Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F24046g2.152ON60460428400.0
SAKL0E10956g2.152ON60052619370.0
Kwal_33.147672.152ON59452519180.0
KLTH0B05170g2.152ON59352518940.0
Ecym_82042.152ON59752518190.0
ABR131W2.152ON59452517980.0
YNL121C (TOM70)2.152ON61754417630.0
TDEL0B051402.152ON59960217580.0
Skud_14.2112.152ON61754417570.0
ZYRO0G06512g2.152ON60452517540.0
Kpol_1048.212.152ON59752517460.0
Suva_14.2192.152ON61754417430.0
Smik_14.2072.152ON61754417390.0
TPHA0I015102.152ON60360216900.0
NCAS0G024802.152ON59652716720.0
TBLA0C055302.152ON61052616590.0
KAFR0F007202.152ON60852516340.0
KNAG0H035302.152ON61453416060.0
CAGL0L12936g2.152ON60052615990.0
NDAI0F028102.152ON60952515800.0
NCAS0B070102.152ON62552815540.0
CAGL0L04048g2.152ON58751914450.0
Skud_8.1782.152ON63853814040.0
Suva_15.3142.152ON64454113920.0
YHR117W (TOM71)2.152ON63953713870.0
Smik_8.1952.152ON63553213710.0
NDAI0B043402.152ON66453413680.0
Ecym_30256.21ON3181131862e-14
NCAS0G008105.617ON584861885e-14
ACR005W6.21ON327951792e-13
KNAG0A079003.481ON512951795e-13
SAKL0G07084g5.617ON585851795e-13
TDEL0D055003.481ON512951786e-13
AEL224W5.617ON580851788e-13
Suva_8.805.617ON586851743e-12
AAR083C3.481ON5382051723e-12
KAFR0C058905.617ON575931715e-12
YOR027W (STI1)5.617ON589851715e-12
Ecym_55825.617ON584851715e-12
NDAI0B057903.481ON523951706e-12
Kwal_55.199355.617ON593861706e-12
CAGL0H08195g5.617ON583851706e-12
TPHA0D032203.481ON5131041707e-12
NDAI0F009105.617ON583851681e-11
TBLA0A072706.21ON373871652e-11
SAKL0E01210g6.21ON323861632e-11
TBLA0E033005.617ON582851653e-11
SAKL0F03102g3.481ON5131011634e-11
Ecym_44133.481ON510951634e-11
NDAI0D008106.21ON349941606e-11
KLTH0E02178g5.617ON593861626e-11
Kpol_1037.266.21ON3421211606e-11
Smik_15.2055.617ON589851627e-11
KLLA0A07062g5.617ON581861627e-11
Skud_15.1925.617ON5891231591e-10
KLTH0F14542g3.481ON5131011582e-10
ZYRO0B04224g3.481ON5131141582e-10
TBLA0C039503.481ON512951582e-10
Suva_7.4083.481ON5131041582e-10
Kpol_1018.695.617ON590851582e-10
Kwal_56.224336.21ON3221261552e-10
KNAG0B032005.617ON5791431582e-10
NCAS0F034903.481ON512971572e-10
Kpol_1032.86.21ON3431051552e-10
ZYRO0A05676g5.617ON572861573e-10
YGR123C (PPT1)3.481ON5131041554e-10
KAFR0L004106.21ON331871534e-10
TPHA0D028805.617ON585851555e-10
TDEL0G044806.21ON343891518e-10
Kpol_505.413.481ON5131051529e-10
TDEL0A048405.617ON576851521e-09
TPHA0J003406.21ON3381001491e-09
KLLA0B10912g3.481ON512951511e-09
TBLA0G010506.21ON350891482e-09
KAFR0B066103.481ON5112481502e-09
Smik_6.2153.481ON513951502e-09
KNAG0M011706.21ON339781472e-09
KLLA0D01155g6.21ON335681463e-09
CAGL0D05060g3.481ON510951448e-09
NDAI0I022406.21ON350731438e-09
TBLA0H033808.506ON3751591421e-08
Kwal_55.211753.481ON511951421e-08
ZYRO0C07788g6.21ON334741392e-08
Skud_7.4323.481ON5131041412e-08
Kpol_513.28.506ON3741071393e-08
KAFR0E029808.506ON3801371366e-08
KLTH0C11220g6.21ON327941356e-08
NCAS0A00490singletonON620861376e-08
Smik_2.2958.506ON385891357e-08
YBR155W (CNS1)8.506ON385891358e-08
NCAS0H008306.21ON338811348e-08
CAGL0E02739g6.21ON343741331e-07
Skud_15.1686.21ON348711303e-07
TDEL0B013108.506ON3801201303e-07
Skud_2.2828.506ON385921294e-07
CAGL0H07425g8.506ON380891295e-07
YOR007C (SGT2)6.21ON346711278e-07
NCAS0D026706.21ON3511121268e-07
Suva_4.4058.506ON385891269e-07
Kwal_27.118908.506ON334891251e-06
Smik_15.1766.21ON345711232e-06
TPHA0M002706.21ON377951197e-06
Suva_15.1826.21ON346711188e-06
KLTH0E11748g8.506ON378891162e-05
NDAI0C052908.506ON379901143e-05
ZYRO0F08624g8.506ON3791391143e-05
KNAG0A039508.506ON386911143e-05
KNAG0I025206.328ON117901054e-05
KNAG0B022407.412ON7392041127e-05
NCAS0B024008.506ON380891109e-05
Ecym_20906.328ON172611042e-04
KLLA0B09966g8.506ON370931082e-04
NCAS0A112003.367ON9071121092e-04
SAKL0A01672g6.328ON128621002e-04
AGL268C8.506ON379881063e-04
SAKL0H10934g8.506ON380891037e-04
TPHA0D038606.328ON12088968e-04
Kpol_1028.516.328ON11763920.002
TDEL0D036003.265ON879176990.002
KNAG0H006103.367ON97383990.002
TDEL0E027505.352ON564116980.003
NDAI0I004406.328ON12867910.003
ZYRO0C16522g3.367ON97483970.005
TPHA0M016303.367ON104380960.006
KAFR0H008703.367ON88783960.006
CAGL0C01903g7.412ON769210960.006
Suva_4.3613.367ON96384950.008
Smik_2.2543.367ON102084950.008
YBR112C (CYC8)3.367ON96684950.008
TBLA0I023106.328ON11661880.008
Skud_2.2403.367ON98484950.009
CAGL0D01364g3.367ON1148138940.010
Ecym_25598.506ON37092920.012
TBLA0D004607.412ON835151910.021
KAFR0J025706.328ON12160840.029
NCAS0A153007.546ON1398108900.030
TBLA0H015203.367ON689349900.032
Kpol_1006.43.367ON732112900.032
KLTH0E10934g8.470ON56888890.036
Kpol_1018.1067.412ON753209890.036
Suva_3.956.328ON11194820.038
NDAI0A051003.367ON1007120890.038
Kpol_172.23.367ON41877880.039
NCAS0E024907.412ON809210890.041
TDEL0C050903.367ON75983890.041
CAGL0K09240g6.328ON14268830.046
KNAG0F040107.546ON1418126880.056
YBR055C (PRP6)3.265ON89999880.056
SAKL0H11946g8.470ON57388870.068
KLLA0B09262g3.367ON941148860.085
KLLA0C08910g6.328ON11548800.091
TPHA0E007407.412ON746261860.094
NDAI0E040407.412ON78360850.11
TPHA0E011105.352ON693100850.11
Kwal_27.107407.412ON628209850.13
Ecym_71427.412ON675113840.15
ZYRO0B03828g7.412ON727210840.15
Kwal_27.117378.470ON57588840.15
CAGL0H07095g5.352ON66173840.16
AGL294W7.412ON65688840.16
Suva_16.5217.546ON142480830.20
NCAS0D045006.328ON12176770.21
KAFR0C018505.352ON646104830.21
YBL084C (CDC27)7.412ON758212830.21
KAFR0B002507.546ON142092830.23
KLTH0C06204g7.412ON627133820.25
SAKL0B07986g3.367ON880175820.28
TBLA0H019705.352ON84071820.28
YDR244W (PEX5)8.470ON61288820.29
Smik_4.4918.470ON61288810.34
Smik_3.1596.328ON11567750.35
AFR453W8.470ON56988810.37
TDEL0C027207.412ON700223810.37
AAR054C6.328ON13362760.39
ADL344W3.367ON910109810.42
Smik_4.5795.352ON667111800.43
KLTH0F10428g3.367ON79580800.44
Ecym_34593.367ON111580800.45
SAKL0H02244g5.72ON62873800.45
Smik_2.367.412ON751210800.51
ACR168W2.665ON70778800.52
KAFR0L018707.412ON712186790.53
KNAG0A041208.470ON60293790.55
Kwal_23.36703.367ON80280790.56
Ecym_56372.665ON71778790.59
SAKL0F16236g7.546ON140880790.62
Suva_2.347.412ON763210790.63
KNAG0K026303.5ON1076175790.68
NCAS0B025608.470ON57897780.70
TBLA0A016908.470ON66293780.76
YPR189W (SKI3)7.546ON143259780.80
NDAI0C051308.470ON59093780.83
YCR060W (TAH1)6.328ON11159720.84
ZYRO0A03036g3.265ON86745770.96
NDAI0C043205.352ON706115770.98
Kpol_1050.1127.546ON136046771.1
Kpol_339.135.352ON686135771.1
KLLA0C15455g8.470ON566102761.2
Skud_4.5068.470ON61188761.2
TPHA0A006903.101ON722234761.2
TBLA0F012303.367ON118977771.3
KAFR0C003603.296ON82766761.4
CAGL0G10087g7.546ON141146761.4
Suva_2.4108.470ON61178761.5
Smik_16.4537.546ON141759761.5
TDEL0B016608.470ON54988751.6
KLLA0F08459g3.153ON837108751.7
Kpol_1031.648.470ON60788752.0
KLTH0F18150g5.689ON68943742.7
CAGL0K11209g8.470ON590100733.0
NCAS0A105403.265ON87785733.2
YKL022C (CDC16)2.665ON840313733.3
AEL281C7.546ON139047733.8
NDAI0J001307.546ON140346724.2
Smik_11.2901.267ON76553724.3
NDAI0F004005.689ON76449724.4
TDEL0A074306.328ON12461684.4
ZYRO0A02926g8.470ON57793724.5
KLLA0E20857g7.412ON71057714.9
KLTH0H14234g1.456ON39570715.0
Skud_16.4937.546ON142580715.2
SAKL0D03564g3.265ON908144715.3
Suva_13.4418.809ON80053715.9
Smik_16.465.45ON813135706.6
Kwal_34.160921.456ON39570697.4
Skud_2.247.412ON769212707.5
TPHA0A052905.72ON66682707.6
TPHA0L012108.470ON58878698.0
Ecym_13968.470ON57396698.1
NCAS0C027708.415ON76773708.1
TBLA0G021004.310ON223535708.4
SAKL0G08140g5.381ON35551698.7
Skud_13.4288.809ON80054698.8
ZYRO0D10186g5.352ON635110699.4
CAGL0C05313g3.153ON839106699.5
SAKL0C01166g1.33ON498114699.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F24046g
         (604 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...  1098   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   750   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   743   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   734   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   705   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   697   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...   683   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   681   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...   681   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   680   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   677   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...   676   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...   674   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   655   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   648   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   643   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   634   0.0  
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...   623   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   620   0.0  
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   613   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   603   0.0  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   561   0.0  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   545   0.0  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   540   0.0  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...   538   0.0  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   532   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   531   0.0  
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    76   2e-14
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    77   5e-14
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    74   2e-13
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    74   5e-13
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    74   5e-13
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    73   6e-13
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    73   8e-13
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    72   3e-12
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    71   3e-12
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    70   5e-12
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    70   5e-12
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    70   5e-12
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    70   6e-12
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    70   6e-12
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    70   6e-12
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    70   7e-12
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     69   1e-11
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    68   2e-11
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    67   2e-11
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    68   3e-11
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    67   4e-11
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    67   4e-11
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    66   6e-11
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    67   6e-11
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    66   6e-11
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    67   7e-11
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    67   7e-11
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    66   1e-10
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    65   2e-10
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    65   2e-10
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    65   2e-10
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    65   2e-10
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    65   2e-10
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    64   2e-10
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    65   2e-10
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    65   2e-10
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    64   2e-10
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    65   3e-10
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    64   4e-10
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    64   4e-10
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    64   5e-10
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    63   8e-10
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    63   9e-10
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    63   1e-09
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    62   1e-09
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    63   1e-09
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    62   2e-09
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    62   2e-09
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    62   2e-09
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    61   2e-09
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    61   3e-09
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    60   8e-09
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    60   8e-09
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    59   1e-08
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    59   1e-08
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    58   2e-08
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    59   2e-08
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    58   3e-08
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    57   6e-08
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    57   6e-08
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       57   6e-08
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    57   7e-08
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    57   8e-08
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    56   8e-08
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    56   1e-07
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    55   3e-07
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    55   3e-07
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    54   4e-07
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    54   5e-07
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    54   8e-07
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...    53   8e-07
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    53   9e-07
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    53   1e-06
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    52   2e-06
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    50   7e-06
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    50   8e-06
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    49   2e-05
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    49   3e-05
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    49   3e-05
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    49   3e-05
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    45   4e-05
KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {O...    48   7e-05
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    47   9e-05
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    45   2e-04
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    46   2e-04
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    47   2e-04
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    43   2e-04
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    45   3e-04
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    44   7e-04
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    42   8e-04
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    40   0.002
TDEL0D03600 Chr4 (661898..664537) [2640 bp, 879 aa] {ON} Anc_3.2...    43   0.002
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    43   0.002
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    42   0.003
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    40   0.003
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    42   0.005
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    42   0.006
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    42   0.006
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    42   0.006
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    41   0.008
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    41   0.008
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    41   0.008
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    39   0.008
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    41   0.009
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    41   0.010
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    40   0.012
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    40   0.021
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    37   0.029
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            39   0.030
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    39   0.032
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    39   0.032
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    39   0.036
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    39   0.036
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    36   0.038
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    39   0.038
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    39   0.039
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    39   0.041
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    39   0.041
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    37   0.046
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    39   0.056
YBR055C Chr2 complement(344602..347301) [2700 bp, 899 aa] {ON}  ...    39   0.056
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    38   0.068
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    38   0.085
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    35   0.091
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    38   0.094
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    37   0.11 
TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.3...    37   0.11 
Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {...    37   0.13 
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    37   0.15 
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    37   0.15 
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    37   0.15 
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    37   0.16 
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    37   0.16 
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    37   0.20 
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    34   0.21 
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    37   0.21 
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    37   0.21 
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    37   0.23 
KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {...    36   0.25 
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    36   0.28 
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    36   0.28 
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    36   0.29 
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    36   0.34 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    33   0.35 
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    36   0.37 
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    36   0.37 
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    34   0.39 
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    36   0.42 
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    35   0.43 
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    35   0.44 
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    35   0.45 
SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} simila...    35   0.45 
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    35   0.51 
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    35   0.52 
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    35   0.53 
KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {O...    35   0.55 
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    35   0.56 
Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar...    35   0.59 
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    35   0.62 
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    35   0.63 
KNAG0K02630 Chr11 (523259..526489) [3231 bp, 1076 aa] {ON} Anc_3...    35   0.68 
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    35   0.70 
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    35   0.76 
YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski ...    35   0.80 
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    35   0.83 
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    32   0.84 
ZYRO0A03036g Chr1 (245136..247739) [2604 bp, 867 aa] {ON} simila...    34   0.96 
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    34   0.98 
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    34   1.1  
Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}...    34   1.1  
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    34   1.2  
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    34   1.2  
TPHA0A00690 Chr1 complement(124257..126425) [2169 bp, 722 aa] {O...    34   1.2  
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    34   1.3  
KAFR0C00360 Chr3 (73892..76375) [2484 bp, 827 aa] {ON} Anc_3.296       34   1.4  
CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} simil...    34   1.4  
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    34   1.5  
Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR18...    34   1.5  
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    33   1.6  
KLLA0F08459g Chr6 complement(787966..790479) [2514 bp, 837 aa] {...    33   1.7  
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    33   2.0  
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    33   2.7  
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    33   3.0  
NCAS0A10540 Chr1 (2097795..2100428) [2634 bp, 877 aa] {ON} Anc_3...    33   3.2  
YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON} ...    33   3.3  
AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON} ...    33   3.8  
NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {O...    32   4.2  
Smik_11.290 Chr11 (480666..482963) [2298 bp, 765 aa] {ON} YKR027...    32   4.3  
NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}...    32   4.4  
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    31   4.4  
ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {...    32   4.5  
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    32   4.9  
KLTH0H14234g Chr8 (1236691..1237878) [1188 bp, 395 aa] {ON} simi...    32   5.0  
Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR18...    32   5.2  
SAKL0D03564g Chr4 (287287..290013) [2727 bp, 908 aa] {ON} simila...    32   5.3  
Suva_13.441 Chr13 complement(758967..761369) [2403 bp, 800 aa] {...    32   5.9  
Smik_16.46 Chr16 (80717..83158) [2442 bp, 813 aa] {ON} YGR261C (...    32   6.6  
Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {...    31   7.4  
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    32   7.5  
TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa] ...    32   7.6  
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    31   8.0  
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    31   8.1  
NCAS0C02770 Chr3 complement(522391..524694) [2304 bp, 767 aa] {O...    32   8.1  
TBLA0G02100 Chr7 (549066..555773) [6708 bp, 2235 aa] {ON} Anc_4....    32   8.4  
SAKL0G08140g Chr7 complement(692376..693443) [1068 bp, 355 aa] {...    31   8.7  
Skud_13.428 Chr13 complement(753597..755999) [2403 bp, 800 aa] {...    31   8.8  
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...    31   9.4  
CAGL0C05313g Chr3 (506270..508789) [2520 bp, 839 aa] {ON} simila...    31   9.5  
SAKL0C01166g Chr3 (102520..104016) [1497 bp, 498 aa] {ON} highly...    31   9.8  

