K  +F  F L + +L+ I + GF +P+PIQ ++IP
Sbjct: 11  KKPTKDTRPQTDDVLNT--------KGNTFEDFFLKRELLMGIFEAGFEKPSPIQEESIP 62

Query: 159 LILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILSPSRELAIQTHRVFKE 218
           + L  RDI+  A+ G+GKTAAFV+P +EK+K    KI  +A+I+ P+RELA+QT +V + 
Sbjct: 63  VALAGRDILARAKNGTGKTAAFVIPTLEKVKPKINKI--QALIMVPTRELALQTSQVVRT 120

Query: 219 FSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDE 278
             K   +  ++ TGG +L D    +     V++ TPGR L L      DL      V DE
Sbjct: 121 LGKHCGVSCMVTTGGTNLRDDILRLNETVHVLVGTPGRVLDLASRKVADLSECSLFVMDE 180

Query: 279 ADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKI 337
           AD++    F+  + ++L+  P   Q+LLFSAT P ++ +F    L  P  + L  E  +
Sbjct: 181 ADKMLSRDFKTIIEQILIFLPPQHQSLLFSATFPITVKEFMVKHLHKPYEINLMEELTL 239

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 59/102 (57%)

Query: 422 IVFVPTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARG 481
           I+F  + + VE + + + + GY   Y +  + Q  R +  + FR G    LV +D+  RG
Sbjct: 271 IIFCNSTNRVELLAKKITDLGYSCYYSHARMRQQERNKVFHEFRQGKVRTLVCSDLLTRG 330

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A ++++
Sbjct: 331 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLIN 372

>Suva_6.59 Chr6 complement(110278..112098) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  150 bits (379), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 117/402 (29%), Positives = 180/402 (44%), Gaps = 75/402 (18%)

Query: 145 GFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSA------KIGVR 198
           GF   TP+Q  TIP++   +D+V  + TGSGKTAAFV+P++EK+    A      K    
Sbjct: 26  GFESMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVQEEANSPKFKKAHFH 85

Query: 199 AVILSPSRELAIQTHRVFKEF-----SKGSDLRSILLTGGDSL---EDQFGMMMGNPDVV 250
           ++I++P+REL+ Q   V   F     S    ++  LL G +     +D    +   P ++
Sbjct: 86  SLIIAPTRELSRQIESVVLSFLEHYPSDSFSIKCQLLIGTNEATVRDDVSSFLQNRPQIL 145

Query: 251 IATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSAT 310
           I TPGR L       +   +   V+ DEADRL ++ F +   ++L   P  R+T LFSAT
Sbjct: 146 IGTPGRVLDFLQMPAVKSSACSMVILDEADRLLDVSFIKDTEKILRLLPKQRRTGLFSAT 205

Query: 311 LPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVA 370
           + S+  D  K GL NPV + ++++ +   +L++ +  +   E+   L+ +L         
Sbjct: 206 MRSAGSDIFKTGLRNPVRITVNSKHQAPSSLKLNYCVVNPLEKLQLLVSIL--------- 256

Query: 371 TESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVPTRHH 430
                                                     N    +K  + F PT   
Sbjct: 257 ------------------------------------------NNYKFKKCIVYF-PTCVS 273

Query: 431 VEY---VTQLLKNCGYLVS-----YIYGALNQHARKQQLYNFRAGL-TSILVVTDVAARG 481
           V Y     Q L     L S      ++G L   AR + L  F   L  ++L  TDVAARG
Sbjct: 274 VSYFYSFVQYLSKKNILTSELEVFSLHGKLQTSARMKTLAAFTDSLNNAVLFTTDVAARG 333

Query: 482 VDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           +DIP +  VI    P +S +F+HR GRT RA   G A + ++
Sbjct: 334 IDIPEVDLVIQLDPPTNSDMFMHRCGRTGRANRVGKAITFLN 375

>CAGL0I04356g Chr9 (389225..390415) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P10081 Saccharomyces cerevisiae
           YKR059w TIF1 or uniprot|P10081 Saccharomyces cerevisiae
           YJL138c TIF2
          Length = 396

 Score =  146 bits (368), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 96/378 (25%), Positives = 180/378 (47%), Gaps = 56/378 (14%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    L++ +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  +++
Sbjct: 25  FDDMNLNEKLLRGVFGYGFNKPSAIQQRAIMPIIEGNDVLAQAQSGTGKTGTFSIAALQR 84

Query: 188 LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDS-LEDQFGMMMGN 246
           +    A    +A++L+P+RELA+Q  +V        D++     GG S +ED  G+   +
Sbjct: 85  I--DPAIKAPQALMLAPTRELALQIQKVVMALGFHMDIKVHACIGGTSFVEDAEGLR--D 140

