Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F24662g3.160ON53053025920.0
Ecym_35493.160ON5325408651e-109
KLTH0C08888g3.160ON5065258401e-106
SAKL0C08800g3.160ON6015408451e-105
AEL085W3.160ON5275388081e-101
Kwal_56.227993.160ON5315327894e-98
ZYRO0B04950g3.160ON5065297431e-91
KAFR0C010503.160ON5065257326e-90
Suva_4.2193.160ON5315377311e-89
TPHA0A009103.160ON5275347293e-89
NCAS0C035403.160ON5185367058e-86
YDL030W (PRP9)3.160ON5305307023e-85
Skud_4.2213.160ON5315386883e-83
TDEL0D046203.160ON5165376832e-82
NDAI0G028903.160ON5365496721e-80
Kpol_479.263.160ON5175326692e-80
CAGL0K01573g3.160ON5165396665e-80
KNAG0K011203.160ON5275456596e-79
Smik_4.2053.160ON5315346571e-78
TBLA0B016003.160ON486731412e-08
Skud_4.2123.150ON26684850.060
Suva_4.2083.150ON26684810.18
AAR078W7.356ON56276770.94
Skud_10.1051.253ON1770131770.99
Smik_4.3468.247ON87857751.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F24662g
         (530 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]...  1003   0.0  
Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {O...   337   e-109
KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} simila...   328   e-106
SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} simila...   330   e-105
AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic ho...   315   e-101
Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {...   308   4e-98
ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {...   290   1e-91
KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {O...   286   6e-90
Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W ...   286   1e-89
TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.1...   285   3e-89
NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.1...   276   8e-86
YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subuni...   275   3e-85
Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W ...   269   3e-83
TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {O...   267   2e-82
NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.1...   263   1e-80
Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}...   262   2e-80
CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} simil...   261   5e-80
KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3....   258   6e-79
Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W ...   257   1e-78
TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.1...    59   2e-08
Skud_4.212 Chr4 complement(370995..371795) [801 bp, 266 aa] {ON}...    37   0.060
Suva_4.208 Chr4 complement(364168..364968) [801 bp, 266 aa] {ON}...    36   0.18 
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    34   0.94 
Skud_10.105 Chr10 complement(179830..185142) [5313 bp, 1770 aa] ...    34   0.99 
Smik_4.346 Chr4 (619186..621822) [2637 bp, 878 aa] {ON} YDR103W ...    33   1.7  

>KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]
           {ON} similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 530

 Score = 1003 bits (2592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/530 (93%), Positives = 493/530 (93%)

Query: 1   MNAPTYLCFEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAWAVPKLDVS 60
           MNAPTYLCFEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAWAVPKLDVS
Sbjct: 1   MNAPTYLCFEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAWAVPKLDVS 60

Query: 61  ANRIYXXXXXXXXXXQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQ 120
           ANRIY          QIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQ
Sbjct: 61  ANRIYRSKKSKRSRKQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQ 120

Query: 121 FETVTTEVLEGQVNSRSLVEVKSDYEMFSGPQAASKNIISPIGQIIDLSRNFARDENFGT 180
           FETVTTEVLEGQVNSRSLVEVKSDYEMFSGPQAASKNIISPIGQIIDLSRNFARDENFGT
Sbjct: 121 FETVTTEVLEGQVNSRSLVEVKSDYEMFSGPQAASKNIISPIGQIIDLSRNFARDENFGT 180

Query: 181 YLDLSEQFKKWLNIIKRADLTILSFLKMLESFETYDYLLNPSLDRDTKEYNQLVTELLXX 240
           YLDLSEQFKKWLNIIKRADLTILSFLKMLESFETYDYLLNPSLDRDTKEYNQLVTELL  
Sbjct: 181 YLDLSEQFKKWLNIIKRADLTILSFLKMLESFETYDYLLNPSLDRDTKEYNQLVTELLKY 240

Query: 241 XXXXXXXXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSEFN 300
                    PLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSEFN
Sbjct: 241 YKAYYSKAYPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSEFN 300

Query: 301 THVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXXXXXXX 360
           THVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLA            
Sbjct: 301 THVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAFTDEEFTEELEK 360

Query: 361 XXXXYESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKVQG 420
               YESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKVQG
Sbjct: 361 LQEQYESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKVQG 420

Query: 421 LDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELWKA 480
           LDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELWKA
Sbjct: 421 LDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELWKA 480

Query: 481 LQAKSTLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL 530
           LQAKSTLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL
Sbjct: 481 LQAKSTLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL 530

>Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AEL085W
          Length = 532

 Score =  337 bits (865), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/540 (37%), Positives = 297/540 (55%), Gaps = 29/540 (5%)

Query: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAW------AVPKLDVSAN 62
            EE+R ILEELE+IEDAIS R+ RNPE+FY +   +H L +          +P +D++AN
Sbjct: 4   LEEKRAILEELELIEDAISDRIARNPEVFYSY---IHELSIVNSDEKVLSNIPNVDITAN 60

Query: 63  RIYXXXXXXXXXXQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFE 122
           R+Y          QI  Q++EI+ FL  Y + +K L  +K   ++++ F+D N +FE F 
Sbjct: 61  RVYMIKKSKRSRKQILLQQHEISKFLSYYLKNVKKLNGYK--NDNVDEFKDHNQNFELFR 118

Query: 123 TVTTEVLEG---QVNSR----SLVEVKSDYEMFSGPQAASKNIISPIGQIIDLSRNFARD 175
                + E    + NS     SL   K  Y MFS      K+I+S  GQ ID+++ F+ +
Sbjct: 119 DQIQRIKEKYAEESNSEAFDASLEARKYQYTMFSNSNHQKKDILSLEGQSIDINKKFSWE 178

Query: 176 ENFGTYLDLSEQFKKWLNIIKRADLTILSFLKMLESFETYDYLLNPSLDRDTKEYNQLVT 235
           E++G YL L +  +++LNI+K A++++L F+  L++F  + +L NP +DR++K Y+  + 
Sbjct: 179 EHYGEYLHLDQYHQEYLNIVKNANVSLLQFIGFLQTFCDHGHLKNPPVDRNSKIYHGFLE 238

Query: 236 ELLXXXXXXXXXXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDS 295
            LL           PL++     K I N F +Y  T I +S    S     V   +WF +
Sbjct: 239 RLLKYVNSFFESAFPLINHVQFQKRIKNSFVEYTSTPIEDS----SRGCLCVACGKWFKA 294

Query: 296 QSEFNTHVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXX 355
            + + +H+Q  +    L   R+ LM EYT       L+K L +T SF ERK A       
Sbjct: 295 ITVYTSHLQGRKHLNNLKCRRRSLMVEYTLQNLFTCLNKELVSTKSFVERKYAFTVEERI 354

Query: 356 XXXXXXXXXYESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWL 415
                    Y +  Y   E ED  S  D +  ++++   D  NP NLPLGPDG+PIP WL
Sbjct: 355 QELAKLRDAYNANAYGDHERED--SQEDLSVSSSKETPPDDNNPLNLPLGPDGYPIPYWL 412

Query: 416 IKVQGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVT 475
            K+QGLD++Y CEICGN +Y GRR FE+HF  ++H+ GL+ LGI P+  FK ++ I +  
Sbjct: 413 YKLQGLDIEYTCEICGNHLYKGRRVFERHFHEQRHTYGLRCLGIEPTSTFKGISKISDAQ 472

Query: 476 ELWKALQAKSTLKSG-----EPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL 530
            LW  L+  S L S      +  S  + V   ++ +E ED +GNVMS +VYE+LKKQGLL
Sbjct: 473 ILWSRLKNNSHLNSASATYPDATSSRAVVTNNKLEIEMEDEDGNVMSHRVYEDLKKQGLL 532

>KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 506

 Score =  328 bits (840), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 195/525 (37%), Positives = 288/525 (54%), Gaps = 25/525 (4%)

Query: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAW--AVPKLDVSANRIYX 66
           +E+ R  LEELE+IE+A++SRLRRNPEIFYR  + +  +        +P    SAN++Y 
Sbjct: 4   YEDARATLEELELIENAVTSRLRRNPEIFYRNIDEVDLVEHSGRFDHIPSSQKSANKVYT 63