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 1098 bits (2840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/604 (91%), Positives = 551/604 (91%)

Query: 1   MSDNSVSSFVTRNKXXXXXXXXXXXXXXXXXXXXNQLQRAELXXXXXXXXXXXXXXXXXX 60
           MSDNSVSSFVTRNK                    NQLQRAEL                  
Sbjct: 1   MSDNSVSSFVTRNKTAILATAAAGGAAIGAYYYYNQLQRAELGSGSSGSKKTSKSEKKKR 60

Query: 61  XXXXXXXXXXXXXXXDVVYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDF 120
                          DVVYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDF
Sbjct: 61  AGKKKKDSSSSSNGSDVVYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDF 120

Query: 121 EKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASA 180
           EKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASA
Sbjct: 121 EKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASA 180

Query: 181 YENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPS 240
           YENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPS
Sbjct: 181 YENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPS 240

Query: 241 NTSLASFFGIFNPETSFDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYK 300
           NTSLASFFGIFNPETSFDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYK
Sbjct: 241 NTSLASFFGIFNPETSFDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYK 300

Query: 301 KELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIM 360
           KELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIM
Sbjct: 301 KELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIM 360

Query: 361 ADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFA 420
           ADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFA
Sbjct: 361 ADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFA 420

Query: 421 YIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIK 480
           YIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIK
Sbjct: 421 YIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIK 480

Query: 481 LEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKL 540
           LEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKL
Sbjct: 481 LEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKL 540

Query: 541 QQEEIDDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRA 600
           QQEEIDDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRA
Sbjct: 541 QQEEIDDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRA 600

Query: 601 QGLA 604
           QGLA
Sbjct: 601 QGLA 604

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/526 (70%), Positives = 436/526 (82%), Gaps = 2/526 (0%)

Query: 78  VYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP 137
            YPVD NG+P L   D+ T EQ +KYA+ LKDKGNEFFK K F+ AI+YY LA+ LK+DP
Sbjct: 76  AYPVDENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLALELKKDP 135

Query: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           VFYSNRSA YVS+   EKVVEDTTAALKLK DYSKC LRRASA E+LG ++DAMFDLSA+
Sbjct: 136 VFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYADAMFDLSAL 195

Query: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSF 257
           SL G+++G S+E +LERNMNKQA  VL EKL+E   K+  LPSNTSLASFFGIF PETSF
Sbjct: 196 SLYGDFNGASIEPMLERNMNKQAMLVLKEKLEEK--KDHRLPSNTSLASFFGIFEPETSF 253

Query: 258 DDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAA 317
           ++YD   EAD  L +GL NLYK  +  Y+ ADE FTKAA  YK  LE SP+NE LK+KAA
Sbjct: 254 ENYDESVEADRLLLQGLTNLYKRTSEGYDTADESFTKAAAAYKTLLEESPENEILKQKAA 313

Query: 318 IAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKAL 377
           IA EHVGIFKF KNDP++AH +L+++L  +PR ++YIY+ALIMADKG+A +Y E FDKAL
Sbjct: 314 IALEHVGIFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLALIMADKGQATEYFENFDKAL 373

Query: 378 ELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDC 437
           ELDPNC+AVYYHRGQM+F+ + ++ AG DFDKAKE N  NIF YIQ ACLA+R+++F+DC
Sbjct: 374 ELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAYRENKFEDC 433

Query: 438 ETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIG 497
           ETLFSEARRKFPTAPEVPNFYAEIL+ K  L  A KQY+IA KLEDAL GIHVGIAP++G
Sbjct: 434 ETLFSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLEDALDGIHVGIAPLVG 493

Query: 498 KATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAAD 557
           KAT L R PTVENFVEA++ FEEAC+ DPRSEQAKIGLAQLKLQQEE+D+AI LFE+AAD
Sbjct: 494 KATLLAREPTVENFVEATQNFEEACEKDPRSEQAKIGLAQLKLQQEEVDEAITLFEEAAD 553

Query: 558 LSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603
           L+RSFDEKLQATTFAEATK+QKKIRADP I  KI+E +AAYRAQG+
Sbjct: 554 LARSFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAAYRAQGM 599

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/525 (69%), Positives = 435/525 (82%), Gaps = 2/525 (0%)

Query: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPV 138
           +PVD  G+PDL K DE + E+ DK+A+ LKDKGNEFFK K FE A++YY+LAI +KEDPV
Sbjct: 71  FPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEVKEDPV 130

Query: 139 FYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVS 198
           FYSNRSA YVS+   EKVVEDTTAALKLKPDYSKC LRRASA E+LG+F+DAMFDLSAVS
Sbjct: 131 FYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFDLSAVS 190

Query: 199 LLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSFD 258
           L G+++G S+E LLERNMNKQA  VL EKL++ Q  E  LPSNTSLASFFGIF PETSF+
Sbjct: 191 LYGDFNGSSIEPLLERNMNKQAMLVLKEKLEKQQ--EYKLPSNTSLASFFGIFQPETSFE 248

Query: 259 DYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAI 318
           +YD  +EAD  L  GL NLYK  +G YE AD  F+KA + YK  LE + ++ SLK+KAAI
Sbjct: 249 NYDENSEADKALLDGLTNLYKRTSGGYEAADAAFSKARDEYKTLLEHNSEDASLKQKAAI 308

Query: 319 AFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALE 378
           A EHVGIFKF KNDPI+AH +L++++   PRP+TYIYMALIMADKG+A +Y + F+KALE
Sbjct: 309 ALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALE 368

Query: 379 LDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCE 438
           LDPNC+AVYYHRGQMHF+ + F++AG DF+KAKELN  NIF YIQ ACL +R+ +F D E
Sbjct: 369 LDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLTYREGKFSDSE 428

Query: 439 TLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGK 498
           TLFSEARRKFPT+PEVPNFYAE L+ K  +  A K+YDIA KLE AL GIHVG++P+IGK
Sbjct: 429 TLFSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAKLESALDGIHVGVSPLIGK 488

Query: 499 ATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
           AT L R P+VENF+EA+ LFE+AC+ DPRSEQAKIGLAQLKLQQE+ID+AI LFE+AADL
Sbjct: 489 ATLLSREPSVENFIEATRLFEQACENDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAADL 548

Query: 559 SRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603
           +RSFDEKLQATTFAEATK+QKKIRADP +  KI+E +AAYRAQG+
Sbjct: 549 ARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRAQGM 593

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/525 (68%), Positives = 434/525 (82%), Gaps = 2/525 (0%)

Query: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPV 138
           YPV+  G+PDLS   E + EQ DKYA+ LKDKGNEFFK K +++AI+YY+ AI +KEDPV
Sbjct: 70  YPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVKEDPV 129

Query: 139 FYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVS 198
           FYSNRSA YVS+   EKVVEDTTAALKLKPDYSKC LRRASA E+LG F+DAMFDLSAVS
Sbjct: 130 FYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLSAVS 189

Query: 199 LLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSFD 258
           L G++SG S+E LLERNMNKQ+  VL EKL++ Q  E  LPSNTSLASFFGIF PET+F+
Sbjct: 190 LYGDFSGASIEPLLERNMNKQSMLVLKEKLEKQQ--EYKLPSNTSLASFFGIFQPETTFE 247

Query: 259 DYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAI 318
           +YD  +EAD  L +GL NLYK     YE AD  F KA + +K  LE +P++  LK+KAAI
Sbjct: 248 NYDDNSEADKYLLEGLTNLYKRTADGYETADLSFAKARDAFKVLLEQNPEDADLKRKAAI 307

Query: 319 AFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALE 378
           A EHVGIFKF KNDPI+AH +L++++   PRP+TYIYMALIMADKG+A +Y + F+KAL+
Sbjct: 308 ALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFDNFEKALK 367

Query: 379 LDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCE 438
           LDP+C+AVYYHRGQM+F+ + F++AG DF+KAKEL+  NIF YIQ ACL +R+ +FDD E
Sbjct: 368 LDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYREGKFDDSE 427

Query: 439 TLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGK 498
           TLFSEARRKFPTAPEVPNFYAE L+ K  L  A KQYDIA KLEDAL GIHVG++P+IGK
Sbjct: 428 TLFSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDALDGIHVGVSPLIGK 487

Query: 499 ATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
           AT L R P+VENFVEA++LFE+AC+ DPRSEQAKIGLAQLKLQQE+ID+AI LFE+AADL
Sbjct: 488 ATLLSREPSVENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDIDEAIALFEEAADL 547

Query: 559 SRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603
           +RSFDEKLQATTFAEATK+QKKIRADP +  KI+E +AAYRAQG+
Sbjct: 548 ARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQGM 592

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/525 (64%), Positives = 428/525 (81%), Gaps = 2/525 (0%)

Query: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPV 138
           YPVD+NG+PDLS  D FT EQ ++Y++A+KDKGNE FK K +E+AI+YY+ A+ LK+DPV
Sbjct: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALRLKKDPV 132

Query: 139 FYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVS 198
           FYSNRSA +V +N  EKVVEDTTAAL+LKPDYSKC LRRA+A E+LG F+DAM DLSAVS
Sbjct: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192

Query: 199 LLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSFD 258
           L G Y+ QS+E +LERNMNKQA +VL  KL +  G +  LPSNTSLASFFGIF  ETSF 
Sbjct: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKLAD--GSKHQLPSNTSLASFFGIFPSETSFA 250

Query: 259 DYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAI 318
           +YD ++EAD  L KGL  L + +TG YE++DE F KAA+L     ++  ++ +L+ K AI
Sbjct: 251 NYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLSLSHQADSEDPALRMKLAI 310

Query: 319 AFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALE 378
           A EHVGIFKF KN+P+ A+  L++++ L+PRP++YIYMALIMADKG+ ++Y +YFDKALE
Sbjct: 311 ALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYFDKALE 370

Query: 379 LDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCE 438
           L PN SAVYYHRGQM+FV + F+++G DFDKAKE NP+NIF YIQ ACLA+R+++F+DCE
Sbjct: 371 LAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENKFEDCE 430

Query: 439 TLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGK 498
           TLFSEARRKFPTAPEVPNFYAEIL+ K  L++A+K+Y+ A KLEDA  GIHVG+AP++GK
Sbjct: 431 TLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLEDAQEGIHVGVAPLVGK 490

Query: 499 ATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
           AT L R     +F EA+ LFEEACK DPRSEQAKIGLAQLKLQQE++D+AIQLFE+A DL
Sbjct: 491 ATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQLFEEATDL 550

Query: 559 SRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603
           +R+F+EKLQATTFAEA K+QK+IRADP +  KI E + AYR QG+
Sbjct: 551 ARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGV 595

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/525 (64%), Positives = 418/525 (79%), Gaps = 2/525 (0%)

Query: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPV 138
           YPVD NG+PDLS    FT EQ +KYA+ALKDKGNE FK + +E+AI++Y  A+ LKEDPV
Sbjct: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129

Query: 139 FYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVS 198
           FYSNRSA YV +N  EKVVEDTTAALKLKPDYSKC LRRA+A E+LG ++DAM DLSAVS
Sbjct: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189

Query: 199 LLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSFD 258
           L G YS Q++E +LERNMNKQA +VL +KL  + G++  LPSNTSLASFF IF  ETS +
Sbjct: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKL--SGGEKHELPSNTSLASFFRIFPSETSLE 247

Query: 259 DYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAI 318
           +YD  +EAD  L KGL  L+  Q G YE+ADE FT A E +    E++PDN +LK+K AI
Sbjct: 248 NYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAVEKFTAAHEANPDNAALKQKLAI 307

Query: 319 AFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALE 378
           A EHVGI KF KN+P+ AH  L++++ L PRP++YIYM LIMADKG+A++Y + F+KALE
Sbjct: 308 ALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNFEKALE 367

Query: 379 LDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCE 438
           LDP  SA YYHR QM+FV++ F +AG DFDKAKE +P  ++ YIQ ACLA+R+ +FDDCE
Sbjct: 368 LDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKKFDDCE 427

Query: 439 TLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGK 498
           TLFSEARR+FPTAPEVPNFYAEIL+ K   + A+K+YD A KLEDA  GIHVG+AP++GK
Sbjct: 428 TLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLEDAQEGIHVGVAPLVGK 487

Query: 499 ATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
           A  L R P+  NF EA++LFE AC+ DPRSEQAKIGLAQLKLQQEE+D+AI+LFE AADL
Sbjct: 488 AALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIKLFEAAADL 547

Query: 559 SRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603
           SR+F+EKLQATTFAEA K+QK+IRADP +  KI E + AYRAQG+
Sbjct: 548 SRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGM 592

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/544 (61%), Positives = 424/544 (77%), Gaps = 18/544 (3%)

Query: 78  VYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP 137
           +YPV +NG+PD S K  FT E+ DKYALALKDKGN+FF+ K ++ AI+YY  A+ LKEDP
Sbjct: 73  IYPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKEDP 132

Query: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           VFYSN SA YVS+ + +KVVE +T AL+LKPDYSK  LRRASA E LG+F+DAMFDLS +
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVL 192