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLL 306
             +V+ TPGR           + +++  + DEAD +   GF+EQ+ ++    P   Q +L
Sbjct: 141 AQIVVGTPGRVFDNIQRRKFKVDNIKMFILDEADEMLSTGFKEQIYQIFTMLPPTTQVVL 200

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIK 366
            SAT+P  +++     + NPV + +  +    E ++  ++++++++ + + L  L ++I 
Sbjct: 201 LSATMPRDVLEVTAKFMQNPVRILVKKDELTLEGIKQFYVNVEEEQFKYDCLTDLYDSIS 260

Query: 367 MPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVP 426
           +  A                                                   ++F  
Sbjct: 261 VTQA---------------------------------------------------VIFCN 269

Query: 427 TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPL 486
           TR  VE +TQ L    + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  
Sbjct: 270 TRRKVEELTQRLTADNFTVSSIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQ 329

Query: 487 LANVINYSLPGSSKIFIH 504
           ++ VINY LP + + +IH
Sbjct: 330 VSLVINYDLPTNKENYIH 347

>TBLA0D05750 Chr4 (1420975..1422180) [1206 bp, 401 aa] {ON}
           Anc_1.211 YJL138C
          Length = 401

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 97/379 (25%), Positives = 181/379 (47%), Gaps = 56/379 (14%)

Query: 127 SFASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIE 186
           +F    L K +L  +   GF +P+ IQ++ I  I++  D++  A++G+GKT  F +  ++
Sbjct: 24  TFDDMKLKKELLRGVFAYGFEEPSAIQQRAILPIVEGNDVLAQAQSGTGKTGTFSIAALQ 83

Query: 187 KLKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDS-LEDQFGMMMG 245
           ++         +A+IL+P+RELA+Q  +V    +   D++     GG S +ED  G+   
Sbjct: 84  RINPEIK--APQALILAPTRELALQIQKVVISLALYLDIKVHACIGGTSFVEDTEGLR-- 139

Query: 246 NPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTL 305
           +  +V+ TPGR         L    ++  + DEAD +   GF+EQ+ ++    P   Q +
Sbjct: 140 DAQIVVGTPGRVFDNIQRHRLRTDKIKMFISDEADEMLSSGFKEQIYQIFTMMPPTTQVV 199

Query: 306 LFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAI 365
           L SAT+P  +++     + +PV + +  +    E ++  +I++++++ + ++L  L ++I
Sbjct: 200 LLSATMPRDVLEVTTKFMRDPVRILVKKDELTLEGIKQFYINVEEEDYKYDVLTDLYDSI 259

Query: 366 KMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFV 425
            +  A                                                   ++F 
Sbjct: 260 SVTQA---------------------------------------------------VIFC 268

Query: 426 PTRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIP 485
            TR  VE +T+ L    + VS IY  L Q  R+  +  FR+G + IL+ TD+ ARG+D+ 
Sbjct: 269 NTRRKVEELTKKLTEADFTVSAIYSDLPQQERETIMKEFRSGSSRILISTDLLARGIDVQ 328

Query: 486 LLANVINYSLPGSSKIFIH 504
            ++ VINY LP + + +IH
Sbjct: 329 QVSLVINYDLPTNKENYIH 347

>SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 668

 Score =  151 bits (381), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 114/412 (27%), Positives = 192/412 (46%), Gaps = 77/412 (18%)

Query: 133 LSKLVLINISKKGFRQPTPIQRKTI-PLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTH 191
           +  ++  +I + GF   TP+Q+KTI P++    D++  A+TG+GKT AF++PM E L  +
Sbjct: 127 IDNMLYKSIDRMGFPALTPVQQKTIKPILATTNDVIARAKTGTGKTLAFLIPMFEHLLAN 186

Query: 192 --SAKIGVRAVILSPSRELAIQTHRVFKEFSKGS----DLRSILLTGGDSLEDQFGMMMG 245
              ++  V+ V+++P+R+LA+Q     ++  K +      +S+ L GG + +     M  
Sbjct: 187 RTDSQYMVKCVVVAPTRDLALQIDSEIQKIHKNNYGLQKFKSVCLIGGTNFDSSIKKMFK 246

Query: 246 N-PDVVIATPGRFLHLKVEMNLD-LKSVEYVVFDEADRLFEMGFQE-------QLNELLV 296
             P++++ATPGR   +  + +    K V++ + DEADRL E+GF++       QLN +  
Sbjct: 247 ERPNIIVATPGRLQDVMSKFSGKFFKFVDFKILDEADRLLEIGFKQDLENISSQLNSINE 306