Query: 67  XXXXXXXXXQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFETVTT 126
                    QI AQE+EI  FL +Y   LK  Q     E  +  +R  N S  +      
Sbjct: 64  VKKSRRSRKQILAQEHEIKSFLSQY---LKDCQSLGRVEFDMSEYRVDNGSVNKLLEHIE 120

Query: 127 EVLEGQVNSRSLVEVKSDYEMFSGPQAASKNIISPIGQIIDLSRNFARDENFGTYLDLSE 186
            + E         E    Y MFS    ++KNIIS   Q +D++  F RDE +G YLDL  
Sbjct: 121 RIKEIHPKDD---EFGDQYAMFSSSTPSNKNIISRKAQNLDINSYFTRDEQYGEYLDLEP 177

Query: 187 QFKKWLNIIKRADLTILSFLKMLESFETYDYLLNPSLDRDTKEYNQLVTELLXXXXXXXX 246
             +KWL+++K  D+T+L FL  +E F    YLL P+++R++  Y + V  L         
Sbjct: 178 FHQKWLSVVKNGDVTLLQFLSEVEKFTDQRYLLQPAVNRNSSRYREFVASLHHYLSDYAA 237

Query: 247 XXXPLVDKEILSKTIHNGFDKYVRTGITES-PSKESGKMYSVVFNRWFDSQSEFNTHVQT 305
              PL+  ++    IH    +   T + +  PS ESG ++ +  ++ F + + +N H+  
Sbjct: 238 RAYPLLSWDL----IHAKAQELYHTNVAKPIPSGESG-VFCIPCDKRFKTDTVYNAHLPG 292

Query: 306 EQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXXXXXXXXXXXY 365
           ++    L +N   L +E++ H F ++LS+ L  T  F ERKLA                Y
Sbjct: 293 KRHVGNLHKNSSFLTQEHSLHIFCRYLSRELARTREFVERKLAFTTEERTQELERLTDIY 352

Query: 366 ESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKVQGLDVKY 425
           +SP+Y + E ED     D  ++T  KE     +  NLPLGPDGFPIP WL K+QGLD++Y
Sbjct: 353 DSPVYGRQEQEDAQE--DENKETEDKEDSVLDSSMNLPLGPDGFPIPYWLYKLQGLDIEY 410

Query: 426 VCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELWKALQAKS 485
            CE+CGN +Y+GRR+F+KHF  ++H  GL+ LGI PS +FK VT I +  +LW  L++ S
Sbjct: 411 PCELCGNFVYNGRRQFDKHFGEQRHVFGLRRLGIEPSASFKGVTKIDDAKQLWSHLRSTS 470

Query: 486 TLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL 530
           +        ++S+  E ++ +E ED +GNVMS +VY+ELKKQGLL
Sbjct: 471 S-------GRVSS--EGKLEVEVEDEDGNVMSKKVYDELKKQGLL 506

>SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 601

 Score =  330 bits (845), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 194/540 (35%), Positives = 295/540 (54%), Gaps = 33/540 (6%)

Query: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAWA----VPKLDVSANRI 64
            E +R +LE LEVIE+AIS R+RRNPE++Y + E    +  E       VP  D+SANRI
Sbjct: 77  LEAKRSVLERLEVIENAISERIRRNPELYYSYYEEQRLVDKENHGLLPPVPASDISANRI 136

Query: 65  YXXXXXXXXXXQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFETV 124
           +          QI  Q++EI  FL  Y+R +  L   KL ++  E        FEQ E  
Sbjct: 137 HSVKKSRRSRKQIVLQQHEIDRFLEEYQREVARLHGIKLDKDDSE---SAAPDFEQLEKA 193

Query: 125 TTEVLEGQVN-SRSL--VEVKS-DYEMFSGPQAASKNIISPIGQIIDLSRNFARDENFGT 180
             +      + SR+L  V+V+S ++ MFS   +  K+I+S  G+ +D++R FARDE++G 
Sbjct: 194 VKDAKSRYADESRTLAGVDVESVEHSMFSSSTSTHKDILSTRGRDLDMNRLFARDEHYGE 253

Query: 181 YLDLSEQFKKWLNIIKRADLTILSFLKMLESFETYDYLLNPSLDRDTKEYNQLVTELLXX 240
           +L L     +WLNI+K   +T L F+ ++E F +  YL+ P+++R +K+Y   V  LL  
Sbjct: 254 FLLLEPFHHEWLNIVKDGSVTALQFMNVVEMFVSDAYLVAPAVNRGSKKYQDFVGSLLGY 313

Query: 241 XXXXXXXXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSEFN 300
                    PLV+   L + +   FD+Y+R  + +    E+  ++ +   RWF  ++ + 
Sbjct: 314 MSEFFRKTYPLVNHSTLGRRLAALFDEYLRAPVAD----ETKGLFCIPCGRWFKLETVYK 369

Query: 301 THVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXXXXXXX 360
           +H+  ++ +  L++    L+ EY  H +   L + + NT +F ER  A            
Sbjct: 370 SHLSGKKHSKNLAKGDGHLLAEYKLHKYCGLLVQTIANTRAFVERNRALTADERAQELER 429

Query: 361 XXXXYESPIYAKDESEDKPSYIDNAEDTAQK---ESMDPTNPYNLPLGPDGFPIPRWLIK 417
               YE+P Y++ E+ED       A +  QK   E+ +  NP+NLPLGPDG+PIP WL K
Sbjct: 430 LAKEYEAPAYSQHETEDA------AREKQQKREPETDEGGNPFNLPLGPDGYPIPYWLYK 483

Query: 418 VQGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTEL 477
           +QGLD++Y CEIC N  Y GRR FEKHF   +H  GL+ LGI PS  FK +T I E  +L
Sbjct: 484 LQGLDIEYSCEICSNHTYKGRRYFEKHFSEARHIFGLRCLGIEPSATFKGITKIQEAKDL 543

Query: 478 WKALQAKSTLKSG-------EPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL 530
           W  +Q  +++ +G          +  +T    ++ +E ED EGNVMS ++Y ELK+QGLL
Sbjct: 544 WARIQ--TSVATGVGAGAIASAATAAATPSTAKLEIEVEDEEGNVMSEKLYHELKRQGLL 601

>AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL030W (PRP9)
          Length = 527

 Score =  315 bits (808), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/538 (34%), Positives = 280/538 (52%), Gaps = 30/538 (5%)

Query: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAWA---VPKLDVSANRIY 65
            EE+R ILEELEVIE AIS+R+ RNPEI+Y + + L  +  +      + K D+++NRIY
Sbjct: 4   LEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSNRIY 63

Query: 66  XXXXXXXXXXQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFETVT 125
                     Q+  Q++EIA FL RY + +K L   K   + +E  RD N +FE FE   
Sbjct: 64  VNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFK--SDDIESLRDPNMNFETFEADI 121

Query: 126 TEVLEGQVNS-------RSLVEVKSDYEMFSGPQAASKNIISPIGQIIDLSRNFARDENF 178
            E+ E Q           SL   + +Y MFS    A + I+S +GQ ID+++ F  +E++
Sbjct: 122 KELQERQAEGADSESAISSLERKRREYSMFSASSGADQTILSNVGQFIDVNKLFMWEEHY 181

Query: 179 GTYLDLSEQFKKWLNIIKRADLTILSFLKMLESFETYDYLLNPSLDRDTKEYNQLVTELL 238
           G YL L    + WLN++K   +T+L F+  LESF    YL  P +DR++K Y   + +L+
Sbjct: 182 GEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAGTGYLTAPPVDRNSKRYQVFIQKLV 241

Query: 239 XXXXXXXXXXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSE 298
                      PL++  +L   I   F+ Y+   + + P      +  +   + F   + 
Sbjct: 242 TYLEGAFRNTYPLLNHRLLENRISQSFESYIANPVEDPPR----GLLCIACGKHFKVGTV 297

Query: 299 FNTHVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXXXXX 358
           F  H+  ++   +++     L  E+T H    +L+  ++NT +  ERK A          
Sbjct: 298 FAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNREM 357

Query: 359 XXXXXXYESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKV 418
                 Y++P Y+  E ED    +       Q    D  NP NLPLGP G+PIP WL K+
Sbjct: 358 ATIRDAYDAPAYSSGEPED----VIETPQQQQNAHPDDVNPLNLPLGPMGYPIPYWLYKL 413