Query: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKL------------------KENQGKESPLP 239
           SL G+++  S+E +LERN+NKQA   L EK                   KE + K+  LP
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQENLP 252

Query: 240 SNTSLASFFGIFNPETSFDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELY 299
           S TS+ASFFGIF PE +F +YD  NEAD EL  GL NLYK     Y+ ADE FTKAA L+
Sbjct: 253 SVTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKADESFTKAARLF 312

Query: 300 KKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALI 359
           +++L+ + ++E LK+K AI+ EH GIFKF KNDP+ AH ++++++ L PR ++YIYMALI
Sbjct: 313 EEQLDKNNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALI 372

Query: 360 MADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIF 419
           MAD+ ++ +Y  YFDKAL+LD N S+VYYHRGQM+F+++N+ +AG DFDKAKEL+PENIF
Sbjct: 373 MADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432

Query: 420 AYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAI 479
            YIQ ACLA+R+++FDDCETLFSEA+RKFP APEVPNF+AEIL  KN  D A+KQYD+AI
Sbjct: 433 PYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAI 492

Query: 480 KLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLK 539
           +LE+ L GI+VGIAP++GKAT L RNPTVENF+EA+ L E+A K+DPRSEQAKIGLAQ+K
Sbjct: 493 ELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMK 552

Query: 540 LQQEEIDDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYR 599
           LQQE+ID+AI LFE++ADL+R+ +EKLQA TFAEA KVQ++IR+DP +  KI E +A  R
Sbjct: 553 LQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLAKKIQETLAKLR 612

Query: 600 AQGL 603
            QGL
Sbjct: 613 EQGL 616

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/602 (57%), Positives = 437/602 (72%), Gaps = 6/602 (0%)

Query: 2   SDNSVSSFVTRNKXXXXXXXXXXXXXXXXXXXXNQLQRAELXXXXXXXXXXXXXXXXXXX 61
           SDNSVSSFV+RNK                     Q QRA L                   
Sbjct: 3   SDNSVSSFVSRNKTAIIATAAAGSAAIGAYYYYRQAQRAALDEDEKGAEGSESSKKKKKN 62

Query: 62  XXXXXXXXXXXXXXDVVYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFE 121
                           VYPV  NG+P L   +E + E  + YA ALKD+GNEFFK KD++
Sbjct: 63  KKKKSGENGGTP----VYPVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYD 118

Query: 122 KAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAY 181
            A++YY  A+ +K+DPVFYSN SA YVS+   +KVVE++T AL+LKPDYSK  LRRASA 
Sbjct: 119 NALKYYNYALVVKKDPVFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASAN 178

Query: 182 ENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSN 241
           E+L  ++DAMFDLS +SL G+++G S+E +LERN+NKQA  VL +KL  N  ++  LPSN
Sbjct: 179 ESLENYADAMFDLSVLSLNGDFNGSSIEPMLERNLNKQAMFVLKDKLGNNVSQQ--LPSN 236

Query: 242 TSLASFFGIFNPETSFDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKK 301
           T+LASFFGIF PET+F +Y+  +EADV LK GLE+LYK  +  Y+LADE F K+A  +  
Sbjct: 237 TALASFFGIFPPETTFANYNENDEADVGLKNGLEDLYKRSSEGYKLADEAFVKSASFFTN 296

Query: 302 ELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMA 361
           +L   PD+  LK+K AIA EH GIFKF KNDP+ AH ++E+++ L+PR ++YIYMALIMA
Sbjct: 297 KLSEFPDDAVLKEKTAIALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIMA 356

Query: 362 DKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAY 421
           DKG+A +Y +YFDKA+ LDPN    YYHRGQM+++   +++AG DFDKAKE +  NIF Y
Sbjct: 357 DKGQAEEYYQYFDKAIALDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFPY 416

Query: 422 IQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKL 481
           IQ ACLA+R+D+FDDCETLFSEA+RKFPTAPEVPNFYAEIL  K  L+AA+KQY+IA +L
Sbjct: 417 IQLACLAYREDKFDDCETLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKRL 476

Query: 482 EDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQ 541
           E+AL GIHVG+AP++GKAT L R P+VENF EA+ L EEAC+ DP SEQAK+GLAQLKLQ
Sbjct: 477 EEALDGIHVGVAPLVGKATLLARQPSVENFREATLLLEEACRRDPTSEQAKVGLAQLKLQ 536

Query: 542 QEEIDDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQ 601
           QEE+D+AI LFE+AA+L+R+ DEKLQATTFAEA KVQK+I+ADP +  KI+E +AAYRAQ
Sbjct: 537 QEEVDEAINLFEEAANLARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRAQ 596

Query: 602 GL 603
           G+
Sbjct: 597 GM 598

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/544 (61%), Positives = 425/544 (78%), Gaps = 18/544 (3%)

Query: 78  VYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP 137
           VYPV +NG+PD SKK  FT E+ DKYALALKDKGN++F+ K ++ AI+YY  A+ LKEDP
Sbjct: 73  VYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDP 132

Query: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           VFYSN SA YVS+ + +KVVE +T AL++KPDYSK  LRRASA E LG F+DAMFDLS +
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKL------------------KENQGKESPLP 239
           SL G+++  S+E +LERN+NKQA   L EK                   KE + K+  LP
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPKERKDKQENLP 252

Query: 240 SNTSLASFFGIFNPETSFDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELY 299
           S TS+ASFFGIF PE +F +YD  N+AD EL  GL NLYK     Y+ ADE FTKAA+L+
Sbjct: 253 SITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRADESFTKAAKLF 312

Query: 300 KKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALI 359
           +++L+ S ++E LK+K AI+ EH GIFKF KNDP+ AH ++++++ L PR ++YIYMALI
Sbjct: 313 EEQLDKSNEDEKLKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALI 372

Query: 360 MADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIF 419
           MAD+ ++ +Y  YFDKAL+L+PN S+VYYHRGQM+F+++N+ +AG DFDKAKEL+PENIF
Sbjct: 373 MADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432

Query: 420 AYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAI 479
            YIQ ACLA+R+++FDDCETLFSEA+RKFP APEVPNF+AEIL  KN  D A+KQYD+AI
Sbjct: 433 PYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAI 492

Query: 480 KLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLK 539
           +LE+ L  I+VGIAP++GKAT L RNPTVENFVEA+ L E+A K+DPRSEQAKIGLAQ+K
Sbjct: 493 ELENKLDRIYVGIAPLVGKATLLTRNPTVENFVEATNLLEKASKLDPRSEQAKIGLAQMK 552

Query: 540 LQQEEIDDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYR 599
           LQQE+ID+AI LFE++ADL+R+ +EKLQA TFAEA KVQ+KIR+DP +  KI E +A  R
Sbjct: 553 LQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKIRSDPILAAKIQETLAKLR 612

Query: 600 AQGL 603
            QGL
Sbjct: 613 EQGL 616

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/525 (62%), Positives = 422/525 (80%), Gaps = 2/525 (0%)

Query: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPV 138
           YPVD  G+P L    E + EQ + ++ ALKDKGNEFFK KD++ A++YY  A++LK+DPV
Sbjct: 81  YPVDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPV 140

Query: 139 FYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVS 198
           FYSN SA YVS+N  +KVVE++T AL+LKPDYSK  LRRASA E+L  + DAMFDLS +S
Sbjct: 141 FYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLS 200

Query: 199 LLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSFD 258
           L G++ G S+E +LERN+NKQA  VL +KL   Q K   LPS+T+LASFFGIF PET F 
Sbjct: 201 LNGDFGGSSIEPMLERNLNKQAMTVLKDKL--GQQKNQLLPSDTALASFFGIFTPETEFA 258

Query: 259 DYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAI 318
           +YD  +EAD +LK GLENLYK  +  Y+ ADE F++A + Y K  E + D+ +LK+K AI
Sbjct: 259 NYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAALKEKDAI 318

Query: 319 AFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALE 378
           A EH GIF+F KNDP+ AH ++++++ L+PR ++YIYMALIMADKG+A +Y E+FDKA++
Sbjct: 319 ALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFFDKAIK 378

Query: 379 LDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCE 438
           LDP  +AVYYHRGQM+F+   +++AG DFDKAK+LN ENIF YIQ ACLA+R+++FDDCE
Sbjct: 379 LDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENKFDDCE 438

Query: 439 TLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGK 498
           TLFSEA+RKF TAPEVPNF+AEILA K  L+ A+KQYDIA +LE+A+ GIHVGI+P++GK
Sbjct: 439 TLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVDGIHVGISPLVGK 498

Query: 499 ATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
           AT L R P+VENF+EA++L EEAC  DPRSEQ K+GLAQLKLQQE+IDDAI+LFE+AA L
Sbjct: 499 ATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIKLFEEAASL 558

Query: 559 SRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603
           +R+ DEKLQATTFAEA KVQK+IRADP +  KI+E +AAY+AQG+
Sbjct: 559 ARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGV 603

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  677 bits (1746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/525 (62%), Positives = 416/525 (79%), Gaps = 2/525 (0%)

Query: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPV 138
           YP+D+NG+PDL     FT EQ + Y++ALKDKGN+FFK + +E A++YY  A+ LK+DPV
Sbjct: 74  YPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQDPV 133

Query: 139 FYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVS 198
           FYSN SA YVS+ N EKVVE +T AL+LKPDYSK  LRRASA ENL  F++AMFDLS +S
Sbjct: 134 FYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSVLS 193

Query: 199 LLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSFD 258
           L G+++  S+E +LERN+NKQA +VL +K+  +  ++  LPSNT LASFFGIF PET+  
Sbjct: 194 LNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDAKQQ--LPSNTFLASFFGIFTPETTLK 251

Query: 259 DYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAI 318
           ++D  NEADVEL   L NLYK ++  Y +ADE F+KAAE Y K+LE++PD+E LK+K A 
Sbjct: 252 NFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVLKEKTAT 311

Query: 319 AFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALE 378
           A E+ GIFKF KNDP+ +H +++ S+ L+PR + YIY ALIMADKGE+  Y ++FDKAL+
Sbjct: 312 ALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFDFFDKALD 371

Query: 379 LDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCE 438
           +DPN + VYYHRGQMHF+ + +++A ADF+KAKE +  NIF YIQ ACL + + +FDDCE
Sbjct: 372 VDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHEGKFDDCE 431

Query: 439 TLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGK 498
           TLFSEA+RKFPTAPEVPNFYAE+L  K   DAA KQYDIA +LE++L  IHVG++P++GK
Sbjct: 432 TLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDAIHVGVSPLVGK 491

Query: 499 ATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
           AT L R PTVEN +E++ L EEACK+D RSEQAKIGLAQLKLQQEEID+AI LFE+A+DL
Sbjct: 492 ATLLARQPTVENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEIDEAITLFEEASDL 551

Query: 559 SRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603
           +R+ +EKLQATTFAEA+KVQKKIRADP +  KI   +AAYR QGL
Sbjct: 552 ARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGL 596

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/544 (60%), Positives = 421/544 (77%), Gaps = 18/544 (3%)

Query: 78  VYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP 137
           +YPV ANG+PD SKK +FT E+ DKYALALKDKGN++F+ K ++ AI+YY  A+ LKEDP
Sbjct: 73  IYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYYNWALELKEDP 132

Query: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           VFYSN SA YVS+ + +KVVE +T AL+LKPDYSK  LRRASA E LG F+DAMFDLS +
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKL------------------KENQGKESPLP 239
           SL G+++  S+E +LERN+NKQA   L EK                   KE + K+  LP
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPKERKDKQESLP 252

Query: 240 SNTSLASFFGIFNPETSFDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELY 299
           S TS+ASFFGIF PE +F + D  NEAD EL  GL NLYK     Y+ ADE FTKA +L+
Sbjct: 253 SVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRADESFTKAVKLF 312

Query: 300 KKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALI 359
           + +L+   ++E +K+K AI+ EH GIFKF KNDP+ AH ++ +++ L PR ++YIYMALI
Sbjct: 313 EDQLDKDNEDEKVKEKLAISLEHTGIFKFLKNDPLGAHEDITKAIDLFPRVNSYIYMALI 372

Query: 360 MADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIF 419
           MAD+ ++ +Y  YFDKAL+LD N S+VYYHRGQM+F+++N+ +AG DFDKAKEL+PENIF
Sbjct: 373 MADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432

Query: 420 AYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAI 479
            YIQ ACLA+R+++FDDCETLFSEA+RKFP APEVPNF+AEIL  KN  D A+KQYD+AI
Sbjct: 433 PYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFDKALKQYDLAI 492

Query: 480 KLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLK 539
           +LE+ L GI+VGIAP++GKAT L RNPTVENF+EA+ L E+A K+DPRSEQAKIGLAQ+K
Sbjct: 493 ELENKLEGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKASKLDPRSEQAKIGLAQMK 552

Query: 540 LQQEEIDDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYR 599
           LQQE+ID+AI LFE++ADL+R+ +EKLQA TFAEA KVQ++IR+DP +  KI E +A  R
Sbjct: 553 LQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRIRSDPVLATKIQETLAKLR 612

Query: 600 AQGL 603
            QGL
Sbjct: 613 EQGL 616

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/544 (60%), Positives = 419/544 (77%), Gaps = 18/544 (3%)

Query: 78  VYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP 137
           VYPV +NG PD S K  FT E+ D+YALALKDKGN+FF+ K ++ AI+YY  A+ LK+DP
Sbjct: 73  VYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKYDDAIKYYNWALELKDDP 132

Query: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           VFYSN SA YVS+ + +KVVE +T AL+LKPDYSK  LRRASA E LG F+DAMFDLS +
Sbjct: 133 VFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNFADAMFDLSVL 192

Query: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKL------------------KENQGKESPLP 239
           SL G+++  S+E +LERN+NKQA   L EK                   KE + K   LP
Sbjct: 193 SLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQAPKELKDKTENLP 252

Query: 240 SNTSLASFFGIFNPETSFDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELY 299
           S TS+ASFFGIF PE +F +YD  NEAD +L  GL NLYK     Y+ ADE FTKA +L+
Sbjct: 253 SITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRSPESYDKADESFTKAVKLF 312

Query: 300 KKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALI 359
            ++L+ + ++E  K+K AI+ EH GIFKF KNDP+ AH ++++++ L PR ++YIYMALI
Sbjct: 313 DEQLDKNNEDEKSKEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIELFPRVNSYIYMALI 372

Query: 360 MADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIF 419
           MAD+ ++ +Y  YFDKAL+LD N S+VYYHRGQM+F+++N+ +AG DFDKAKEL+PENIF
Sbjct: 373 MADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIF 432

Query: 420 AYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAI 479
            YIQ ACLA+R+++FDDCETLFSEA+RKFP APEVPNF+AEIL  KN  + A+KQYD+AI
Sbjct: 433 PYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDKNDFEKALKQYDLAI 492

Query: 480 KLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLK 539
           +LE+ L GI+VGIAP++GKAT L RNPTVENF+EA+ L EEA K+DPRSEQAKIGLAQ+K
Sbjct: 493 ELENKLDGIYVGIAPLVGKATLLTRNPTVENFIEATNLLEEASKLDPRSEQAKIGLAQMK 552

Query: 540 LQQEEIDDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYR 599
           LQQE+ID+AI LFE++ADL+R+ +EKLQA TFAEA KVQK+IR+DP +  KI E +A  R
Sbjct: 553 LQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQKRIRSDPILAAKIQETLAKLR 612

Query: 600 AQGL 603
            QGL
Sbjct: 613 EQGL 616

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/602 (55%), Positives = 431/602 (71%), Gaps = 3/602 (0%)