Query: 297 AFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLD--------AETKISENLEMLFISI 348
             P + +TLLFSATL   + + A   ++    + LD        A  KI ++L +     
Sbjct: 307 KGPEHIRTLLFSATLDDRVQELANDIMNREECLFLDTVDKNEPEAHEKIDQHLVI----- 361

Query: 349 KKDEREANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRR 408
              E+ A+ LY   E IK  +A    +K                                
Sbjct: 362 --SEKFAHNLYAPIEEIKSQLAENENLK-------------------------------- 387

Query: 409 LPNANEMPSEKATIVFVPTRHHVEYVTQLLKNC--GYLVSYIYGALNQHARKQQLYNFRA 466
                        I+FVPT    ++  + L+     + +   +G + Q  R + +  F+ 
Sbjct: 388 ------------AILFVPTVKFAKFFCRSLEQILPDFPILEFHGKIEQRRRTRIVQEFKR 435

Query: 467 GLTSILVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWA 518
               +LV TDV ARG+D P +  V    +P     +IHR+GRTAR G  G A
Sbjct: 436 AKRGLLVSTDVGARGMDFPNIDEVFQIGVPSELANYIHRIGRTARGGKEGRA 487

>KLTH0F05610g Chr6 complement(483243..484433) [1191 bp, 396 aa] {ON}
           highly similar to uniprot|P10081 Saccharomyces
           cerevisiae YKR059W TIF1 and highly similar to
           uniprot|P10081 Saccharomyces cerevisiae YJL138C
           TIF2translation initiation factor eIF4A
          Length = 396

 Score =  146 bits (368), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 97/378 (25%), Positives = 173/378 (45%), Gaps = 55/378 (14%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    L + +L  I   GF  P+ IQ++ I  I +  D++  A++G+GKT  F +  ++K
Sbjct: 24  FDDLNLKEELLRGIYGYGFVDPSAIQQRAILPITEGHDVLAQAQSGTGKTGTFSIAALQK 83

Query: 188 LKTHSAKIGV-RAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGN 246
           +     KI   +A++L+P+RELA+Q  +V    +   D++     GG S  +    +   
Sbjct: 84  I---DPKIKAPQALMLAPTRELALQIQKVVMALAFHMDIKVHACIGGTSFVEDAEALRDG 140

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLL 306
             +V+ TPGR   +          ++  + DEAD +   GF+EQ+ ++    P   Q +L
Sbjct: 141 AQIVVGTPGRVFDMIERRRFRTDHIKMFILDEADEMLSSGFKEQIYKIFTLLPPTTQVVL 200

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIK 366
            SAT+P  +++     + NP+ + +  +    E ++  FI++++++ + + L  L ++I 
Sbjct: 201 LSATMPQDVLEVTTKFMRNPIRILVKKDELTLEGIKQFFINVEEEDYKYDCLSDLYDSIS 260

Query: 367 MPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVP 426
           +  A                                                   ++F  
Sbjct: 261 VTQA---------------------------------------------------VIFCN 269

Query: 427 TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPL 486
           TR  VE +TQ L    + VS IY  L Q  R   +  FR G + IL+ TD+ ARG+D+  
Sbjct: 270 TRRKVEELTQRLVADNFTVSAIYSDLPQQQRDTIMKEFRTGSSRILISTDLLARGIDVQQ 329

Query: 487 LANVINYSLPGSSKIFIH 504
           ++ VINY LP + + +IH
Sbjct: 330 VSLVINYDLPTNKENYIH 347

>NCAS0B08130 Chr2 (1551641..1552831) [1191 bp, 396 aa] {ON}
           Anc_1.211
          Length = 396

 Score =  146 bits (368), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 99/378 (26%), Positives = 179/378 (47%), Gaps = 56/378 (14%)

Query: 128 FASFGLSKLVLINISKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEK 187
           F    L + +L  +   GF  P+ IQ++ I  I++  D++  A++G+GKT  F +  +++
Sbjct: 25  FDDMNLDEKLLRGVFGYGFEDPSAIQQRAIMPIIEGHDVLAQAQSGTGKTGTFSIAALQR 84

Query: 188 LKTHSAKIGVRAVILSPSRELAIQTHRVFKEFSKGSDLRSILLTGGDS-LEDQFGMMMGN 246
           + T S K   +A++L+P+RELA+Q  +V    +   D++     GG S +ED  G+   +
Sbjct: 85  IDT-SIK-APQALMLAPTRELALQIQKVVMALAFHMDVKVHACIGGTSFVEDAEGLR--D 140