Query: 419 QGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELW 478
           QGLD++Y CEIC N +Y GRR     F       GL+ LGI PS AFKD+  I E  +L+
Sbjct: 414 QGLDIEYACEICANHVYKGRRISNAIFRTAP-CYGLRCLGIEPSPAFKDIYNIAEAQQLF 472

Query: 479 KALQAK------STLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL 530
           ++LQ+       +T ++G   S  +T K   + +E ED +GNVM+ QVYE+LKKQGLL
Sbjct: 473 QSLQSSTGPAGLATRRAGAISSSANTRK---LEVEVEDEDGNVMTHQVYEDLKKQGLL 527

>Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {ON}
           YDL030W (PRP9) - RNA splicing factor [contig 184] FULL
          Length = 531

 Score =  308 bits (789), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 191/532 (35%), Positives = 292/532 (54%), Gaps = 34/532 (6%)

Query: 7   LCFEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAWA--VPKLDVSANRI 64
           + +E  R  LEELE+IE AI++RLRRNPEIFYR  + L  +  +A      +++ ++N+I
Sbjct: 26  VTYESSRSTLEELELIEGAIAARLRRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNKI 85

Query: 65  YXXXXXXXXXXQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQF--- 121
           Y          QI AQE+EI LFL  YR+  +SL+     E  L  ++ T+ S + F   
Sbjct: 86  YSVRKTKRTRKQILAQEHEIQLFLEEYRKKSESLRN---VEFDLRRYQVTDGSVDGFLEH 142

Query: 122 -ETVTTEVLEGQVNSRSLVEVKSDYEMFSGPQAASKNIISPIGQIIDLSRNFARDENFGT 180
            ET+ +EV +   +S        +Y MFS   AA ++I+S   + +D++  F R+E +G 
Sbjct: 143 IETINSEVPDDIDDSME------NYTMFSNSTAARRDILSKKARALDINAKFTREEQYGE 196

Query: 181 YLDLSEQFKKWLNIIKRADLTILSFLKMLESFETYDYLLNPSLDRDTKEYNQLVTELLXX 240
           +LDL    ++WL+++K   +++L FL  +E F T  +LL P+++R +  Y   V  LL  
Sbjct: 197 FLDLEPFHQQWLSVVKDGSVSLLQFLGEIEKFTTKRFLLTPAVNRGSARYQDFVKALLCY 256

Query: 241 XXXXXXXXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGK--MYSVVFNRWFDSQSE 298
                    PL D + +   I   +  Y      +S  +E+G   ++ +  ++ F +++ 
Sbjct: 257 LQDYLMRAYPLQDWDKIHAEIQATYCDY------KSHPEEAGDSGLFCIPCDKTFKAETV 310

Query: 299 FNTHVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXXXXX 358
           +  H+  ++    +++  + L +EY  H    +L + L  T  F ERKLA          
Sbjct: 311 YLAHLTGKKHINNMNKKDEFLAQEYKLHMLCCYLVQELVRTREFVERKLAFTPEERRQEM 370

Query: 359 XXXXXXYESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKV 418
                 YESP+Y + E ED      + + T  +E   P   ++LPLGPDGFPIP WL K+
Sbjct: 371 ERLTTVYESPVYGEQEQEDIAEA--DQKPTTNQEDSTPEPSFDLPLGPDGFPIPYWLYKL 428

Query: 419 QGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELW 478
           QGLD++Y CE+CGN IY GRR+F+KHF  ++H  GLK LG+ PS +FK VT+I +V +LW
Sbjct: 429 QGLDIEYPCEVCGNLIYKGRRQFDKHFTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQLW 488

Query: 479 KALQAKSTLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL 530
             L++          SK S    P+   E ED EGNVMS +VYEELKKQGL+
Sbjct: 489 AHLRSS---------SKASNAAGPKFEEEIEDEEGNVMSKKVYEELKKQGLI 531

>ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {ON}
           similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 506

 Score =  290 bits (743), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 191/529 (36%), Positives = 274/529 (51%), Gaps = 33/529 (6%)

Query: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYR--FNEALHNLGVEAWAVPKLDVSANRIYX 66
            E RR++LE LE+IEDAIS R  RNPE++Y     + L + G+E  +   + V  NRIY 
Sbjct: 4   LETRRQLLEGLEIIEDAISQRFGRNPELYYSNITKQVLIDGGIELPSTTAMAV--NRIYK 61

Query: 67  XXXXXXXXXQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFETVTT 126
                    Q+  Q++EI LFL +     K L     + + +E +RD   +F++F     
Sbjct: 62  SKRTKRSRKQLVTQQHEINLFLSQALDKQKELSGVNGTVD-VEDYRDEEINFDKFREAVD 120

Query: 127 EVLEGQVNSRSLV----EVKSDYEMFSGPQAASKNIISPIGQIIDLSRNFARDENFGTYL 182
           ++     +   L     E   ++EMFS   + S  I+S   + +DL++ F RDE +G  L
Sbjct: 121 QINSKYEDQEGLALDINENIVNHEMFSATFSKS-TILSESARDLDLNQIFTRDEQYGDLL 179

Query: 183 DLSEQFKKWLNIIKRADLTILSFLKMLESF-ETYDYLLNPSLDRDTKEYNQLVTELLXXX 241
           DL +   +WLN+IKRAD + L F  +L+ F +  +YLL+P +DR  + Y Q + EL    
Sbjct: 180 DLEKFHSQWLNVIKRADCSYLQFFDVLQKFLDPSEYLLSPPMDRKNERYGQFLIELFQYV 239

Query: 242 XXXXXXXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSEFNT 301
                    LV+  ILS+ + + F++Y+R  I +S    +  +Y V   +WF + + F +
Sbjct: 240 EQFFAKVYVLVNSTILSQRMESDFEEYLRMPIYKS----NHGLYCVACGKWFKTPTVFQS 295

Query: 302 HVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXXXXXXXX 361
           H+  +       +   +L  EY  H + K L   L+ T  F ERK+A             
Sbjct: 296 HLTGKHHRNNRDKRFTKLQAEYKLHRYLKILQGQLERTRGFVERKMAFTTEERMEEMSRL 355

Query: 362 XXXYESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKVQGL 421
              YE P YA DE E +     ++ DT  ++ M+      LPLG DG PIP WL K+QGL
Sbjct: 356 ARIYEGPDYAPDEKEIEEKE--DSVDTPSEKKMN--GGIELPLGLDGLPIPLWLYKLQGL 411

Query: 422 DVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELWKAL 481
           DV Y CEICGNQ Y GRR FE+HF    H   LK LGI  S AF+ +T+I E   LWK +
Sbjct: 412 DVTYSCEICGNQTYRGRRMFERHFTEPTHLFHLKCLGIEASDAFRSITSIEEAQNLWKRI 471

Query: 482 QAKSTLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL 530
              +T  S +              +E ED EGNVM+ QVYEELKKQGL+
Sbjct: 472 SGNNTTSSRD--------------IEVEDEEGNVMTQQVYEELKKQGLV 506

>KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {ON}
           Anc_3.160 YDL030W
          Length = 506

 Score =  286 bits (732), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 176/525 (33%), Positives = 266/525 (50%), Gaps = 25/525 (4%)

Query: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAWAVPK-LDVSANRIYXX 67
            EE+R + E+LEVIEDAI+ RL+RNPE++Y + E L +    +  VP  +D+  NR+Y  
Sbjct: 4   LEEKRDLCEDLEVIEDAIAKRLQRNPELYYNYLEKLSSFEKHSLEVPSSIDIKNNRVYKS 63

Query: 68  XXXXXXXXQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFETVTTE 127
                   QI AQ++EI LF+  Y    K L         L   +DT           T 
Sbjct: 64  KKAKRSKKQIVAQQHEIRLFIEDYTNKQKGLN-------MLMKRKDTTQISSDIGDFITS 116

Query: 128 VLEGQVNSRSLVEVKSDYEMFSGPQAASKNIISPIGQIIDLSRNFARDENFGTYLDLSEQ 187
           + E + + +S ++ K DY          K+I+S     +D+++ F RDE FG  +DL   
Sbjct: 117 ITENKSHVKSSLKDKIDYYSMFSASTTQKSILSKRAADLDINQTFTRDEQFGECMDLERF 176