Query: 2   SDNSVSSFVTRNKXXXXXXXXXXXXXXXXXXXXNQLQRAELXXXXXXXXXXXXXXXXXXX 61
           SD SV  F+ RNK                     QLQR ++                   
Sbjct: 4   SDGSVGGFIARNKTAIIATVAAGSAALGAYYYYTQLQR-QIDDSSSSKKKKKKHSKKKKS 62

Query: 62  XXXXXXXXXXXXXXDVVYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFE 121
                          V+YPV +NG+PDLS KD F+ E  +KYA+ALKDKGN++FK +DFE
Sbjct: 63  TSTDEKSNSKNETAKVIYPVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDFE 122

Query: 122 KAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAY 181
            A++YY  A++LK+DPVFYSN SA YVS+   EKVVE +T ALKLK DYSK  LRRASAY
Sbjct: 123 NALKYYNYALTLKQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASAY 182

Query: 182 ENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSN 241
           E+L  + DAM DLS +SL G+++G S+E +LERN+NKQA +VL EK+ EN  K   LPSN
Sbjct: 183 ESLANYVDAMVDLSVLSLNGDFNGASIEPMLERNLNKQAMQVLKEKIAEN--KPQLLPSN 240

Query: 242 TSLASFFGIFNPETSFDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKK 301
           TSLASFFG+F PE S ++++  +E++ EL  GL NLY      Y +ADE F KA +L +K
Sbjct: 241 TSLASFFGVFKPEVSLNNFNENSESEKELLNGLTNLYSRTNDGYLVADESFQKAVKLLEK 300

Query: 302 ELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMA 361
           E E + +N  +K+K AIA E+ GI KF KNDP+ AH ++++++ + PR ++YIY +LI+A
Sbjct: 301 EYEENKENNDIKEKYAIALEYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSYIYNSLILA 360

Query: 362 DKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAY 421
           DKGE  +  + FD A+ LD   +A YYHRGQ++F+ + +++AG DFDKAKEL+  NI  Y
Sbjct: 361 DKGETEESIKNFDAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPY 420

Query: 422 IQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKL 481
           IQ ACLA+++++F+DCETLFSEARRKFPTAPEVPNFYA++L  +N  D A+KQYDI+ KL
Sbjct: 421 IQLACLAYKENKFNDCETLFSEARRKFPTAPEVPNFYADVLLERNEFDKALKQYDISKKL 480

Query: 482 EDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQ 541
           E+A+ GIHVGIAPMIGKAT L RNP VEN +E++ELFEEACK+DPRSEQAKIGLAQLKLQ
Sbjct: 481 EEAVEGIHVGIAPMIGKATLLARNPIVENLLESTELFEEACKLDPRSEQAKIGLAQLKLQ 540

Query: 542 QEEIDDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQ 601
           QEE+D+AI LFE+AA L+R+ DEKLQATTFAEA+KVQKK+R+DP I  KI E +AAY+ Q
Sbjct: 541 QEEVDEAIALFEEAAFLARNMDEKLQATTFAEASKVQKKVRSDPVINQKIQETLAAYQQQ 600

Query: 602 GL 603
           GL
Sbjct: 601 GL 602

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/527 (60%), Positives = 404/527 (76%), Gaps = 1/527 (0%)

Query: 78  VYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP 137
           +YP+DANG+P L   D    +  +++A ALK+KGN  FK KDFE AI+YYT A+SLKEDP
Sbjct: 69  IYPIDANGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSLKEDP 128

Query: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           V+YSN SA Y S+ N+EKV+E  T AL L+PDYSK  +RRA+AYE LG F DAMFDLS  
Sbjct: 129 VYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSVC 188

Query: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSF 257
           SL  + S  S+E +LERN+N+QA  VL  KL     K+S LPSNT+L SFFGIF PE SF
Sbjct: 189 SLNTDMSDASIEPILERNLNQQAMFVLNTKLGVTD-KKSQLPSNTALTSFFGIFKPELSF 247

Query: 258 DDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAA 317
            +YD   E D EL  GL+NLY+C    YE AD  FTKA E + K+L  +PD+E++K+K A
Sbjct: 248 ANYDDTCEGDKELLNGLKNLYRCTAEGYETADLSFTKATEYFLKQLSETPDDETVKEKTA 307

Query: 318 IAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKAL 377
           IA EH GIFKF KN+P+ AH +++++L L+PR ++YIYMALI+ADKG+ + Y   ++KA+
Sbjct: 308 IALEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMALILADKGDTDNYFANYEKAM 367

Query: 378 ELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDC 437
           +LD   +A+YYHRGQM+F+ + +++AG DFDKAKEL+PENIF YIQ ACL++R+++FDDC
Sbjct: 368 KLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRENKFDDC 427

Query: 438 ETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIG 497
           ETLFSEARRKFP + EVPNFYAEILA K   DAA+K+Y+ AI+LE     +HVGIAP++G
Sbjct: 428 ETLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEKKQDAVHVGIAPLVG 487

Query: 498 KATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAAD 557
           KAT L+R PTVENFVEA+ L EEA K DPRSEQAKI L QLKLQQE+ID+AI+LFE AA 
Sbjct: 488 KATLLVRTPTVENFVEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDIDEAIELFESAAT 547

Query: 558 LSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGLA 604
           L+R+F+EKLQATTFAEA K+QK+IRADP +  KI E IAA RA   A
Sbjct: 548 LARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAALRASDFA 594

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/526 (60%), Positives = 407/526 (77%), Gaps = 3/526 (0%)

Query: 78  VYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP 137
           +YPV  NG+P+L  KD+FT E+ +KY++ALKDKGN  FKA  FE+AI+YY  AI LKE+P
Sbjct: 85  IYPVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIELKENP 144

Query: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           +FYSN SA YVS+N  E++++    AL+LKPDYSK  LRRA+A E L  ++DAMFDLS +
Sbjct: 145 IFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMFDLSVL 204

Query: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSF 257
           SL G+Y+G S+E +LERN+NKQA  VL +KLK    K+  LPS+TSL++FFGIF PE SF
Sbjct: 205 SLNGDYNGASIEPILERNLNKQAMSVLKDKLK--NSKDDQLPSDTSLSAFFGIFKPELSF 262

Query: 258 DDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAA 317
           ++YD  N+AD EL  GL +L+K Q+  Y +AD+ F  A ELY K+LE +PD+  LK KA+
Sbjct: 263 ENYDETNDADKELLNGLTHLFKRQSESYLIADKSFMNALELYIKQLEETPDDTDLKVKAS 322

Query: 318 IAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKAL 377
           IA+E+ GIF F KND   A  N+++S+ LNPR ++YIY ALI+ADKGE+  Y +YFDKAL
Sbjct: 323 IAYEYAGIFNFLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGESQDYLDYFDKAL 382

Query: 378 ELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDC 437
           +LD    AVYYHR Q++FV ++F +A  DF+KAKE +P NIF YIQ ACL +R+++FDDC
Sbjct: 383 KLDDKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYRENKFDDC 442

Query: 438 ETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALP-GIHVGIAPMI 496
           ETLFSEA+RKFPT PEVPNFYAE+L  K   D A+K Y+ A +LE+A   GIHVG+AP+I
Sbjct: 443 ETLFSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEASKDGIHVGVAPLI 502

Query: 497 GKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAA 556
           GKAT L R PT+EN   A +L EEA +IDPRSEQAKIGLAQLKLQ+EEID++I+LFE++A
Sbjct: 503 GKATLLAREPTLENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKEEIDESIRLFEESA 562

Query: 557 DLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQG 602
           DL+R+ +EKLQATTFAEA KVQK IRADP I  KI+E +AAYRAQ 
Sbjct: 563 DLARTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRAQN 608

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/525 (58%), Positives = 395/525 (75%)

Query: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPV 138
           +P   NG+PD +  D  T +Q DK+A+ LKDKGNE+FK KD+E A+++Y  A+ LK+DPV
Sbjct: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142

Query: 139 FYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVS 198
           FYSN SA YVS+N  +KV+E +T AL+LKPDYSK  LRRA+A E L  +SDAMFDLS +S
Sbjct: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202

Query: 199 LLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSFD 258
           L  +++G ++E +LERN+NKQA KVL +K K     ES LPSNTS+ASFF IF PE SFD
Sbjct: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPSKNESELPSNTSMASFFSIFTPEISFD 262

Query: 259 DYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAI 318
            YD E++AD EL  GL+ LY  +TGCYE+A+  F K+ ELYK  LES+ D E++ KK AI
Sbjct: 263 SYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISKKFAI 322

Query: 319 AFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALE 378
           A E+VGIF F +ND +TA     +S+S +PR ++YIY+ALI ADK E ++  +YFD+AL+
Sbjct: 323 ALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYFDEALK 382

Query: 379 LDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCE 438
           LDPNCS +YYHRGQ++FV +++  A  DF KAKEL+  NIF YIQ ACL++R+  F+DC+
Sbjct: 383 LDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGDFEDCQ 442

Query: 439 TLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGK 498
             F  AR+KFP APE+P F  EILA K  LD A KQY+  I+LE+    IHVGIAP+IGK
Sbjct: 443 NQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLENTQKSIHVGIAPLIGK 502

Query: 499 ATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
           ATAL R PT ENF EAS+L ++A + DPRSEQA +GLAQLKLQ+E++D AI+LFE A+D 
Sbjct: 503 ATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIELFEKASDY 562

Query: 559 SRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603
           SRS DEKLQATTFAEA KVQK+IRADP IK K++E +A Y AQG 
Sbjct: 563 SRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGF 607

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/534 (58%), Positives = 399/534 (74%), Gaps = 8/534 (1%)

Query: 78  VYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP 137
           VYP+ A+G+PDLS+ D +TPEQ + YALALKDKGNE FK K  E+AI+YY  A+  K+DP
Sbjct: 80  VYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDP 139

Query: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           VFY+N SA YVS+N+FEKV+E+   AL+LKPDYSK  LRRA+ YEN+  F+DAMFDLS +
Sbjct: 140 VFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199

Query: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGK-ESPLPSNTSLASFFGIFNPETS 256
           SL  ++SG S+E +LERN+NKQA K+L E+L+  Q K E PLPS+TS+ASFFGIF PET 
Sbjct: 200 SLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETE 259

Query: 257 FDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNE----SL 312
           F  YD   EAD  L+ GL  L+      +  AD  F +A   Y++    + D E    +L
Sbjct: 260 FKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNL 319

Query: 313 KKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEY 372
            +K AIA E+ GIFKF KND I A   + E++ L PR ++YIY+AL  AD GE+++Y   
Sbjct: 320 NEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTN 379

Query: 373 FDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDD 432
           FDKALEL+PN SA YYHRGQ++F+ +++++A ADF KAKEL+ +NIFAYIQ ACL +R+ 
Sbjct: 380 FDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREG 439

Query: 433 RFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDAL---PGIH 489
             D+C+ LF EAR KFP APEVP FYAEILA K     A KQYD+A +LE+A+    GI 
Sbjct: 440 DMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIR 499

Query: 490 VGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAI 549
           VG+AP++GKAT L R P+ ENF EA+ LFEEACK DPRSEQAK+GLAQL LQQE++D AI
Sbjct: 500 VGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAI 559

Query: 550 QLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603
           ++FE+AADL+R+ DEKLQA TFAEA KVQKKIRADP I+ K++EA+A YRAQG+
Sbjct: 560 KMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGM 613

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  620 bits (1599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/526 (57%), Positives = 399/526 (75%), Gaps = 9/526 (1%)

Query: 86  QPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSA 145
           +PD++     + +Q   YA ALKDKGN  FK K FE AIE+Y  AI L EDPVF+SN SA
Sbjct: 75  KPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEFYNHAIKLHEDPVFHSNISA 134

Query: 146 AYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSG 205
            YVS+ + +KVVE +T AL+LKPDYSK  LRRASAYEN+G++ DAMFD+S +SL G+++G
Sbjct: 135 CYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGRYQDAMFDISVLSLNGDFNG 194

Query: 206 QSVEQLLERNMNKQATKVLGEKL--------KENQGKESPLPSNTSLASFFGIFNPETSF 257
            S+E +LERN+NKQA +VL E +         E   +   LPSNTSL+SFFGIF PET  
Sbjct: 195 SSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQELPSNTSLSSFFGIFKPETEI 254

Query: 258 DDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAA 317
             YD  NEADV L +GL+ LY   +  Y+LADE F KAA+LY+++L ++ D  + K+KAA
Sbjct: 255 PAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKLYREQLANNND-AAFKEKAA 313

Query: 318 IAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKAL 377
            A E++GIF F KND   +  NL+E+L+L+PR +TYIY+AL MAD+G++  Y  YF+KA+
Sbjct: 314 TALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYIYLALTMADRGQSEDYFSYFEKAI 373

Query: 378 ELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDC 437
            LDPN +AVYYHRGQM+F+ +N+++AG DF K+KE +P+NIF YIQ ACLA+R+++  +C
Sbjct: 374 ALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYIQLACLAYRENKMAEC 433

Query: 438 ETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIG 497
           E LF EAR+ FPTAPEVPNFYAEILA K  +D A+KQY+IA +LE     IHVGIAP++G
Sbjct: 434 EKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQYNIAYRLESLQKQIHVGIAPLVG 493

Query: 498 KATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAAD 557
           KAT L R PT ENF   S+L E+ACK DPRSEQAK+GLAQL+LQQE++D+AI+LFE+AA 
Sbjct: 494 KATILARQPTPENFATISQLLEDACKADPRSEQAKVGLAQLRLQQEKVDEAIELFEEAAK 553

Query: 558 LSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603
           ++R+ DEKLQA TFAEATKVQK+IRADP +  K++E +AAY+AQ +
Sbjct: 554 MARTVDEKLQAITFAEATKVQKRIRADPVVSKKVEETLAAYQAQNM 599

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/525 (57%), Positives = 398/525 (75%), Gaps = 3/525 (0%)

Query: 78  VYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP 137
           +Y VD+NG+P+LS  D  T E  +++A+ALKDKGNE FK   FE AI+YY  A+ LK+DP
Sbjct: 84  IYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKLKDDP 143

Query: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           ++YSN SA Y S+  +EKV+E  T ALKL+P +SK  +RRA AYE +G F DAMFD+SA 
Sbjct: 144 IYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFDISAC 203

Query: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSF 257
           SL G+ +  S+E +LER +NKQA  VL EK+  N  KE  LPS+T LASFF +F PETSF
Sbjct: 204 SLNGDMNDASIEPILERILNKQAEFVLKEKISAN--KEQNLPSSTPLASFFRVFKPETSF 261

Query: 258 DDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAA 317
            +Y+  NEAD EL  GL NLYK     +++AD+ F KAAEL+K +L  + DNE++K+K A
Sbjct: 262 ANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAIKEKTA 321

Query: 318 IAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKAL 377
           IA E+ GI  + KN+ + AH +++ ++ L+PR ++YIY +LI +D    ++Y + FDKAL
Sbjct: 322 IALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSEYLQNFDKAL 381

Query: 378 ELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDC 437
           EL+PN  A+YYHRGQ +F+ + +++AG DFDK KEL+  NIFAYIQ ACLA+R+ +FDDC
Sbjct: 382 ELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAYRESKFDDC 441

Query: 438 ETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALP-GIHVGIAPMI 496
           ETLFSEARRKFPTAPEVPNF+AE+LA +   + A+K++D AI+LE   P  IHVGIAP+I
Sbjct: 442 ETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEIHVGIAPLI 501