Query: 247 PDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLL 306
             +V+ TPGR             S++  + DEAD +   GF+EQ+ ++    P   Q +L
Sbjct: 141 AQIVVGTPGRVFDNIQRRRFRTDSIKMFILDEADEMLSSGFKEQIYQIFTMLPPTTQVVL 200

Query: 307 FSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIK 366
            SAT+P  +++     + NPV + +  +    E ++  ++++++++ +   L  L ++I 
Sbjct: 201 LSATMPRDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEQFKYECLTDLYDSIS 260

Query: 367 MPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANEMPSEKATIVFVP 426
           +  A                                                   ++F  
Sbjct: 261 VTQA---------------------------------------------------VIFCN 269

Query: 427 TRHHVEYVTQLLKNCGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPL 486
           TR  VE +TQ L    + VS IY  L Q  R   +  FR+G + IL+ TD+ ARG+D+  
Sbjct: 270 TRRKVEELTQKLTADDFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQ 329

Query: 487 LANVINYSLPGSSKIFIH 504
           ++ VINY LP + + +IH
Sbjct: 330 VSLVINYDLPTNKENYIH 347

>ZYRO0C04378g Chr3 complement(342717..344762) [2046 bp, 681 aa] {ON}
           similar to uniprot|P15424 Saccharomyces cerevisiae
           YDR194C MSS116 DEAD-box protein required for efficient
           splicing of mitochondrial Group I and II introns
           presumed RNA helicase due to DEAD-box motif
          Length = 681

 Score =  151 bits (381), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 126/412 (30%), Positives = 191/412 (46%), Gaps = 77/412 (18%)

Query: 137 VLINISKKGFRQPTPIQRKTIPLIL--QKRDIVGMARTGSGKTAAFVLPMIEKL--KTHS 192
            ++NI   GF   TP+Q+K I  IL  Q +D++  A+TG+GKT AF++PM + L      
Sbjct: 92  CIVNI---GFTGLTPVQQKAIRPILENQSQDVITRAKTGTGKTFAFLIPMFQHLINTKRE 148

Query: 193 AKIGVRAVILSPSRELAIQ----------THRVFKEFSKGSDLRSILLTGGDSLEDQF-G 241
               V+ VI++P+R+LA+Q           H V K F       S+ L GG +       
Sbjct: 149 NPSAVKYVIVAPTRDLALQIEMETRRIQAAHPVLKRF------HSLTLVGGTNFAASVTD 202

Query: 242 MMMGNPDVVIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQ-------LNEL 294
           ++   P VVIATPGR L +        K V+  V DEADRL E+GFQ+        LN++
Sbjct: 203 LIRRKPQVVIATPGRLLDILQRYEKHFKQVDVKVLDEADRLLEIGFQQDLEKISSILNKI 262

Query: 295 LVAFPTNRQTLLFSATLPSSLVDFAKAGLSNPVLVRLDAETKISENLEMLFISIKKDERE 354
               P + +TLLFSATL + + D +++ +     + LD   K            +K  + 
Sbjct: 263 NETGPDHIRTLLFSATLDAKVQDLSQSIMGKDECLFLDTVDKNEPQAH------EKISQS 316

Query: 355 ANLLYLLQEAIKMPVATESQIKKLKQQNXXXXXXXXXXXXXXXXXXXXXXXXRRLPNANE 414
           A +   L  +I   +AT   +K+    N                                
Sbjct: 317 AVIAENLGHSI---LATMDHVKRQVLAN-------------------------------- 341

Query: 415 MPSEKATIVFVPTRHHVEYVTQLL---KNCGYLVSYIYGALNQHARKQQLYNFRAGLTSI 471
            P+ KA I+F PT      +++LL   ++    +   +G   Q+ R + +  F+   + I
Sbjct: 342 -PNYKA-ILFTPTIKCTTLISELLHAQQDVAVPILEFHGKKTQNVRTKMVQKFKRDRSGI 399

Query: 472 LVVTDVAARGVDIPLLANVINYSLPGSSKIFIHRVGRTARAGNRGWAFSIVS 523
           LV TDVAARG+D P +  V+   +P     +IHR+GRTARAG  G A   +S
Sbjct: 400 LVCTDVAARGLDFPDVGEVLQIGVPAIMSQYIHRIGRTARAGKTGKAVLFMS 451

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,663,515
Number of extensions: 4029130
Number of successful extensions: 17080
Number of sequences better than 10.0: 623
Number of HSP's gapped: 16240
Number of HSP's successfully gapped: 1106
Length of query: 973
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 854
Effective length of database: 39,836,145
Effective search space: 34020067830
Effective search space used: 34020067830
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)