Query: 188 FKKWLNIIKRADLTILSFLKMLESF-ETYDYLLNPSLDRDTKEYNQLVTELLXXXXXXXX 246
              WL+++K    ++L F +++ESF +T  YL +P +DR  + Y + +  +         
Sbjct: 177 HNVWLSVVKDDSYSLLDFFRVIESFLDTKSYLKSPHMDRKNQRYQEFIKTISGYVESFFF 236

Query: 247 XXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSEFNTHVQTE 306
               L+DKE ++  +   F  Y+     ++P       + V  N+ F ++S F+ H+  +
Sbjct: 237 KKFCLIDKEYVNARLQQDFILYL-----DNPLNNQNGFFCVACNKSFKTKSVFDNHLPGK 291

Query: 307 QFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXXXXXXXXXXXYE 366
           Q    + + R  L+ EY  + F   L     NT  FTERK++                Y 
Sbjct: 292 QHKRNVDKRRNSLISEYKLYRFLNLLRTEFNNTKEFTERKISFTANERREELERLNNEYN 351

Query: 367 SPIYAKDESEDKPSYIDN-AEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKVQGLDVKY 425
           +P+Y  +E E+     D  A     +  +D    +N+PLGPDG P+P WL K+QGLDV Y
Sbjct: 352 APVYGSEEQEEGDEEHDEYASKNGNRSILDGL--FNMPLGPDGVPMPFWLYKLQGLDVSY 409

Query: 426 VCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELWKALQAKS 485
            CEIC N+ + GRR FE+HF  K H   L+ LGITPS  F  +T I E   LW  +Q  S
Sbjct: 410 YCEICSNREFKGRRAFERHFNEKTHQYHLRCLGITPSPTFVGITAITEAQTLWDHIQ--S 467

Query: 486 TLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL 530
           T K   P  KI      +M +E ED +GNV++ +VY++LK+QGLL
Sbjct: 468 TQKKKAPSGKI------DMDIEVEDADGNVLTRKVYDDLKRQGLL 506

>Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  286 bits (731), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 189/537 (35%), Positives = 275/537 (51%), Gaps = 24/537 (4%)

Query: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRFN-EALHNLGVEAWAVPKLDVSANRIYXX 67
            E +R +LE+LE+IE+AI+ R++RNPE++YR+  EA           P L VS N+IY  
Sbjct: 4   LETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSL-VSENKIYKL 62

Query: 68  XXXXXXXXQIKAQEYEIALFLGRYR---RLLKSL---QKHKLSEEHLEYFRDTNASFEQF 121
                   Q+  Q++EI LFL  Y+   RL+  +   Q  +  E+ L  F       E+ 
Sbjct: 63  KKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFEQKLQELEEE 122

Query: 122 ETVTTEVLEGQVNSRSLVEVKSDYEMFSGPQAASK--NIISPIGQIIDLSRNFARDENFG 179
                E  +  +N +     +  Y +FS     SK  NI+S   + IDL+R F RDE +G
Sbjct: 123 LKNEQENYQLDINLK-----RGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYG 177

Query: 180 TYLDLSEQFKKWLNIIKRADLTILSFLKMLESF-ETYDYLLNPSLDRDTKEYNQLVTELL 238
            Y++L +    WLN+IKR D ++L F   +E F +   YLL P +DR    Y   + +L 
Sbjct: 178 EYMELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLS 237

Query: 239 XXXXXXXXXXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSE 298
                       L +KE++   I + FD     GI +S   ES  +Y  +  +WF +Q+ 
Sbjct: 238 EYVESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKS---ESKGIYCPLCYKWFKTQAV 294

Query: 299 FNTHVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXXXXX 358
           F  H+  +      ++ ++ +  EY  H + + L   L +T SF ERKLA          
Sbjct: 295 FENHIPGKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEM 354

Query: 359 XXXXXXYESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKV 418
                 YE+P Y   E ED        +D   +E       +++PLGPDG P+P WL K+
Sbjct: 355 DSLTQKYEAPAYDATEREDDGKGGGEQKDDKLQEKHLFGKSFDMPLGPDGLPMPYWLYKL 414

Query: 419 QGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELW 478
            GLD +Y CEIC N+IY+GRR FE+HF  + H   L+ LGI PS  FK +T I E   LW
Sbjct: 415 HGLDREYPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLW 474

Query: 479 KALQAK----STLKSGEPFSKISTVKEPE-MVLETEDNEGNVMSVQVYEELKKQGLL 530
           K  Q++    S++ +     K+S  K P  M LE ED +GNVMS +VY+ELKKQGL+
Sbjct: 475 KNTQSQPQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531

>TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  285 bits (729), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 183/534 (34%), Positives = 271/534 (50%), Gaps = 24/534 (4%)

Query: 10  EERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAWAVPKLDV-SANRIYXXX 68
           EERR +LE+LEVIE +I+ R +RNPE++Y++ E L  +      +P   V + N+IY   
Sbjct: 5   EERRSLLEDLEVIESSITKRFQRNPELYYKYQEGLKKVVDPDIDLPSKTVRNTNKIYKTR 64

Query: 69  XXXXXXXQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFETVTTEV 128
                  QI  Q+YEI  FL  YRR  K L K KL    +  FRD  A F +FE +   +
Sbjct: 65  KHKRKRKQILLQQYEINEFLDDYRRKEKQLMKQKLD---ISEFRDKGADFVKFEELLESI 121

Query: 129 LEGQV-------NSRSLVEVKSDYEMFSGPQA--ASKNIISPIGQIIDLSRNFARDENFG 179
                        +  L++ K  Y MFS      +  NI+S   Q++DL+  F+++E +G
Sbjct: 122 NNEYNNQNEETPTNLKLLDKKDKYAMFSSSININSPNNILSKRSQLLDLNNYFSKEEQYG 181

Query: 180 TYLDLSEQFKKWLNIIKRADLTILSFLKMLESFETYD-YLLNPSLDRDTKEYNQLVTELL 238
             L+L + +  WLN++K AD +IL ++ ML  F   D ++LN  +DR    Y   +  +L
Sbjct: 182 EILNLEQFYSSWLNVVKTADCSILKYILMLNVFLDKDEFILNSPMDRKNLRYVDFI-RIL 240

Query: 239 XXXXXXXXXXXPLVDKEILSKT-IHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQS 297
                       +++  I  KT +   F+KY    I     KE      +   +WF + +
Sbjct: 241 SKYFESYLEKRYILNNWINFKTELKKSFEKYSIKPIV----KEKKGYLCISCGKWFKNSN 296

Query: 298 EFNTHVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXXXX 357
            ++ H++ +Q     S  +  L  EY  H    +L      + ++ ERKLA         
Sbjct: 297 VYDGHLKGKQHEKHYSNRKMFLYNEYKLHRIINYLKYEFDESKAYMERKLAFTNTERNNE 356

Query: 358 XXXXXXXYESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIK 417
                  YE P Y KDE E+   Y +  +++    + D    +N+PLGPDG PIP WL K
Sbjct: 357 LKLLTKKYEEPAYNKDEPENTDKY-EEDDNSMSNAAEDRNKSFNMPLGPDGMPIPLWLYK 415

Query: 418 VQGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTEL 477
           +QGLD+KY CEICGN+ Y GR+ +E HF    H+  L  LGI  S AFK +T+I E   L
Sbjct: 416 LQGLDIKYNCEICGNKEYQGRKAYENHFSELTHTSHLYFLGIQYSKAFKGITSIAEAKSL 475

Query: 478 WKALQAKSTLKSGEPFSKISTVKEPEMV-LETEDNEGNVMSVQVYEELKKQGLL 530
           W ++ A +   S   FS  +  K      +E ED+EGNVMS ++Y+ELKKQ L+
Sbjct: 476 WSSMHASNG--SAASFSNQNNTKLAMTEDIEVEDSEGNVMSKKIYDELKKQNLV 527

>NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.160
           YDL030W
          Length = 518

 Score =  276 bits (705), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 183/536 (34%), Positives = 280/536 (52%), Gaps = 38/536 (7%)