Query: 497 GKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAA 556
           GKAT LI  PTVENFVE  +L +EAC  DPRSEQA++GLAQLKLQQE+ID+AIQLFE+AA
Sbjct: 502 GKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQEDIDEAIQLFEEAA 561

Query: 557 DLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQ 601
           +L++S++EKLQATTFAEA K+QK+IRADP +  KI + I   R+Q
Sbjct: 562 ELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/528 (55%), Positives = 393/528 (74%), Gaps = 3/528 (0%)

Query: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPV 138
           YP + +  PD+ +      E+  K ++ LKDKGN++FKAKD+  AI+YY LA+ L +DP+
Sbjct: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156

Query: 139 FYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVS 198
           FYSN SA YVS+   +KV+E +T AL+L P+YSK  LRRASA E+L  +SDA+FDLS +S
Sbjct: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216

Query: 199 LLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQG---KESPLPSNTSLASFFGIFNPET 255
           L G+YSG S+E +LERN+NKQA KVL E++ +  G   ++  LPS TSL SFFGIF+PE 
Sbjct: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPEL 276

Query: 256 SFDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKK 315
           +F +Y+  ++ADVEL  GL NL+K     Y  AD+ F KA+ L+ +EL  +P ++ L +K
Sbjct: 277 TFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLLEK 336

Query: 316 AAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDK 375
            AIA E+ GIF+F KND + A  ++E+++   PR ++Y+Y+ALI ADK  + +Y +YFDK
Sbjct: 337 TAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSKYFDK 396

Query: 376 ALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFD 435
           ALEL+P+  +VYYHRGQ++F+ +++ +A  +F+KAKEL+  NIF YIQ ACLA+R++ FD
Sbjct: 397 ALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRENDFD 456

Query: 436 DCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPM 495
            C+ LF E R+KFPT PEVP FYAEILA K     AIKQYDIA +LE A   IHVGIAP+
Sbjct: 457 RCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEKAQKNIHVGIAPL 516

Query: 496 IGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDA 555
           +GKAT L R P + N  EA++L E+AC+IDPRSEQA +GLAQLKLQ EE+D AI+LFE A
Sbjct: 517 VGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLAIELFEKA 576

Query: 556 ADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603
           ADLSR+ DEK+QA TFAEA K+QK+IRADP I  K+DEA+A+YR+QG+
Sbjct: 577 ADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGV 624

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/519 (52%), Positives = 375/519 (72%), Gaps = 1/519 (0%)

Query: 84  NGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNR 143
           N +PD+         + ++YA  LK +GN +FK KD+E AI YY  A+ LK DPVFYSN 
Sbjct: 66  NDEPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNM 125

Query: 144 SAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEY 203
           +A Y+S+ + ++ +E  + AL+L PDYSK  L+RA+ YEN+G+F+DA+ DL+AVSL G+Y
Sbjct: 126 AACYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDY 185

Query: 204 SGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPETSFDDYDGE 263
           +  +++ ++ER +NKQA   L + L+ ++ K   LPS TS+A+FFG+F+ ET    +D  
Sbjct: 186 NDATIQPIVERVLNKQAMMALKDHLEASE-KNKVLPSYTSMAAFFGVFDAETDIPGHDAT 244

Query: 264 NEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAIAFEHV 323
            E+D  L   L +LY      Y+  D EFTKA ELYK +LE+   N    +KAAIAFEH 
Sbjct: 245 EESDKILSDALTHLYSQTKEGYDRCDSEFTKATELYKAKLENDRTNSVTNEKAAIAFEHT 304

Query: 324 GIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALELDPNC 383
            I  F KNDP+TA   ++E++ L+PRP +YIY+ L+MADKG   +Y   F KA++LDPN 
Sbjct: 305 AILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLDPNM 364

Query: 384 SAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETLFSE 443
           +A+YYHRGQM+F+++ +++AG DFDKAKE +P NIF YIQ AC+++R+  FDDCETLFSE
Sbjct: 365 AAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETLFSE 424

Query: 444 ARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGKATALI 503
           ARRKFP APEVPNF+AEIL+ K  ++ A  +YD AI+LE     IHVGIAP++GKAT L+
Sbjct: 425 ARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELESKSENIHVGIAPLVGKATTLL 484

Query: 504 RNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADLSRSFD 563
           + PTVENF+EA +LFE+A   DPRSE+AK+GLAQ KLQQE++DDAI+LFE+AA L R+ D
Sbjct: 485 KYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAILCRTLD 544

Query: 564 EKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQG 602
           EKLQATTFAEATKVQ ++RAD  ++ K  +A+   R  G
Sbjct: 545 EKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/538 (51%), Positives = 372/538 (69%), Gaps = 13/538 (2%)

Query: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDP 137
           YP+ ++G+PD+++       Q  +YA+ LKDKGN FF +K+F+ AI+YY  AI L   DP
Sbjct: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159

Query: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           VFYSN SA Y+S  +  KVVE TT AL++KPD+SK  LRRASA E+LG F+DAMFDLS +
Sbjct: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219

Query: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESP--LPSNTSLASFFGIFNPET 255
           SL G++ G S+E +LERN+NKQA KVL   L +N G      LPSNTSLASFFGIF+P+ 
Sbjct: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279

Query: 256 SFDDYDGENEADVE---LKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESL 312
                   +  D     L + L+ LY   +  Y +A+  FTKA + Y   L +S  + ++
Sbjct: 280 EISRVSSISPPDTAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGAI 339

Query: 313 KKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEY 372
           +  AA+AF + GIF+F KND + A   L+ES++L+P P++YI+MAL +ADK  + ++  +
Sbjct: 340 RGNAALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQEFFSF 399

Query: 373 FDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDD 432
           F KA++LDP  S  YYHRGQM+F+++++  A  DF KA+ LNP NI+ YIQ ACL ++  
Sbjct: 400 FQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACLLYKQG 459

Query: 433 RFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGI 492
           +F + E LF+E + KFPT PEVP F+AEIL  K   + AIKQYDIA +L++    IHVGI
Sbjct: 460 KFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQEVQRKIHVGI 519

Query: 493 APMIGKATALIRNPTV-------ENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEI 545
            P+IGKAT L R  T        E F  A EL  EAC +DPRSEQAKIGLAQLKLQ E+I
Sbjct: 520 GPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQLKLQMEKI 579

Query: 546 DDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603
           DDAI+LF+D+A L+R+ DEKLQATTFAEA K+QK++RADP I  K+++ +A+YRA G+
Sbjct: 580 DDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLASYRANGM 637

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/541 (51%), Positives = 382/541 (70%), Gaps = 13/541 (2%)

Query: 76  DVVYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISL-K 134
           DV YP+  +G+PD+ +    +  Q   +A+ LKDKGN FF AK F  AI+YY  AI L  
Sbjct: 103 DVEYPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDP 162

Query: 135 EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDL 194
            DPVFYSN SA Y+S  + +KVVE TT AL++KPD+SK  LRRASA E+LG F+DAMFDL
Sbjct: 163 NDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDL 222

Query: 195 SAVSLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESP--LPSNTSLASFFGIFN 252
           S +SL G++ G S+E +LERN+NKQA KVL E L +N   +S   LPSNTSLASFFGIF+
Sbjct: 223 SVLSLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFD 282

Query: 253 P--ETS-FDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDN 309
           P  ETS  +     + A   L + L++LY   +  Y +AD+  TKA + Y   L ++ ++
Sbjct: 283 PDLETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLLRANKED 342

Query: 310 ESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQY 369
             +++ AA+AF + GIF+F KND + A   L+ES++L+P P++Y++MAL +ADK  + ++
Sbjct: 343 RVIRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQEF 402

Query: 370 KEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAF 429
            ++F  A++LDP     YYHRGQM+F+++++  A +DF KA+ LNP N++ YIQ ACL +
Sbjct: 403 FKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLLY 462

Query: 430 RDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIH 489
           + D+F + E+LF+EA+ KFP  PEVP FYAEIL  K   + AIKQYDIA +LE+    IH
Sbjct: 463 KQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEEVQKKIH 522

Query: 490 VGIAPMIGKATALIR----NPTV---ENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQ 542
           VGI P+IGKAT L R    +PT    E F  A EL  +AC++DPRSEQAKIGLAQL+LQ 
Sbjct: 523 VGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQLELQM 582

Query: 543 EEIDDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQG 602
           E+ID AI+LF+++A L+R+ DEKLQATTFAEA K+QK++RADP I  K+++ +A YRAQG
Sbjct: 583 EKIDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANYRAQG 642

Query: 603 L 603
           +
Sbjct: 643 M 643

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/537 (50%), Positives = 377/537 (70%), Gaps = 12/537 (2%)

Query: 79  YPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDP 137
           YP   NG+PD+++    +P Q   YA+ LK++GN FF AK+F +AI+YY  AI L   +P
Sbjct: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161

Query: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           VFYSN SA Y+S  + EKV+E TT AL++KPD+SK  LRRASA E+LG F+DAMFDLS +
Sbjct: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221

Query: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESP-LPSNTSLASFFGIFNPETS 256
           SL G++ G S+E +LERN+NKQA KVL E L +++G+ S  LPSNTSLASFFGIF+    
Sbjct: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281

Query: 257 FDDYDGENEADVE---LKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLK 313
               +  +  D     L   L+ LY      Y +A++  TK+ ++Y   L ++  ++ L+
Sbjct: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341

Query: 314 KKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYF 373
           + AA+A  + GIF F KN+ + A + L+ES++L+P P++YI++AL +ADK  + ++ ++F
Sbjct: 342 ENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEFFKFF 401

Query: 374 DKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDR 433
            KA++L+P     YYHRGQM+F+++++K A  DF KA+ LNPEN++ YIQ ACL ++  +
Sbjct: 402 QKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGK 461

Query: 434 FDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIA 493
           F + E  F+E + KFPT PEVP F+AEIL  +   D AIKQYDIA +LE+    IHVGI 
Sbjct: 462 FTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIG 521

Query: 494 PMIGKATALIR----NPTV---ENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEID 546
           P+IGKAT L R    +PT    E F  A +L  +AC++DPRSEQAKIGLAQLKLQ E+ID
Sbjct: 522 PLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKID 581

Query: 547 DAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603
           +AI+LFED+A L+R+ DEKLQATTFAEA K+QK++RADP I  K++  +A YRA+G+
Sbjct: 582 EAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYRAKGM 638

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/532 (52%), Positives = 365/532 (68%), Gaps = 13/532 (2%)

Query: 84  NGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSN 142
           NG+PD+S+    T  Q   YA+ LK+KGN FF  K+F +AI+YY  AI L   DPVFYSN
Sbjct: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163

Query: 143 RSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGE 202
            SA Y+S  +  KV+E TT AL++KPD+SK  LRRASA E+LG F+DAMFDLS +SL G+
Sbjct: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223

Query: 203 YSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPL-PSNTSLASFFGIFNPETSFDDYD 261
           + G S+E +LERN+NKQA KVL E L +  G+ S L PSNTSL SFFGIF+P+      +
Sbjct: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283

Query: 262 GENEADVE---LKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAI 318
             +  D     L   L+ LY      Y  AD+ FT A + Y   L S  D   LK+ AA+
Sbjct: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDG-PLKENAAL 342

Query: 319 AFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALE 378
           AF + GIF F KN+ + A   L+ES++L+P P++YI++AL +ADK  + ++ +YF KA++
Sbjct: 343 AFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQKAID 402

Query: 379 LDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCE 438
           LD      YYHRGQM+F+++++  A ADF KA+ L PENI+ YIQ ACL ++  +F + E
Sbjct: 403 LDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKFTESE 462

Query: 439 TLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGK 498
            LF+E + KFPT PEVP F+AEIL  K     AIKQYDIA +LE+    IHVGI P+IGK
Sbjct: 463 ALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEEVQEKIHVGIGPLIGK 522

Query: 499 ATALIR----NPTV---ENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQL 551
           AT L R    +PT    E F  A  L  +AC++DPRSEQAKIGLAQLKLQ E+IDDAI+L
Sbjct: 523 ATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEKIDDAIEL 582

Query: 552 FEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603
           F+D+A L+R+ DEKLQATTFAEA K+QK++RADP I  K++  +A+YRA+G+
Sbjct: 583 FQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGM 634

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/534 (52%), Positives = 373/534 (69%), Gaps = 9/534 (1%)

Query: 79  YPVDANGQPDLSKKDEFTPEQVD---KYALALKDKGNEFFKAKDFEKAIEYYTLAISLKE 135
           YP+D+   PD ++ ++      +   K+A  LK+KGN++FK+KD E AI+YY  A+ L +
Sbjct: 130 YPLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRLDQ 189

Query: 136 DPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLS 195
           DPVFYSN SA Y ++N  +KV+E +  AL+LKPDYSK  LRRA+AYE LG   +A++D S
Sbjct: 190 DPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYDFS 249

Query: 196 AVSLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFGIFNPET 255
            +SL GEYSGQ +E LL R ++K +T VL  KL   +     L S+++L SFFGIF PET
Sbjct: 250 ILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKLDNKKTDNFILLSDSALVSFFGIFPPET 309

Query: 256 SFDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNE---SL 312
           +  +Y+ ++EAD EL +GLE L K  +  +  AD+ F KA EL+ ++L SS DN+    L
Sbjct: 310 TITNYNPDDEADKELVQGLEALAKKTSEGFLDADKHFIKANELFMEKLLSSEDNDENSGL 369

Query: 313 KKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQ---Y 369
            +K AIA E+ G+FKF K D + +  +L++++ L PRP++YIYMA+++ADK        Y
Sbjct: 370 LEKVAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNNDKNDLDY 429

Query: 370 KEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAF 429
            +YFDKA  L+PN +  YYHRGQ+  V + F EA   F KAKEL+  N++ YIQ AC+A+
Sbjct: 430 FKYFDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQLACVAY 489

Query: 430 RDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIH 489
            +  F  C+ LF EAR KFPT PEVP FYAEILA K  L+AA+KQYDIA +LE A   IH
Sbjct: 490 YNSTFKKCQELFDEARTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLETAYKYIH 549

Query: 490 VGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAI 549
           VGIAP+IGKA AL R PT ENF   +EL E+AC++DPRSEQAKI LAQLKLQ E+ID AI
Sbjct: 550 VGIAPLIGKAAALARIPTQENFDTMTELLEKACELDPRSEQAKISLAQLKLQTEDIDTAI 609

Query: 550 QLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603
            LFE+ ADL+R++ +KLQATTFAEA K+QK+I+ +P    KI+E +A YRA G+
Sbjct: 610 ALFEETADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLATYRADGI 663

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 66/113 (58%), Gaps = 2/113 (1%)

Query: 80  PVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPV 138
           P  ++ +P  +  D   PE V + A  LK +GN+ F AKDFE A++ YT AI L   + V
Sbjct: 73  PTLSSSEPTGNNTDAHAPE-VAERAENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131

Query: 139 FYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAM 191
           FY NR+AAY S   FE+ V D  +A+++ P YS+ + R   A   LG+  +AM
Sbjct: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAKYALGKPEEAM 184

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 52/86 (60%), Gaps = 2/86 (2%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAAL 164
           LK KGN  F +KDF  AIEY+T AI+    P  V YSNRSA Y S+  F++ + D    +
Sbjct: 7   LKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCV 66

Query: 165 KLKPDYSKCWLRRASAYENLGQFSDA 190
           K+ PD+SK + R  +A+  LG   DA
Sbjct: 67  KINPDWSKGYNRMGAAHLGLGDLDDA 92

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 71/146 (48%), Gaps = 12/146 (8%)