Query: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALH---NLGVEAWAVPKLDVSANRIY 65
            E++R +LE+LEVIEDAI+ R +RNPE++Y     L    NL ++  A  + + S N+IY
Sbjct: 5   LEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPA--ESNKSNNKIY 62

Query: 66  XXXXXXXXXXQIKAQEYEIALFLGRY---RRLLKSLQKHKLSEEHLEYFRDTNASFEQFE 122
                     Q   Q+ EI +FL  +   RR+L  L K        E  +D N + E F+
Sbjct: 63  KRKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGK--------ETVKDDNITLETFK 114

Query: 123 TVTTEVLEGQVNSRSLV--EVKSDYEMFSGPQAASK--NIISPIGQIIDLSRNFARDENF 178
           T+  ++   + +S  L   +  + Y MFS   + SK  NI+S     +D+++ F+R+E +
Sbjct: 115 TMIQDINAKKSSSEVLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQY 174

Query: 179 GTYLDLSEQFKKWLNIIKRADLTILSFLKMLESF-ETYDYLLNPSLDRDTKEYNQLVTEL 237
           G Y+D    + +WLN++K  D+T+L FL +L  F +   YL +P +DR    Y + +  L
Sbjct: 175 GQYMDFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESL 234

Query: 238 LXXXXXXXXXXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGK-MYSVVFNRWFDSQ 296
                        L++K  ++  I + F +Y++      P++ S K  Y     +WF ++
Sbjct: 235 CSYVESFFFRKYALINKSAITSQIESQFTEYIK-----EPTEHSVKGQYCKACAKWFKTE 289

Query: 297 SEFNTHVQTEQFNIALSRNRKR-LMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXX 355
           S F  H+  +  +I   + RK  L+ EY  H F   L +  + T  F E K+A       
Sbjct: 290 SVFVNHIPGKN-HIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERM 348

Query: 356 XXXXXXXXXYESPIYAKDESEDKPSYID--NAEDTAQKESMDPTNPYNLPLGPDGFPIPR 413
                    YE P Y+ DE E   +  D  + E  + K        +++PLGPDG P+P 
Sbjct: 349 EEMKRLTENYEKPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPF 408

Query: 414 WLIKVQGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVE 473
           WL K+QGLDV+Y CEIC NQI+ GRR FEKHF    H   L+ LGI PS  FK +T I E
Sbjct: 409 WLYKLQGLDVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKE 468

Query: 474 VTELWKALQAKSTLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGL 529
             +LW  + ++    S +P   +S++   E+ +E ED+ GNVMS ++Y+ELKKQGL
Sbjct: 469 AQKLWVDINSQKN--SSKPM--VSSI---ELQVEVEDSVGNVMSKKLYDELKKQGL 517

>YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subunit
           of the SF3a splicing factor complex, required for
           spliceosome assembly; acts after the formation of the U1
           snRNP-pre-mRNA complex
          Length = 530

 Score =  275 bits (702), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 183/530 (34%), Positives = 268/530 (50%), Gaps = 11/530 (2%)

Query: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAWAVPKLDVSANRIYXXX 68
            E RR +LEE+E+IE+AI+ R++RNPE++Y + +    +  +        ++ N+IY   
Sbjct: 4   LETRRSLLEEMEIIENAIAERIQRNPELYYHYIQESSKVFPDTKLPRSSLIAENKIYKFK 63

Query: 69  XXXXXXXQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFETVTTEV 128
                  QI  Q++EI +FL  Y+   ++  K    EE  E  +D      + + +  E+
Sbjct: 64  KVKRKRKQIILQQHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLEKEL 123

Query: 129 LEGQVNSRSLVEVKSD-YEMFSGPQAASK--NIISPIGQIIDLSRNFARDENFGTYLDLS 185
                N    +  K D Y +FS     S+  NI+S   + +DL+  F RDE +G Y++L 
Sbjct: 124 KNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYMELE 183

Query: 186 EQFKKWLNIIKRADLTILSFLKMLESF-ETYDYLLNPSLDRDTKEYNQLVTELLXXXXXX 244
           +    WLN+IKR D ++L FL +LE F +   YLL P +DR    Y   + +L       
Sbjct: 184 QFHSLWLNVIKRGDCSLLQFLDILELFLDDEKYLLTPPMDRKNDRYMAFLLKLSKYVETF 243

Query: 245 XXXXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSEFNTHVQ 304
                 L+D   +   I + F+     G   S   E+  +Y    +RWF + S F +H+ 
Sbjct: 244 FFKSYALLDAAAVENLIKSDFEHSYCRGSLRS---EAKGIYCPFCSRWFKTSSVFESHLV 300

Query: 305 TEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXXXXXXXXXXX 364
            +      S+ R  +  EY  H + K+L+     T SF ERKLA                
Sbjct: 301 GKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQK 360

Query: 365 YESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKVQGLDVK 424
           YE+P Y   E E          D   +E       +++PLGPDG P+P WL K+ GLD +
Sbjct: 361 YEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420

Query: 425 YVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELWKALQAK 484
           Y CEIC N++Y+GRR FE+HF  ++H   L+ LGI PS  FK +T I E  ELWK +Q +
Sbjct: 421 YRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQ 480

Query: 485 STLKS---GEPFSKISTVKEP-EMVLETEDNEGNVMSVQVYEELKKQGLL 530
           S L S     P    S +K P E+ LE ED EGNVMS +VY+ELKKQGL+
Sbjct: 481 SQLTSIAAVPPKPNPSQLKVPTELELEEEDEEGNVMSKKVYDELKKQGLV 530

>Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  269 bits (688), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 179/538 (33%), Positives = 271/538 (50%), Gaps = 26/538 (4%)

Query: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRF-NEALHNLGVEAWAVPKLDVSANRIYXX 67
            E RR +LE+LE+IE+AI+ R++RNPE++Y +  E+           P L ++ N+IY  
Sbjct: 4   LETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSL-IAENKIYKL 62

Query: 68  XXXXXXXXQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFETVTTE 127
                   Q+  Q++EI LFL  Y    K+  +      +LE   + +   ++FE    E
Sbjct: 63  KKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNE----SNNLEGVEEDDKEVDRFEQNLQE 118

Query: 128 VLEGQVNSRSLVEV-----KSDYEMFSGPQAASK--NIISPIGQIIDLSRNFARDENFGT 180
           + E   N     ++     +S Y +FS     SK  NI+S   + +DL++ F RDE +G 
Sbjct: 119 LEERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGE 178

Query: 181 YLDLSEQFKKWLNIIKRADLTILSFLKMLESF-ETYDYLLNPSLDRDTKEYNQLVTELLX 239
           Y++L +    WLN+I+R+D ++L F  +LE F +   +LL P +DR    Y   +  L  
Sbjct: 179 YMELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSK 238

Query: 240 XXXXXXXXXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSEF 299
                      L DKE++  +I + F+     G+  S   E+  +Y    ++WF +   F
Sbjct: 239 YLETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRS---EAKGIYCPFCSKWFKTFPVF 295

Query: 300 NTHVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXXXXXX 359
             H+  +      ++ +  +  EY  H + K+L     +T SF ERKLA           
Sbjct: 296 ENHLSGKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMD 355

Query: 360 XXXXXYESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKVQ 419
                YE+P Y   E E         +    +E       +++PLGPDG P+P WL K+ 
Sbjct: 356 SLTEKYEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLH 415

Query: 420 GLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELWK 479
           GLD +Y CEIC N++Y+GRR FE+HF  + H   L+ LGI PS AFK +T I EV +LWK
Sbjct: 416 GLDREYPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLWK 475

Query: 480 ALQAKSTLKSGEPFSKISTVKEPEM-------VLETEDNEGNVMSVQVYEELKKQGLL 530
            +Q +   +SG   +   T K P          LE ED EGNVMS +VY+ELKKQGL+
Sbjct: 476 DIQNQH--RSGSSTAVALTKKSPSQPKLPTGLELEEEDEEGNVMSKKVYDELKKQGLV 531

>TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {ON}
           Anc_3.160 YDL030W
          Length = 516

 Score =  267 bits (683), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 185/537 (34%), Positives = 267/537 (49%), Gaps = 39/537 (7%)

Query: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRF--NEALHNLGVEAWAVPKLDVSANRIYX 66
            E RR  LE+LEVIE +I+SR  RNP ++Y +    AL +    + ++     +ANRIY 
Sbjct: 4   LESRRSHLEDLEVIEQSIASRFERNPGLYYGYLQKRALIDDIPLSSSITNA-YNANRIYK 62

Query: 67  XXXXXXXXXQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFETVTT 126
                    Q   Q++EI LFL    R L+ L   K    +    RD  A+FE F+    
Sbjct: 63  AKRSKRNRKQFVLQQHEIDLFLQESMRKLRDLGSLK-GPVNTHSLRDEEATFEIFKQNLE 121

Query: 127 EVLEG--QVNSRSLV----EVKSDYEMFSGPQAASK--NIISPIGQIIDLSRNFARDENF 178
           E+ +    + S SL     E  S + MFS     SK   I+S   + + L+  F+R+E +
Sbjct: 122 EIKDKYKDLGSDSLFSDVNEEISKHAMFSALTTDSKPVTILSRSAKNLRLNDVFSREEQY 181

Query: 179 GTYLDLSEQFKKWLNIIKRADLTILSFLKMLESF-ETYDYLLNPSLDRDTKEYNQLVTEL 237
           G YLDL      WLN+I+  + T+L F  +LE F +   Y+L P +DR    Y + + E+
Sbjct: 182 GEYLDLDRFHSSWLNVIRSTECTLLQFYSILEKFLDDRQYILAPPMDRKNGRYAEFLVEI 241

Query: 238 LXXXXXXXXXXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGK-MYSVVFNRWFDSQ 296
                        L++   L + I + F + + T     P    GK  Y +   +WF   
Sbjct: 242 SNYLEKFFQKANVLLNHTKLERRIQSEFSRSLAT-----PLHTGGKGFYCIACCKWFKVP 296

Query: 297 SEFNTHVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXXX 356
           + F++H+  +     LS+  K L  EY  H +   LS+  + T  FTERK+A        
Sbjct: 297 TVFDSHLTGKHHKNNLSKRSKHLQAEYKLHRYLTLLSEEFRRTREFTERKVAFTAEERMQ 356

Query: 357 XXXXXXXXYESPIYAKDESEDKPSYIDNAE---DTAQKESMDPTNPYNLPLGPDGFPIPR 413
                   Y +P Y  DE E +    + AE   ++A   S D      LPLG DG PIP 
Sbjct: 357 EMARLNHDYHAPDYGPDEKEQEDPDSNKAELDKNSALGGSFD------LPLGADGLPIPY 410

Query: 414 WLIKVQGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVE 473
           WL K+QGLDV+Y CEIC NQ Y GRR FEKHF    H+  LK LGI PS+ FK +T I E
Sbjct: 411 WLYKLQGLDVEYSCEICTNQTYKGRRAFEKHFLEPTHTFHLKCLGIEPSITFKGITGIQE 470

Query: 474 VTELWKALQAKSTLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL 530
             +LW+   +++  ++           + ++ LE ED EGNV++ +VY+ELKKQGL+
Sbjct: 471 AQDLWRQTSSRNRPQT-----------QKKIDLEVEDQEGNVLTQKVYQELKKQGLV 516

>NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.160
           YDL030W
          Length = 536

 Score =  263 bits (672), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 174/549 (31%), Positives = 282/549 (51%), Gaps = 39/549 (7%)

Query: 5   TYLCFEERRKILEELEVIEDAISSRLRRNPEIFY----RFNEALHNLGVEAWAVPKLDVS 60
           ++L  E+RR +LE+LE+IE+AIS+R +RNPE++Y    + +E   +  VE      + ++
Sbjct: 2   SHLDLEKRRSLLEDLEIIENAISTRFQRNPELYYSNLKKVSELFPSKQVEELPTHSI-MT 60

Query: 61  ANRIYXXXXXXXXXXQIKAQEYEIALFLGRYRRLLKSLQ--------KHKLSEEHLEYFR 112
            N+IY          QI  Q++EI+LF+  +    K L+        K K ++E +    
Sbjct: 61  NNKIYKTKKLKRNRKQIALQQHEISLFIKDFFSKQKELETLTREANFKAKKNKEEIL--- 117

Query: 113 DTNASFEQFETVTTEVLEGQVN---SRSLVEVK---SDYEMFSGP--QAASKNIISPIGQ 164
                 E+F+ + +E+ E   N   +R  +E+    + Y MFS    ++    I+S    
Sbjct: 118 ---LPVEEFKDILSEINEADGNENGNRRELEINDKINKYSMFSNSLNKSHPSTILSSRAS 174

Query: 165 IIDLSRNFARDENFGTYLDLSEQFKKWLNIIKRADLTILSFLKMLESFET-YDYLLNPSL 223
            +D++  F+ +E +G YL L+  + +WLN++K+ DLT L FL ML+ F+    Y++ P +
Sbjct: 175 DLDINSIFSLEEQYGEYLALNPYYTEWLNVVKKEDLTFLQFLNMLKIFQDDKRYIVQPPM 234

Query: 224 DRDTKEYNQLVTELLXXXXXXXXXXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGK 283
           DR  + Y + +               PL+D    S+ +   F+K     I +    E   
Sbjct: 235 DRKNEPYMKYLQRYCSYLESFFERKYPLIDSRYTSRELKKEFNK----SIIKPLENEKKG 290

Query: 284 MYSVVFNRWFDSQSEFNTHVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFT 343
            +     +WF + + F +H+  ++   + ++  + L  EY  H +S  L +  Q+T  F 
Sbjct: 291 FFCKTCCKWFKTLTVFESHLNGQKHIKSYNKRVQGLYAEYKTHRYSMLLKEEHQSTCEFV 350

Query: 344 ERKLAXXXXXXXXXXXXXXXXYESPIYAKDESEDKPSYID-NAEDTAQKESMDP--TNPY 400
           ERK+A                 ++P Y  +E E   +  + N +D  + +      +   
Sbjct: 351 ERKMAFTVEERITEMKRLAEICKAPAYDVNEKEGDENNTELNVKDNLKNDGASAMLSGSI 410

Query: 401 NLPLGPDGFPIPRWLIKVQGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGIT 460
           N+PLGPDG P+P WL K+QGLDV Y CEIC NQI+ GRR F+KHF    H   L+ LGI 
Sbjct: 411 NMPLGPDGLPMPFWLYKLQGLDVSYPCEICSNQIFKGRRTFDKHFTEATHIYHLRCLGIE 470

Query: 461 PSLAFKDVTTIVEVTELWKALQAKSTLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQV 520
           P+ AFK VT I E   LW  ++   T+   + F  I T+ + +M +E ED EGN+M+ +V
Sbjct: 471 PTPAFKGVTKIEEAQRLWNNMK-NDTIMGDKKF--IETIPD-KMAIEVEDKEGNIMTQKV 526

Query: 521 YEELKKQGL 529
           Y+ELKKQGL
Sbjct: 527 YDELKKQGL 535

>Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}
           complement(50993..52546) [1554 nt, 518 aa]
          Length = 517

 Score =  262 bits (669), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 170/532 (31%), Positives = 275/532 (51%), Gaps = 30/532 (5%)

Query: 10  EERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNL--GVEAWAVPKLDVSANRIYXX 67
           E  R +LE++EVIEDAIS R +RNPE++Y +++ L+++  G E       + S+NRIY  
Sbjct: 5   ENVRSLLEDIEVIEDAISKRFQRNPEVYYYYSQQLNDINGGGEETKTVVSNRSSNRIYKS 64

Query: 68  XXXXXXXXQIKAQEYEIALFLGRYRRLLKSLQKHKLSEE----HLEYFRDTNASFE-QFE 122
                   Q+  Q+YE   F+   R  L  +++  +++E     L+ + +   S + ++E
Sbjct: 65  RKHKRDRKQVILQQYETNEFIKDIRSKLNEIREINVTKESNGIKLDRYVELMGSIDTKYE 124

Query: 123 TVTTEVLEGQVNSRSLVEVKSDYEMFSGPQAASK--NIISPIGQIIDLSRNFARDENFGT 180
              ++  +  +N          Y MF+   + +K  NI+S   + ++++  F RDE +G 
Sbjct: 125 DSVSDNQQLPINKTIF-----QYSMFTSSNSKNKPNNILSDKCKYLEINDYFTRDEQYGE 179