Query: 95  FTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNF 153
             PE+ ++  L    +G E+F   D+  A++ YT  I    ED   YSNR+AA   + +F
Sbjct: 385 INPEKAEEARL----EGKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSF 440

Query: 154 EKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGE--YSGQSVEQL 211
            + ++D   A++  P++ + +LR+A+A   +  F  A+  L       +   +G S  ++
Sbjct: 441 PEAIKDCEKAIEKDPNFVRAYLRKATAQIAIKDFVKALETLEEAKKKDDEVNNGASSNEI 500

Query: 212 LERNMNKQATKVLGEKLKENQGKESP 237
           ++  M     K   E+ +   G E+P
Sbjct: 501 MKLQM-----KATQERFQAPTGNETP 521

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 7/78 (8%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAAL----KL 166
           GN+ +K+  F++AI  Y  A  L +D  + +NRSAA     +FE  +     A+    +L
Sbjct: 263 GNKLYKSHKFDEAIAEYNKAWDLHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGREL 322

Query: 167 KPDY---SKCWLRRASAY 181
           + DY   +K + R  +AY
Sbjct: 323 RADYKLIAKSFARMGNAY 340

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 58/95 (61%), Gaps = 1/95 (1%)

Query: 98  EQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKV 156
           E++ K A ALK +GN    AKD+E AI+ YT AI  L  D V+Y+NR+AAY S+  +EK 
Sbjct: 84  EELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKA 143

Query: 157 VEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAM 191
           VED   A K+   YSK + R   A   LG+  +A+
Sbjct: 144 VEDAEKATKVDSSYSKGFSRLGYAKYALGRHEEAL 178

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 59/95 (62%), Gaps = 1/95 (1%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTA 162
           AL  KD+GN + K++D++KAIE YT AI L     +FYSNR+ A++ ++NF+  + D   
Sbjct: 12  ALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCND 71

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           A+KL  +  K + RR  AY  L +F  A  DL+ +
Sbjct: 72  AIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTIL 106

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAY 421
           E + KA+ELD   S  Y +R   H  ++NF+ A  D + A +L+  NI AY
Sbjct: 33  ELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIKLDNNNIKAY 83

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/85 (45%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAALK 165
           K +GN  F AKDFEKAIE +T AI + E P  V YSNRSA Y S   F K +ED    + 
Sbjct: 7   KQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVN 66

Query: 166 LKPDYSKCWLRRASAYENLGQFSDA 190
           + P +SK + R  +A+  LG   +A
Sbjct: 67  INPAWSKGYNRVGAAHFGLGDLDEA 91

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 54/93 (58%), Gaps = 7/93 (7%)

Query: 106 ALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAAL- 164
           A K +GN+F+KA+ F++AIE+Y+ A  L +D  + +NR+AA      +E  ++  T A+ 
Sbjct: 261 AEKAEGNKFYKARKFDEAIEHYSKAWELHKDITYLNNRAAAEYEKGEYETAIKTLTEAVE 320

Query: 165 ---KLKPDY---SKCWLRRASAYENLGQFSDAM 191
              +L+ DY   SK + R  ++Y  L +   A+
Sbjct: 321 QGRELRADYKVISKSFARIGNSYHKLNELKKAI 353

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 110 KGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKP 168
           +G E+F   D+  A++ YT  I    ED   YSNR+AA   + +F + ++D   A+   P
Sbjct: 399 QGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDP 458

Query: 169 DYSKCWLRRASA 180
           ++ + ++R+A+A
Sbjct: 459 NFIRAYIRKATA 470

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 58/95 (61%), Gaps = 1/95 (1%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTA 162
           AL LK++GN F K +DF KAI+ YT AI L     +++SNR+ A++ ++NF+  + D   
Sbjct: 12  ALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDE 71

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           ALKL P  +K + RR  +Y  L +F  A  DL  V
Sbjct: 72  ALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIV 106

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 30/51 (58%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAY 421
           + + KA+ LD   S  + +R   H  ++NF+ +  D D+A +L+P+N  AY
Sbjct: 33  DLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALKLDPKNAKAY 83

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 38/85 (44%), Positives = 51/85 (60%), Gaps = 2/85 (2%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAALK 165
           K +GN  F AKDFEKAIE +  AI + E P  V YSNRSA Y S+  F + + D    ++
Sbjct: 8   KKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVR 67

Query: 166 LKPDYSKCWLRRASAYENLGQFSDA 190
           +KPD+SK   R  +A+  LG   +A
Sbjct: 68  IKPDWSKGHNRLGAAHYGLGDLDEA 92

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 49/86 (56%), Gaps = 1/86 (1%)

Query: 110 KGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKP 168
           +G E+F   D+  A++ YT  I    ED   YSNR+AA   + +F   ++D   A++  P
Sbjct: 394 QGKEYFTNADWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDP 453

Query: 169 DYSKCWLRRASAYENLGQFSDAMFDL 194
           ++ + ++R+A+A   + +++ A+  L
Sbjct: 454 NFVRAYIRKATAQIAVQEYAAAIETL 479

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 47/91 (51%), Gaps = 7/91 (7%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAAL--- 164
           K KGNE +K + F++AI  Y  A  L +D  + +NR+AA     ++E  ++    A+   
Sbjct: 258 KAKGNELYKKRQFDEAIANYEKAWDLHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEEG 317

Query: 165 -KLKPDY---SKCWLRRASAYENLGQFSDAM 191
            +L+ DY   +K + R  +A+  L     A+
Sbjct: 318 RELRADYKVIAKSFARLGNAHYKLADLKKAI 348

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/85 (43%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAALK 165
           K +GN  F AKD+ KAI+ +T AI + E P  V YSNRSA Y S+  F   + D T  +K
Sbjct: 9   KQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVK 68

Query: 166 LKPDYSKCWLRRASAYENLGQFSDA 190
           + P +SK + R  +A+  LG   DA
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 49/87 (56%), Gaps = 7/87 (8%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAAL--- 164
           K +GN+F+KA+ FE+AIE+Y  A  L  D  + +NR+AA     ++E  +   T A+   
Sbjct: 263 KAEGNKFYKARQFEEAIEHYNKAWELHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQG 322

Query: 165 -KLKPDY---SKCWLRRASAYENLGQF 187
            +++ DY   SK + R  +AY  LG  
Sbjct: 323 REMRADYKVISKSFARIGNAYHKLGDL 349

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 56/104 (53%), Gaps = 5/104 (4%)

Query: 95  FTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNF 153
             PE+ ++  L    +G E+F   D+  A++ YT  I    ED   YSNR+AA   + +F
Sbjct: 388 INPEKAEEARL----EGKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSF 443

Query: 154 EKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
            + + D   A++  P++ + ++R+A+A   + +F+ A+  L A 
Sbjct: 444 PEAIADCNKAIEKDPNFVRAYIRKATAQIAVQEFAGALETLDAA 487

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 98/205 (47%), Gaps = 28/205 (13%)

Query: 78  VYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KED 136
           V  V  +G P   ++D  T       AL  K++GNE+ KAKD+ +A+E YT AI      
Sbjct: 16  VRTVAGSGHPSPPRRDSMTAAT----ALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQ 71

Query: 137 PVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSA 196
            +F+SNR+ A + ++ F+  +ED+  A++L     K + RR  A+  L ++  A  DL  
Sbjct: 72  SIFFSNRALANLKLDRFQSALEDSARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEV 131

Query: 197 VSLLGEYSGQSV-------EQLLERNMNKQATKVLGEKLKENQGKESPLPSNTSLASFFG 249
           V +  +   ++V       E++L R   ++A +  G++      ++  L    SLASF G
Sbjct: 132 V-VRAKPGDEAVRRALEVCERMLRRERFERAIRADGDE------EQRRLCKTLSLASFAG 184

Query: 250 IFNPETSFDDYDG-----ENEADVE 269
                     YDG     E E D E
Sbjct: 185 ----NADLASYDGPALELEQETDAE 205

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 57/93 (61%), Gaps = 2/93 (2%)

Query: 100 VDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVV 157
           + K A   K +GN  F AKD++KAI+ +T AI + E P  V YSNRSAAY S   +E+ +
Sbjct: 1   MSKTADEYKQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQAL 60

Query: 158 EDTTAALKLKPDYSKCWLRRASAYENLGQFSDA 190
            D    +K+ P ++K + R+ +A + L ++ +A
Sbjct: 61  SDADECIKINPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 71/146 (48%), Gaps = 16/146 (10%)

Query: 95  FTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNF 153
            +PE+ ++  L    +G E+F   D+  A++ YT  I    +D   YSNR+AA   + +F
Sbjct: 380 LSPEKAEEARL----EGKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSF 435

Query: 154 EKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAM--FDLSAVSLLGEYSGQSVEQL 211
              + D   A++  P + + +LR+A+    + +F+ A+   DL+     G+ +G  + QL
Sbjct: 436 PDAISDCNKAIEKDPSFIRAYLRKATCQIAVKEFAGAIETLDLARERDDGK-NGNEINQL 494

Query: 212 LERNMNKQATKVLGEKLKENQGKESP 237
                     K   ++ +  +G E+P
Sbjct: 495 Y--------AKASAQRFQPAEGNETP 512

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 49/91 (53%), Gaps = 7/91 (7%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAAL--- 164
           K +GN+ +KA+ F++AI +Y  A    +D  + +NRSAA     ++E  ++  T A+   
Sbjct: 255 KAEGNKAYKARQFDEAISHYNQAWETFKDITYLNNRSAAEYEKGDYETCIKTLTEAVENA 314

Query: 165 -KLKPDY---SKCWLRRASAYENLGQFSDAM 191
            +L+ DY   +K + R  +AY  L     A+
Sbjct: 315 RELRTDYKIVAKSFARMGNAYAKLDDLKKAI 345

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 42/110 (38%), Gaps = 27/110 (24%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAA------------------------ 146
           GN + K  D +KAIEYY  +++    P   S    A                        
Sbjct: 332 GNAYAKLDDLKKAIEYYQKSLTEHRTPDILSKLRKAEKDLKQQEAEAYLSPEKAEEARLE 391

Query: 147 ---YVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFD 193
              Y +  ++   V+  T  +K  PD ++ +  RA+A   L  F DA+ D
Sbjct: 392 GKEYFTKADWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISD 441

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAALK 165
           K +GN  F AKD++KAIE +T AI + E P  V YSNRSA Y S+  F   + D    +K
Sbjct: 9   KQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVK 68

Query: 166 LKPDYSKCWLRRASAYENLGQFSDA 190
           + P +SK + R  +A+  LG   +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 48/87 (55%), Gaps = 7/87 (8%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAAL--- 164
           K +GN+F+KA+ F++AIE+Y  A  L +D  + +NR+AA      +E  +     A+   
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQG 325

Query: 165 -KLKPDY---SKCWLRRASAYENLGQF 187
            +++ DY   SK + R  +AY  LG  
Sbjct: 326 REMRADYKVISKSFARIGNAYHKLGDL 352

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 111 GNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G E+F   D+  A++ YT  I    ED   YSNR+AA   + +F + + D   A++  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 170 YSKCWLRRASAYENLGQFSDAMFDLSAV 197
           + + ++R+A+A   + +++ A+  L A 
Sbjct: 463 FVRAYIRKATAQIAVKEYASALETLDAA 490

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 37/85 (43%), Positives = 53/85 (62%), Gaps = 2/85 (2%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAALK 165
           K +GN  F AKDF++A+E +T AI   E+P  V YSNRS AY S+  F++ + D T  +K
Sbjct: 8   KKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVK 67

Query: 166 LKPDYSKCWLRRASAYENLGQFSDA 190
           +K D+SK   R  +A+  LG   +A
Sbjct: 68  IKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 54/99 (54%), Gaps = 5/99 (5%)

Query: 97  PEQVDKYALALKDKGNEFFKAKDFEKAIEYYT-LAISLKEDPVFYSNRSAAYVSINNFEK 155
           PE+ +K  L     G E+F   D+  A++ Y+ + +    D   YSNR+AA   + +F  
Sbjct: 389 PEKAEKARL----DGKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPD 444

Query: 156 VVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDL 194
            ++D   A+++ P + + ++R+A+A   + ++S A+  L
Sbjct: 445 AIKDCDKAIEIDPSFVRAYIRKATAQIAVQEYSAAIETL 483

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 49/91 (53%), Gaps = 7/91 (7%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAAL--- 164
           K +GN+ +K + F++AI  Y  A +L++D  + +NR+AA     ++   ++    A+   
Sbjct: 262 KAEGNQLYKQRKFDEAIAKYEEAWNLQKDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQG 321

Query: 165 -KLKPDY---SKCWLRRASAYENLGQFSDAM 191
            +L+ DY   +K + R  +AY  L +   A+
Sbjct: 322 RELRADYKVIAKSFARLGNAYYKLDEVKKAV 352

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 58/95 (61%), Gaps = 1/95 (1%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTA 162
           A+ LK++GN++ K K + KA+EYYT AI L     +F+SNR+ A + ++NF+  ++D  +
Sbjct: 13  AIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNS 72

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           AL+L P   K + RR  +   L  F  A  DLS V
Sbjct: 73  ALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV 107

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 9/68 (13%)

Query: 363 KGEANQY---------KEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKEL 413
           K E N+Y          EY+ KA+ELD   S  + +R      ++NF+    D + A EL
Sbjct: 17  KNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALEL 76

Query: 414 NPENIFAY 421
           +P+NI AY
Sbjct: 77  DPKNIKAY 84

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 2/86 (2%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAAL 164
            K +GN  F AKDFEKA E ++ AI   E P  V YSNRSA Y S+  F++ +ED    +
Sbjct: 6   FKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECV 65

Query: 165 KLKPDYSKCWLRRASAYENLGQFSDA 190
           K+ P +SK + R  +A   LG   DA
Sbjct: 66  KINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 60/107 (56%), Gaps = 8/107 (7%)

Query: 93  DEFTPEQVDKY-ALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSIN 151
           DE  PEQ  K  A A K +GN+++KA+ F++AIE+Y  A  L  D  + +NRSAA     
Sbjct: 255 DEPEPEQDSKAKADAEKAEGNKYYKARKFDEAIEHYNKAWDLHRDVTYLNNRSAAEYEKG 314

Query: 152 NFEKVVEDTTAAL----KLKPDY---SKCWLRRASAYENLGQFSDAM 191
           ++E+ ++  T A+    +++ DY   SK + R  +AY  +     A+
Sbjct: 315 DYEQAIKTLTEAVDQGREMRADYKLISKSFARIGNAYLKMDDLKKAI 361

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 110 KGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKP 168
           +G EFF   D+  A+  YT  I    ED   YSNR+A    + +F   ++D   A+   P
Sbjct: 407 QGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDP 466

Query: 169 DYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           ++ + ++R+ASA   + +F+ AM  L A 
Sbjct: 467 NFVRAYIRKASAQIAVREFAPAMETLDAA 495

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 2/85 (2%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAALK 165
           K +GN  F AKD+EKAI+ ++ AI + E P  VFYSNRSA Y S+  F + + D    +K
Sbjct: 8   KQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVK 67

Query: 166 LKPDYSKCWLRRASAYENLGQFSDA 190
           + P +SK + R  +A+  LG   +A
Sbjct: 68  INPTWSKGYNRLGAAHLGLGDLDEA 92

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 57/104 (54%), Gaps = 5/104 (4%)

Query: 95  FTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNF 153
             PE+ ++  L    +G ++F   D+  A++ YT  I    ED   YSNR+AA   + +F
Sbjct: 385 INPEKAEEARL----EGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSF 440

Query: 154 EKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
            + +ED   A++  P++ + ++R+A+A   + +F+ A+  L A 
Sbjct: 441 PEAIEDCNKAIEKDPNFIRAYIRKATAQIAVKEFAAAIETLDAA 484

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 26/36 (72%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAA 146
           GN+ +KA+ F++AI +Y  A +L +D  + +NRSAA
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLHQDITYLNNRSAA 298

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 70.1 bits (170), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 61/104 (58%), Gaps = 2/104 (1%)

Query: 96  TPEQVD-KYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNF 153
           +P Q D   AL  K+KGNE+ K  D++ AIE+Y+ AI+L     +++SNR+ A++  +NF
Sbjct: 3   SPSQEDIATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNF 62

Query: 154 EKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
              V D   ALKL P   K + RR  +Y  + +F  A  DL+ V
Sbjct: 63  YSAVVDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV 106

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAY 421
           E++ KA+ LD   S  + +R   H   +NF  A  D D A +L+P+NI AY
Sbjct: 33  EFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDNALKLDPKNIKAY 83

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 69.3 bits (168), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 37/85 (43%), Positives = 50/85 (58%), Gaps = 2/85 (2%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAALK 165
           K +GN  F +KDF KAIE +T AI +   P  V YSNRSAAY S   F++ + D T  +K
Sbjct: 9   KQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVK 68

Query: 166 LKPDYSKCWLRRASAYENLGQFSDA 190
           + P +SK + R  +A   LG   +A
Sbjct: 69  INPTWSKGYNRLGAAEFGLGNLEEA 93

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 50/85 (58%), Gaps = 1/85 (1%)

Query: 111 GNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G E+F   D+  A++ Y+  I    ED   YSNR+AA   + +F + ++D   A+K  P+
Sbjct: 396 GKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPN 455

Query: 170 YSKCWLRRASAYENLGQFSDAMFDL 194
           + + ++R+A+A   + ++++A+  L
Sbjct: 456 FVRAYIRKATAQIAIKEYANALDTL 480

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 48/91 (52%), Gaps = 7/91 (7%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAAL--- 164
           K +GN+ +KA  F++AIE Y  A +L +D  + +NRSAA     +FE  +     A+   
Sbjct: 259 KVEGNKLYKAHKFDEAIEQYNKAWALNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQG 318

Query: 165 -KLKPDY---SKCWLRRASAYENLGQFSDAM 191
            +L+ DY   +K + R  +AY   G    ++
Sbjct: 319 RELRADYKIIAKSFARIGNAYHKKGDLKKSI 349

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 68.2 bits (165), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 54/87 (62%), Gaps = 1/87 (1%)

Query: 106 ALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAAL 164
             KD+GN    ++D++KAIE YT AIS    DP++YSNRS AY+ +N++E  + D    +
Sbjct: 139 TFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCI 198

Query: 165 KLKPDYSKCWLRRASAYENLGQFSDAM 191
            +  ++SK ++R A+      Q+ DA+
Sbjct: 199 SIDANFSKAYIRLANIKVQQHQYIDAL 225

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 56/86 (65%), Gaps = 1/86 (1%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALK 165
           LK +GN+   +KDFE AI+ YT AI  L  + V+Y+NR+AAY S+  +E+ V+D  +A+K
Sbjct: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIK 159

Query: 166 LKPDYSKCWLRRASAYENLGQFSDAM 191
           + P YSK + R   A   LG+  +A+
Sbjct: 160 VNPSYSKGYSRLGFAKYALGKPEEAL 185

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 52/85 (61%), Gaps = 2/85 (2%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAALK 165
           KD+GN  F AK++++AIE +T AI + E P  V YSNRSA Y S   F K +ED    +K
Sbjct: 9   KDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVK 68

Query: 166 LKPDYSKCWLRRASAYENLGQFSDA 190
           + P +SK + R  +A+  +G   +A
Sbjct: 69  INPTWSKGYNRVGAAHFGMGDLDEA 93

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 58/109 (53%), Gaps = 8/109 (7%)

Query: 91  KKDEFTPEQVDKYAL-ALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVS 149
           K++  TPE   K A  A K +GN+ +KA  F++AIE+Y  A  L  D  + +NRSAA   
Sbjct: 241 KEEASTPEDESKIAADAEKAEGNKLYKAHKFDEAIEHYNKAWELHNDITYLNNRSAAEFE 300

Query: 150 INNFEKVVEDTTAAL----KLKPDY---SKCWLRRASAYENLGQFSDAM 191
             +++  +E    A+    +++ DY   +K + R A++Y  L     A+
Sbjct: 301 KGDYQTAIETLHEAVEKGREMRADYKLVAKSFTRIANSYMKLNDIKSAI 349

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 54/104 (51%), Gaps = 5/104 (4%)

Query: 95  FTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNF 153
             PE+ ++  L    +G E+F   D+  A++ YT  I+    D   YSNR+AA   + +F
Sbjct: 384 INPEKAEEARL----EGKEYFTKGDWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSF 439

Query: 154 EKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
            + + D   A++  P++ + ++R+A+A   +  F  A+  L A 
Sbjct: 440 PEAITDCNTAIEKDPNFIRAYIRKATAQIAIKDFVPAIETLDAA 483

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 60/101 (59%), Gaps = 2/101 (1%)

Query: 98  EQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKV 156
           E V+K AL  K++GN F K K+F KA E Y+ AI L     +++SNR+ A++ ++NF+  
Sbjct: 7   EDVNK-ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTA 65

Query: 157 VEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           + D   A++L P   K + RR  +Y  L +F+ A  DL  V
Sbjct: 66  LNDCNKAIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV 106

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (62%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAY 421
           E + KA+ELD   S  + +R   H  ++NF+ A  D +KA EL+P+N+ AY
Sbjct: 33  ELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNKAIELDPKNVKAY 83

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 56/95 (58%), Gaps = 1/95 (1%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISLKE-DPVFYSNRSAAYVSINNFEKVVEDTTA 162
           AL  KD+GN+F  +KD+ +AIE YT AI L     +F+SNR+ A + ++ F+  +ED++ 
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           A++L     K + RR  AY  L  F  A  DL  V
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVV 103

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 58/94 (61%), Gaps = 1/94 (1%)

Query: 99  QVDKYALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVV 157
           ++   A A K +GN+    KDF  A+E YT AI  L  + ++Y+NR+AA+ S+  FE+ +
Sbjct: 96  EIKANAEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAI 155

Query: 158 EDTTAALKLKPDYSKCWLRRASAYENLGQFSDAM 191
           +D  +A+K+ P YSK + R A A   LG+  +A+
Sbjct: 156 KDAESAIKIDPSYSKGYSRLAFAKYGLGKHEEAL 189

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 50/86 (58%), Gaps = 2/86 (2%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAAL 164
            K +GN  F AKD+EKA E +T AI   E P  V YSNRSA + S+  F + + D    +
Sbjct: 6   FKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECV 65

Query: 165 KLKPDYSKCWLRRASAYENLGQFSDA 190
           K+ P +SK + R  +AY  LG+  +A
Sbjct: 66  KINPAWSKGYNRVGAAYFGLGKLDEA 91

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 62/107 (57%), Gaps = 8/107 (7%)

Query: 93  DEFTPEQ-VDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSIN 151
           DE  PEQ   K A A K +GN+F+KA+ F++AIE+Y  A  L +D  + +NRSAA     
Sbjct: 255 DEPQPEQDSKKNADAEKAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAEYEKG 314

Query: 152 NFEKVVEDTTAAL----KLKPDY---SKCWLRRASAYENLGQFSDAM 191
           ++E+ ++  T A+    +++ DY   SK + R  +AY  L  F  A+
Sbjct: 315 DYEQAIKTLTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAI 361

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 56/102 (54%), Gaps = 5/102 (4%)

Query: 97  PEQVDKYALALKDKGNEFFKAKDFEKAIEYYT-LAISLKEDPVFYSNRSAAYVSINNFEK 155
           PE+ ++  L    +G E+F   D+  A++ YT +     ED   YSNR+AA   + +F +
Sbjct: 398 PEKAEEARL----QGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPE 453

Query: 156 VVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
            ++D   A+   P++ + ++R+A+A   + +F+ A+  L A 
Sbjct: 454 AIKDCDMAISKDPNFIRAYIRKATAQIAVREFASAIETLDAA 495

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 43/121 (35%), Positives = 69/121 (57%), Gaps = 4/121 (3%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAI-SLKEDPVFYSNRSAAYVSINNFEKVVEDTTA 162
           A ALK +GN+    KD+E AI+ YT AI +L  + V+++NR+AAY S+  +++ VED  +
Sbjct: 100 AEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANS 159

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLERNMNKQATK 222
           A+K+ P YSK + R   A    G+  DA   L A   + +  G    ++++R+      K
Sbjct: 160 AIKINPTYSKGYSRLGFAKFAQGKAEDA---LEAYKKVLDIEGDKATEMMKRDYETAKKK 216

Query: 223 V 223
           V
Sbjct: 217 V 217

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAALK 165
           K +GN  F AKD++KAIE +T AI + + P  V YSNRSA Y S+  F   + D    + 
Sbjct: 9   KQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECIN 68

Query: 166 LKPDYSKCWLRRASAYENLGQFSDA 190
           + P +SK + R  +A+  LG   +A
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEA 93

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 61/118 (51%), Gaps = 12/118 (10%)

Query: 82  DANGQPDLSKKDEFTPEQVDK---YALALKDK--GNEFFKAKDFEKAIEYYTLAISLKED 136
           D++  P   +  E  P +VD+    A A K+K  GN+F+KA+ F++AIE+Y  A  L  D
Sbjct: 235 DSSNTPQREENKESDPMEVDEDDSKAEADKEKAEGNKFYKARQFDEAIEHYNKAWELHRD 294

Query: 137 PVFYSNRSAAYVSINNFEKVVEDTTAAL----KLKPDY---SKCWLRRASAYENLGQF 187
             + +NR+AA      ++  +     A+    +++ DY   S+ + R  +AY  LG  
Sbjct: 295 ITYLNNRAAAEYEKGEYKTAIATLNDAVEQGREMRADYKVISRSFARIGNAYHKLGDL 352

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 56/104 (53%), Gaps = 5/104 (4%)

Query: 95  FTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNF 153
             PE+ ++  L    +G ++F   D+  A++ YT  I    ED   YSNR+AA   + +F
Sbjct: 391 INPEKAEEARL----EGKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSF 446

Query: 154 EKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
            + + D   A++  P++ + ++R+A+A   + +++ A+  L A 
Sbjct: 447 PEAIADCNKAIEKDPNFVRAYIRKATAQIAVQEYAAALETLDAA 490

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 67.0 bits (162), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/86 (39%), Positives = 52/86 (60%), Gaps = 2/86 (2%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAAL 164
            K +GN+ F +KD+ KAIE +T AI + E P  V +SNRSA Y S  +F K ++D    +
Sbjct: 6   FKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECV 65

Query: 165 KLKPDYSKCWLRRASAYENLGQFSDA 190
           K+ P ++K + R  +A+  LG   +A
Sbjct: 66  KINPSWAKGYNRLGAAHYGLGDLDEA 91

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 10/112 (8%)

Query: 90  SKKDEFTPEQVD---KYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAA 146
           +KK E  P +VD     A A K +GN+ +K + F++AIE Y  A     D  + +NR+AA
Sbjct: 238 TKKPEPEPMEVDDDKSKAEAAKAEGNKLYKQRKFDEAIEKYNEAWETHNDITYLNNRAAA 297

Query: 147 YVSINNFEKVVEDTTAAL----KLKPDY---SKCWLRRASAYENLGQFSDAM 191
                ++E  +E  T A+    +L+ DY   SK + R  ++Y  LG    A+
Sbjct: 298 EYEKGDYEAAIETLTKAVEQGRELRADYKVISKSFARMGNSYHKLGDLKKAI 349

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 47/89 (52%), Gaps = 1/89 (1%)

Query: 110 KGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKP 168
           +G E+F   D+ KA+E YT  I     D   YSNR+AA   + +F   + D   A++  P
Sbjct: 395 QGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDP 454

Query: 169 DYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           ++ + ++R+A+    +  ++ A+  L + 
Sbjct: 455 NFVRAYIRKATGQIAIKDYAGAIETLDSA 483

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 5/123 (4%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAALK 165
           K +GN  F AK+++ AIE +T AI + E P  V +SNRSA Y S+  F   + D    +K
Sbjct: 9   KQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVK 68

Query: 166 LKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLL---GEYSGQSVEQLLERNMNKQATK 222
           + P +SK + R  +A+  LG   +A  D      L    + +   +EQ+      +QA  
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDEAESDYKKALELDANNKAAKDGLEQVHRTQQARQAQP 128

Query: 223 VLG 225
            LG
Sbjct: 129 DLG 131

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 7/87 (8%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAALK-- 165
           K +GN+F+KA  F++AIE+Y  A  L +D  + +NR+AA     ++E V+     A++  
Sbjct: 266 KAEGNKFYKAHQFDEAIEHYNRAWELHKDITYLNNRAAAEYEKGDYETVIATLNDAVEKG 325

Query: 166 --LKPDY---SKCWLRRASAYENLGQF 187
             ++ DY   SK + R  +AY  LG  
Sbjct: 326 RDMRADYKVISKSFARIGNAYHKLGDL 352

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 47/85 (55%), Gaps = 1/85 (1%)

Query: 111 GNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G E+F   D+  A++ YT  I    ED   YSNR+AA   + +F + + D   A++  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 170 YSKCWLRRASAYENLGQFSDAMFDL 194
           + + ++R A+A   + +F+ A+  L
Sbjct: 463 FVRAYIRMAAAQIAVKEFAAALETL 487

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 59/101 (58%), Gaps = 1/101 (0%)

Query: 98  EQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKE-DPVFYSNRSAAYVSINNFEKV 156
           E+  + AL  K++GN F K K + +A+EYY+ AI L +   +F+SNR+ + + ++NF   
Sbjct: 6   EEAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTA 65

Query: 157 VEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           +ED   +++L P   K   RR  +Y  L +FS A  DL  +
Sbjct: 66  LEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENI 418
           EY+ KA+ELD   S  + +R      ++NF  A  D +K+ EL+P+NI
Sbjct: 33  EYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDPKNI 80

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 63/114 (55%), Gaps = 3/114 (2%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISLKED-PVFYSNRSAAYVSINNFEKVVEDTTA 162
           AL  KD+GN+F K +DF KA E YT AI L +   +F+SNR+ A++  +NF+  + D   
Sbjct: 12  ALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDK 71

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV--SLLGEYSGQSVEQLLER 214
           AL+L     K + RR  +Y  L +F  A  DL  V  S  G+ +     Q+ E+
Sbjct: 72  ALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTVLKSKPGDVAADRALQICEK 125

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 30/51 (58%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAY 421
           E + KA+ELD   S  + +R   H   +NF+ +  D DKA EL+ +NI AY
Sbjct: 33  ELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALELDSKNIKAY 83

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 56/95 (58%), Gaps = 1/95 (1%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISLKED-PVFYSNRSAAYVSINNFEKVVEDTTA 162
           AL  K++GN+  K +D+  AIE YT AI L +   +++SNR+  ++ ++NF+  + D   
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           AL++ P   K + RR  +Y  L +F +A  DL  V
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV 106

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAY 421
           E + +A++LD   S  + +R   H  ++NF+    D DKA E++P+NI AY
Sbjct: 33  ELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALEIDPKNIKAY 83

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 59/104 (56%), Gaps = 2/104 (1%)