Query: 181 YLDLSEQFKKWLNIIKRADLTILSFLKMLESF-ETYDYLLNPSLDRDTKEYNQLVTELLX 239
           YL+L   +  WLN+IK A+ +IL ++ ++E F ++  Y+L P +DR  + Y + +  +  
Sbjct: 180 YLELERFYNNWLNVIKSANCSILQYMSIIEKFLDSAQYILQPPMDRKNERYLKFLEIIET 239

Query: 240 XXXXXXXXXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSEF 299
                      L+D E  ++ +   ++       T+S  K+    +  +  +WF ++S F
Sbjct: 240 YLTSFIKKTYVLIDWEEEAEVLKYDYE----IECTKSLMKQGKGNFCRLCGKWFKTESVF 295

Query: 300 NTHVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXXXXXX 359
             H+  +       +       E+  H    +LSK  + T  F ERKLA           
Sbjct: 296 ENHLPGKNHVKNYKKYYDEYFIEFKIHRILNWLSKEFEETKLFLERKLAFTSDERIKEID 355

Query: 360 XXXXXYESPIYAKDESED-KPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKV 418
                YE P Y+  E E+ KP+  +N+  T+  ++      +++PLGPDG P+P WL K+
Sbjct: 356 RMTEVYERPAYSVGEPEEGKPN--ENSSKTSSNKNDIINGSFDMPLGPDGLPMPYWLYKL 413

Query: 419 QGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELW 478
           QGLD+ Y CEIC N IY GRR FEKHF    H+  L+ LGI PS AFK + +I E T+LW
Sbjct: 414 QGLDMTYKCEICANTIYKGRRTFEKHFSETTHNYHLRCLGIEPSSAFKGIVSIKEATDLW 473

Query: 479 KALQAKSTLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL 530
             +  K      +  SK +     E  +E ED EGNV+S ++YEELKKQGLL
Sbjct: 474 GTMNVK------DKSSKHAESNNYE--IEVEDKEGNVLSKEIYEELKKQGLL 517

>CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030w
           Pre-mRNA splicing factor PRP9
          Length = 516

 Score =  261 bits (666), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 172/539 (31%), Positives = 264/539 (48%), Gaps = 50/539 (9%)

Query: 13  RKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAWAVPKL----DVSANRIYXXX 68
           R +LE++EVIEDAISSR +RNPE++Y +   +H  G+    +PKL    D   N+IY   
Sbjct: 7   RSLLEDIEVIEDAISSRFQRNPELYYDYR--IHLEGIRD-DIPKLGLDDDRMVNKIYKAR 63

Query: 69  XXXXXXXQIKAQEYEIALFLGRYRRLLKSLQK--HKLSEEHLEYFRDTNASFEQFETVTT 126
                  Q + Q+YEI  FL    +  K + K  ++L  + L+Y +D+   FE  + +  
Sbjct: 64  KHKRTLKQKRTQQYEINTFLDDIFKKNKYILKVRNQLKSDGLKY-KDSECKFELLKKLLG 122

Query: 127 EVLE---------GQVNSRSLVEVKSDYEMFSGPQAASKNIISPIGQIIDLSRNFARDEN 177
           +             + NS  L+++      ++      K ++S    ++D++  F +DE 
Sbjct: 123 DEPTEDEDEDDSISKSNSSRLLDIDETINRYNMNLGNGK-LVSERCSLLDINTIFQKDEQ 181

Query: 178 FGTYLDLSEQFKKWLNIIKRADLTILSFLKMLESF-ETYDYLLNPSLDRDTKEYNQLVTE 236
            G  +D    +++WLNI+K   LT   F+  LE F +   YLL+P +DR TK Y + V E
Sbjct: 182 DGFIIDFEPLYRRWLNIVKDGTLTYPKFISNLEKFIDDKKYLLDPVMDRKTKGYCEFVVE 241

Query: 237 LLXXXXXXXXXXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQ 296
                         L+++E +   +H  F+ +V   I      ESG  Y +  ++ F+S 
Sbjct: 242 ACDFVETQYFKRNILLNEEQIKGKLHRDFENHVTKAII----TESGIYYCLYCDKMFNSA 297

Query: 297 SEFNTHVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXXX 356
             +++H   +  + ++S        E+  H +   + +  +NT  + +RK+A        
Sbjct: 298 HIYDSHRTGKAHSKSVSNYHDSFRAEFKLHVYVSCMREEFENTKEYVDRKMAFTNKERLE 357

Query: 357 XXXXXXXXYESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPY-----NLPLGPDGFPI 411
                   Y  P+Y   E E      D  ED ++ ++ D          ++PLGPDG PI
Sbjct: 358 EMEKLTQEYHRPVYDPTEKEG-----DVEEDNSKSKTKDELKEMLGLGEDMPLGPDGLPI 412

Query: 412 PRWLIKVQGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTI 471
           P WL K+QGLDV   CEICGNQ+Y G + F+KHF    H+  LK LGI PS AF+ +T I
Sbjct: 413 PYWLYKLQGLDVGQECEICGNQVYKGHKNFDKHFSGPTHTYHLKCLGIEPSSAFQGITKI 472

Query: 472 VEVTELWKALQAKSTLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELKKQGLL 530
            E   LWK +Q  +T                E+  E ED EGNVMS  +YEELKKQGL+
Sbjct: 473 KEAQALWKQMQRNTT---------------QELAEEVEDKEGNVMSKDIYEELKKQGLV 516

>KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  258 bits (659), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 170/545 (31%), Positives = 271/545 (49%), Gaps = 39/545 (7%)

Query: 7   LCFEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEA---WAVPKLDVSANR 63
           +  +ER  ++ +LE++EDAI++R +RNP ++Y     L  L ++A      P+  V+ N+
Sbjct: 1   MGLDERVSLIRQLEILEDAIAARFQRNPALYYNSVPMLKKLTMQAEPKVCPPQDHVTKNK 60

Query: 64  IYXXXXXXXXXXQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFET 123
           +Y          Q+  Q++EI LFL     +L  L + + S      +++     ++F+T
Sbjct: 61  VYRVEKSARKVKQVATQQHEIKLFLQDRTDILNKLSRAQESGPGESQYKN----LDEFKT 116

Query: 124 VTTEVLEGQVNSRSLVEVKSD-YEMFSGP-QAASKNIISPIGQIIDLSRNFARDENFGTY 181
               + E  +  RS ++ + D Y MFS   +    NI+S     +D++  F R+E +GTY
Sbjct: 117 AINGLTESNIPKRSGLQSEKDQYAMFSSSIEKPPTNILSARALELDINAIFNREEQYGTY 176

Query: 182 LDLSEQFKKWLNIIKRADLTILSFLKMLESF-----ETYDYLLNPSLDRDTKEYNQLVTE 236
           + L      WL ++K   +T+L +L+ LE       +   YL +P +DRD K+Y + +  
Sbjct: 177 IQLENYHPMWLELMKEPSVTVLQYLESLERMFLNADDKTSYLTSPPIDRDNKQYLRFLER 236

Query: 237 LLXXXXXXXXXXXPLVDKEILSKTIHNGF-DKYVRTGITESPSKESGKMYSVVFNRWFDS 295
           L            PL+D+ ++   + + F ++YV   +    S +    +  V ++ ++ 
Sbjct: 237 LGLYLKTYIAKKFPLIDQHLVEDYLLDHFKNRYVNKPV----STDQNTQFCPVCDKRYEG 292

Query: 296 QSEFNTHVQTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXX 355
              FN H+  +       +    L  E+    +   LSK  +++ +F ERKLA       
Sbjct: 293 MQLFNDHLLNKFHAQQRGKRLPLLQAEFRVSVYLTALSKEFKDSKNFMERKLAFTYAERQ 352

Query: 356 XXXXXXXXXYESPIYAKD-ESEDKPSYIDNAED---------TAQKESMDPTNPYNLPLG 405
                    YE+P Y    E ED P+  D  ++         TA+ ESM      N+PLG
Sbjct: 353 EELQRLTTEYEAPNYNPALEHEDNPAETDKNKNGKTHSENKQTAELESMFT----NMPLG 408

Query: 406 PDGFPIPRWLIKVQGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAF 465
           PDG PIP WL K+QGLDVKY CEICGN  + GRR ++KHF    H   LK LGIT S AF
Sbjct: 409 PDGMPIPLWLYKLQGLDVKYTCEICGNAEFKGRRAYQKHFHEPLHEYRLKCLGITRSKAF 468

Query: 466 KDVTTIVEVTELWKALQAKSTLKSGEPFSKISTVKEPEMVLETEDNEGNVMSVQVYEELK 525
             +  I E  ELW  +  KST       ++  +    ++ +E ED +GNVMS  VY++LK
Sbjct: 469 DGIALIEEAQELWAKISGKST------SARAGSDDSLKLEIEVEDEDGNVMSQTVYQDLK 522

Query: 526 KQGLL 530
           +QGLL
Sbjct: 523 RQGLL 527

>Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  257 bits (657), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 171/534 (32%), Positives = 270/534 (50%), Gaps = 18/534 (3%)

Query: 9   FEERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAWAVPKLD-VSANRIYXX 67
            E RR +LE++E+IE+AI  R+RRNPE++Y + +    +  +   +PK   ++ N+++  
Sbjct: 4   LETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDV-KLPKSSLIAENKLFKI 62

Query: 68  XXXXXXXXQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFETVTTE 127
                   Q+  Q++EI+LFL  Y    KS           E  +D  +  E+   +  E
Sbjct: 63  KKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQLEDE 122

Query: 128 VLEGQVNSRSLVEVKSD-YEMFSGPQAASK--NIISPIGQIIDLSRNFARDENFGTYLDL 184
           +   + N +  +  K + Y +FS    +SK  NI+S   + +DL++ F RDE +G Y++L
Sbjct: 123 LKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEYMEL 182

Query: 185 SEQFKKWLNIIKRADLTILSFLKMLESF-ETYDYLLNPSLDRDTKEYNQLVTELLXXXXX 243
            +    WLN+ KR+D ++L F  ++E F +   YLL P +DR    Y   + +L      
Sbjct: 183 EQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLCKYLET 242

Query: 244 XXXXXXPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSEFNTHV 303
                  L DKE++  +I   F++    G   S   E+  ++     +WF +   F  H+
Sbjct: 243 FFFKSYALFDKEVIESSIRFDFEQSYCKGSLRS---EAKGIHCPFCYKWFKTSPVFENHL 299

Query: 304 QTEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAXXXXXXXXXXXXXXX 363
             +       + +  +  EY  H + K+L     +T SF ERKL                
Sbjct: 300 TGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQ 359

Query: 364 XYESPIY-AKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKVQGLD 422
            YE+P Y   D+  D+    D  +D  Q++       +++PLGPDG P+P WL K+ GLD
Sbjct: 360 KYEAPAYDPTDKDGDQQKGSDQRDDQLQEKHF-FGKSFDMPLGPDGLPMPHWLYKLHGLD 418

Query: 423 VKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELWKALQ 482
            +Y CEIC N++Y+GRR FE+HF    H   L+ LGI PSLAFK +T I E  +LW+ +Q
Sbjct: 419 REYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENMQ 478

Query: 483 AKSTLKSGEPFSKISTVKEPEMVLET------EDNEGNVMSVQVYEELKKQGLL 530
            K    +    S ++ +K     L T      ED EGNVMS +V++ELKKQGL+
Sbjct: 479 -KQPQSATSIASSLTKLKHSRSKLPTELELEEEDEEGNVMSKKVFDELKKQGLV 531

>TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.160
           YDL030W
          Length = 486

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 407 DGFPIPRWLIKVQGLDVKYVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITP--SLA 464
           DG  +PRWL ++QGL   + CE+C  + +HGR  +E+HF   +H   L  LG+     + 
Sbjct: 356 DGRHVPRWLYRLQGLSSIFTCELCDGREFHGRTRYERHFTSTQHRTRLVCLGVPAEQHVQ 415

Query: 465 FKDVTTIVEVTEL 477
           F+ +  +  V EL
Sbjct: 416 FRGLGKLDAVLEL 428

>Skud_4.212 Chr4 complement(370995..371795) [801 bp, 266 aa] {ON}
           YDL043C (REAL)
          Length = 266

 Score = 37.4 bits (85), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 424 KYVCEICGNQIYHGRREFEKHFPLKKHSEGL--KSLGITPSLAFKDVTTIVEVTELWKAL 481
           K VC++C N ++      E+H   KKH   +  + + I  S   K+     +     K +
Sbjct: 65  KLVCKLC-NTMHMSWSSVERHLGGKKHGLNVLRRGISIEKSSRGKEGQATQDFQRQQKII 123

Query: 482 QAKSTLKSGE--PFSKISTVKEPE 503
           +AK +LK+    P SK++TVK+P+
Sbjct: 124 EAKQSLKNNGVVPVSKVATVKDPK 147

>Suva_4.208 Chr4 complement(364168..364968) [801 bp, 266 aa] {ON}
           YDL043C (REAL)
          Length = 266

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 43/84 (51%), Gaps = 5/84 (5%)

Query: 424 KYVCEICGNQIYHGRREFEKHFPLKKHSEGL--KSLGITPSLAFKDVTTIVEVTELWKAL 481
           K VC++C N ++      E+H   KKH   +  + + I  +   ++     +     K +
Sbjct: 65  KLVCKLC-NTMHMSWSSVERHLGGKKHGLNVLRRGISIEKNSQGRNGQATQDFQHQQKII 123

Query: 482 QAKSTLKSGE--PFSKISTVKEPE 503
           +AK +LK+    P SKI+TVK+P+
Sbjct: 124 EAKQSLKNNGVVPVSKIATVKDPK 147

>AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR196W (PWP1)
          Length = 562

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 13/76 (17%)

Query: 445 FPLKKHSEGLKSLGITPSLAFKDVTTIV--EVTELWKALQAKSTLKSGEPFSKISTVKEP 502
           + L  H  G+ SL ++PS+    VT+ +  +V +LWK            P    S  + P
Sbjct: 401 WTLNAHDSGISSLSVSPSIPNMLVTSAMGEKVIKLWKT-----------PAEGASAQEGP 449

Query: 503 EMVLETEDNEGNVMSV 518
            MVL  +   GNV+S 
Sbjct: 450 RMVLSRDFGVGNVLST 465

>Skud_10.105 Chr10 complement(179830..185142) [5313 bp, 1770 aa]
           {ON} YJL109C (REAL)
          Length = 1770

 Score = 34.3 bits (77), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 57/131 (43%), Gaps = 8/131 (6%)

Query: 76  QIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFE----QFETVTTEVLEG 131
           +IK ++YE+ L +     + + L+      E  EYF   N        ++  +T E+ E 
Sbjct: 372 KIKLEKYEVRLIITDLIHISEILEDKSQLIELFEYFTSINEDLVLKCLRYLGLTGEIFEI 431

Query: 132 QVNSRSLVEVKSDYEM---FSGPQAASKNIISPIGQ-IIDLSRNFARDENFGTYLDLSEQ 187
           ++ +     V ++ ++      P  A++N   P  Q  +D+  NF    N     +  E+
Sbjct: 432 RLTTSLFTNVDTNADIVKQLCDPMEATRNGTVPSFQAFLDIHSNFINTTNMSILAESGER 491

Query: 188 FKKWLNIIKRA 198
           FKK L++   A
Sbjct: 492 FKKVLSLFTEA 502

>Smik_4.346 Chr4 (619186..621822) [2637 bp, 878 aa] {ON} YDR103W
           (REAL)
          Length = 878

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 5/57 (8%)

Query: 389 AQKESMDPTNPYNLP--LGPDGFPIPRWLIKVQGLDVKYVCEICGNQIYHGRREFEK 443
           ++KE+ +    YN+P  + P G+P+PR  IK   L+    C +C   I   RR+ EK
Sbjct: 142 SEKENYNSRTSYNIPPKVAPFGYPLPRASIKKSFLNA--ACTLCDEPI-SSRRKGEK 195

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,648,613
Number of extensions: 2264989
Number of successful extensions: 7597
Number of sequences better than 10.0: 35
Number of HSP's gapped: 7735
Number of HSP's successfully gapped: 35
Length of query: 530
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 416
Effective length of database: 40,409,475
Effective search space: 16810341600
Effective search space used: 16810341600
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)