Query: 96  TPEQVDKY-ALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNF 153
            P + D+  AL  K++GN F K K F KAIE YT AI L     +++SNR+ A+  ++NF
Sbjct: 3   NPTEADRANALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNF 62

Query: 154 EKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           +  + D   ALKL P   K + RRA +   L +F  A  DL+ +
Sbjct: 63  QSALNDCDEALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCA--CLA 428
           E + +A++LD   S  + +R   HF V+NF+ A  D D+A +L+P+NI AY + A  C+A
Sbjct: 33  EKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDPKNIKAYHRRALSCMA 92

Query: 429 F 429
            
Sbjct: 93  L 93

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 51/85 (60%), Gaps = 2/85 (2%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAALK 165
           K +GN  F AKD++KAI+ ++ AI + E P  V YSNRSA Y S+  F   ++D    +K
Sbjct: 9   KQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVK 68

Query: 166 LKPDYSKCWLRRASAYENLGQFSDA 190
           + P +SK + R  +A+  +G   +A
Sbjct: 69  INPSWSKGYNRVGAAHFGMGDLDEA 93

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 71/146 (48%), Gaps = 8/146 (5%)

Query: 93  DEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSIN 151
           D   PE+ ++  L    +G ++F   D+  A++ YT  I    ED   YSNR+A    + 
Sbjct: 390 DYINPEKAEEARL----EGKDYFTKGDWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLM 445

Query: 152 NFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSGQSVEQL 211
           +F + ++D   A++  P++ + ++R+A+A   + +FS A+  L A         +S    
Sbjct: 446 SFPEAIDDCNKAIEKDPNFVRAYIRKATAQIAVREFSSALETLDAARSKDAEVNKSANT- 504

Query: 212 LERNMNKQATKVLGEKLKENQGKESP 237
             R +++   K   ++ + N   ESP
Sbjct: 505 --REIDQLYIKASQQRFQPNDSNESP 528

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 7/88 (7%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAAL----KL 166
           GN+ +KA+ F++A+  Y  A     D  + +NRSAA     ++E  ++    A+    ++
Sbjct: 270 GNKLYKARQFDEAVAKYNEAWEAHNDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGREM 329

Query: 167 KPDY---SKCWLRRASAYENLGQFSDAM 191
           + DY   +K + R  + Y  L     A+
Sbjct: 330 RADYKVIAKSFARMGNCYTKLNDLKKAI 357

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 74/126 (58%), Gaps = 5/126 (3%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTA 162
           A +LK +GN+   AKDFE+A+  Y+ AI  L  + V+Y+NR+AA+ S+  +E+ V+D   
Sbjct: 97  AESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAED 156

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLERNMNKQATK 222
           A+K+ P YSK + R   A   LG+  +A   L A   + +  G++    ++R+ +  A K
Sbjct: 157 AIKVNPSYSKGYSRLGFAQYALGKPEEA---LDAYKKVLDIEGEAATDAMKRDYDT-AMK 212

Query: 223 VLGEKL 228
            +G+ L
Sbjct: 213 KVGQSL 218

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 71/143 (49%), Gaps = 22/143 (15%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAALK 165
           K +GN  F AK +++A++ +T AI + E P  V YSNRSA+Y S   F + ++D     K
Sbjct: 9   KQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTK 68

Query: 166 LKPDYSKCWLRRASAYENLGQFSDA------MFDLSAVSLLGEYSGQSVEQLLERNMNKQ 219
           + P ++K + R  +A+  +G   DA        +L A + + +   + +EQ+      +Q
Sbjct: 69  INPSWAKGYTREGAAHFGMGNLDDAEASYKKALELDANNKIAK---EGIEQIQRVQSQRQ 125

Query: 220 ATKVLG-----------EKLKEN 231
           A   LG           EKLK N
Sbjct: 126 AQPDLGLTEMFNDPNLIEKLKNN 148

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 55/106 (51%), Gaps = 5/106 (4%)

Query: 93  DEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSIN 151
           D   PE+ ++  L    +G E+F   D+  A++ YT  I    ED   YSNR+AA   + 
Sbjct: 378 DYINPEKAEEARL----EGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLM 433

Query: 152 NFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           +F   + D   A++  P++ + ++R+A+A   +  FS A+  L A 
Sbjct: 434 SFPDAISDCNKAIEKDPNFVRAYIRKATAQIAVKDFSYAIETLDAA 479

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 48/91 (52%), Gaps = 7/91 (7%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAAL--- 164
           K +GN+ +KA++F++AI  Y  A  L  +  + +NRSAA      ++  +     A+   
Sbjct: 255 KVEGNKAYKARNFDEAIACYNKAWELDNNITYLNNRSAAEFEKGEYDTAINTLNEAIEKG 314

Query: 165 -KLKPDY---SKCWLRRASAYENLGQFSDAM 191
            +++ DY   +K + R  +AY  +G   +A+
Sbjct: 315 REMRADYKIIAKSFARIGNAYVKMGNLKEAI 345

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 57/97 (58%), Gaps = 5/97 (5%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP---VFYSNRSAAYVSINNFEKVVEDT 160
           A+A K++GN + K +++ KAIE Y+ AI L  DP   +F+SNR+ A + ++NF+  + D 
Sbjct: 12  AVAFKNEGNTYIKEQNYMKAIELYSQAIEL--DPTQSIFFSNRALAQLKLDNFQSCMNDC 69

Query: 161 TAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
             AL+L P   K + RR  ++  L Q   A  DL  V
Sbjct: 70  DVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV 106

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAY 421
           E + +A+ELDP  S  + +R      ++NF+    D D A  L+P+NI AY
Sbjct: 33  ELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDVALRLDPKNIKAY 83

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 88  DLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAA 146
           +L  K+E   E   K A ALK +GN+    K+++ AI+ Y+ AI +   +P +YSNR+AA
Sbjct: 82  ELEVKNEEISEDKKKEAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAA 141

Query: 147 YVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAM 191
           Y  I +F   V D   A+KL P YSK + R  +A    G   DA+
Sbjct: 142 YQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAV 186

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/86 (41%), Positives = 50/86 (58%), Gaps = 2/86 (2%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAAL 164
            K +GN  F AKD+ KAI+ +T AI + E P  V YSNRSA Y S   FE+ ++D    +
Sbjct: 6   FKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECV 65

Query: 165 KLKPDYSKCWLRRASAYENLGQFSDA 190
           K+ P +SK + R  +A   L Q  +A
Sbjct: 66  KISPSWSKGYNRVGAAQFGLSQLDEA 91

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 57/102 (55%), Gaps = 5/102 (4%)

Query: 95  FTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYT-LAISLKEDPVFYSNRSAAYVSINNF 153
             PE+ ++  L    +G EFF   D+  A++ YT +     +D   +SNR+AA   + +F
Sbjct: 375 VNPEKAEEARL----QGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSF 430

Query: 154 EKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLS 195
            + +ED   A+ + P++ + ++R+A+A   + +F+ A+  L+
Sbjct: 431 PEAIEDCNKAVSIDPNFVRAYIRKATAQIAVKEFAAAIETLN 472

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 52/95 (54%), Gaps = 7/95 (7%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAA 163
           A A K +GN+ +KA+ FE+AIE+Y  A  L +D  + +NRSAA     +++  ++    A
Sbjct: 246 AEAEKAEGNKLYKARQFEEAIEHYNKAWELHKDITYLNNRSAAEFEKGDYDTAIKTLNDA 305

Query: 164 L----KLKPDY---SKCWLRRASAYENLGQFSDAM 191
           +    +L+ DY   +K + R  +AY  L     A+
Sbjct: 306 VEQGRELRADYKTIAKSFARIGNAYYKLKDLRKAI 340

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 59/104 (56%), Gaps = 2/104 (1%)

Query: 96  TPEQVDKY-ALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNF 153
           TP   D+  AL  K++GN F K K F KAIE YT AI L     +++SNR+ A+  ++NF
Sbjct: 3   TPTAADRAKALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNF 62

Query: 154 EKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           +  + D   A+KL P   K + RRA +   L +F  A  DL+ +
Sbjct: 63  QSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVL 106

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCA--CLA 428
           E + +A++LD   S  + +R   HF V+NF+ A  D D+A +L+P+NI AY + A  C+A
Sbjct: 33  EKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMA 92

Query: 429 F 429
            
Sbjct: 93  L 93

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 55/87 (63%), Gaps = 2/87 (2%)

Query: 92  KDEF-TPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVS 149
           KDE    E+    A  LK +GN+    KDF+ AI  Y+ AIS+   + ++Y+NR+AAY S
Sbjct: 86  KDELENDEETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSS 145

Query: 150 INNFEKVVEDTTAALKLKPDYSKCWLR 176
           + +FEK  ED  +A+++ P+YSK + R
Sbjct: 146 LKDFEKATEDAESAIRVDPNYSKGYSR 172

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 49/85 (57%), Gaps = 2/85 (2%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAALK 165
           K +GN  F AK++EKA++ ++ AI +  +P  V YSNRSA Y S+  F   + D     K
Sbjct: 9   KQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTK 68

Query: 166 LKPDYSKCWLRRASAYENLGQFSDA 190
           + P +SK + R  +A+  LG   +A
Sbjct: 69  INPTWSKGYNRVGAAHYGLGDLDEA 93

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 7/96 (7%)

Query: 102 KYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTT 161
           K A A KD+GN+ +KA  F++AIE+Y  A  L  D  + +N++AA     ++E  ++   
Sbjct: 256 KLADAEKDEGNKLYKAHKFDEAIEHYDKAWELHNDITYLNNKAAAQYEKGDYETTIKTLE 315

Query: 162 AAL----KLKPDY---SKCWLRRASAYENLGQFSDA 190
            A+    +L+ DY   +K + R  +AYE L     A
Sbjct: 316 DAIEKGRELRADYKIIAKAFTRMGNAYEKLNDLKKA 351

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 49/86 (56%), Gaps = 1/86 (1%)

Query: 110 KGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKP 168
           +G +FF    +  A++ YT  I+   +D   YSNR+AA   + +F + + D   AL+  P
Sbjct: 398 QGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDP 457

Query: 169 DYSKCWLRRASAYENLGQFSDAMFDL 194
           ++ K ++R+A+A   + ++S A+  L
Sbjct: 458 NFVKAYIRKATAQIAIKEYSSALETL 483

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 55/89 (61%), Gaps = 1/89 (1%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTA 162
           A  LK +GN+    KDF+ AI+ Y+ AI  L  + V+Y+NR+AA+ S+  +E+ ++D  +
Sbjct: 97  AETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAES 156

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAM 191
           A+K  P YSK + R   A   LGQ  DA+
Sbjct: 157 AIKTDPTYSKGYSRLGYAKFALGQAEDAL 185

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 58/105 (55%), Gaps = 6/105 (5%)

Query: 96  TPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP---VFYSNRSAAYVSINN 152
           T E + K A+  K++GN F K +++ KAIE YT AI L  DP   +FYSNR+ A + ++N
Sbjct: 5   TAEDIAK-AVEFKNEGNVFIKEQNYSKAIELYTKAIEL--DPNQSIFYSNRALAQLKLDN 61

Query: 153 FEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           F+    D   AL L     K + RR  A   L +F  A  DL+ V
Sbjct: 62  FQSAYNDCNEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVV 106

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 31/51 (60%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAY 421
           E + KA+ELDPN S  Y +R      ++NF+ A  D ++A  L+ +N+ AY
Sbjct: 33  ELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNEALTLDSKNVKAY 83

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDP--VFYSNRSAAYVSINNFEKVVEDTTAALK 165
           K +GN  F AKD+EKA E +  AI + E P  V YSNRSA Y S+  F + ++D    +K
Sbjct: 8   KQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVK 67

Query: 166 LKPDYSKCWLRRASAYENLGQFSDA 190
           + P +SK + R  +A   L    DA
Sbjct: 68  INPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 64/119 (53%), Gaps = 10/119 (8%)

Query: 80  PVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVF 139
           P+  N +P+  + DE  P+     A   K +GN+F+KA+ F++AIE+Y  A  L +D  +
Sbjct: 227 PLKENNEPEPMEVDEKGPQVA---AEEEKAEGNKFYKARKFDEAIEHYNKAWELHKDITY 283

Query: 140 YSNRSAAYVSINNFEKVVEDTTAAL----KLKPDY---SKCWLRRASAYENLGQFSDAM 191
            +NR+AA     ++E  +   T A+    +++ DY   +K + R  +AY  LG    ++
Sbjct: 284 LNNRAAAEYEKGDYETAIATLTNAVDEGREMRADYKVIAKSFARIGNAYHKLGDLKKSI 342

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 49/88 (55%), Gaps = 1/88 (1%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G E+F   D+  A++ YT  I    +D   YSNR+AA   + +F + + D   A++  P+
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPN 448

Query: 170 YSKCWLRRASAYENLGQFSDAMFDLSAV 197
           + + ++R+ASA   + +F+ A+  L  V
Sbjct: 449 FIRAYIRKASAQIAVKEFAAAVETLDTV 476

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 57/100 (57%), Gaps = 1/100 (1%)

Query: 93  DEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSIN 151
           D+   E+    A  LK +GN+    KD+E AI+ Y+ AI  L  + V+Y+NR+AAY S+ 
Sbjct: 82  DDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYYANRAAAYSSLK 141

Query: 152 NFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAM 191
            ++  V D  +A+K+ P YSK + R   A    G+  DA+
Sbjct: 142 KYDDAVNDAESAIKVNPTYSKGYSRLGFAKFAQGKVEDAL 181

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 1/95 (1%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTA 162
           AL LK++GN+F K K + KA EYYT AI    E+ + YSNR+   + ++NF+  ++D   
Sbjct: 13  ALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKR 72

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           A++L  +  K + RRA +Y  L +F  A  DL  V
Sbjct: 73  AIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 5/70 (7%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCA----- 425
           EY+ KA+E DP  + +Y +R   +  ++NF+ +  D  +A EL+  N+ AY + A     
Sbjct: 34  EYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRAIELDNNNLKAYHRRAMSYIG 93

Query: 426 CLAFRDDRFD 435
            L FR  R D
Sbjct: 94  LLEFRKARKD 103

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 57/89 (64%), Gaps = 1/89 (1%)

Query: 89  LSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAY 147
           +S KDE   +++   A ALK +GN+   AKD+  A+E Y  AI L     V+Y+NR+AAY
Sbjct: 88  ISDKDEEEDKELAAKAEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAY 147

Query: 148 VSINNFEKVVEDTTAALKLKPDYSKCWLR 176
            S   +++ ++D  +A+K++P++SK + R
Sbjct: 148 SSQEKYDEAIKDAESAIKVEPNWSKGYSR 176

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 105/248 (42%), Gaps = 37/248 (14%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP---VFYSNRSAAYVSINNFEKVVEDT 160
           A + KD+GN+F K +DF++A E YT AI  + DP   +FYSNR+ A + ++NF   + D 
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAI--ETDPTQSIFYSNRALANLKLDNFMNALNDC 66

Query: 161 TAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV------SLLGEYSGQSVEQLLER 214
           T A++L     K + RR  A   L  F  A  D + V       ++ +    + E+++  
Sbjct: 67  TNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIVLKYKPNDIIAKNGFDTCEKVIRE 126

Query: 215 NMNKQATKVLGEKLKE----NQGKESPLPSNTSLASFFGIFNPETSFDDYDGENEADVEL 270
              K+A     EK            S   +N  L+ + G   PE  F     E   +   
Sbjct: 127 ERFKKAIGGSDEKTGGATICQSTSLSSFDANADLSKYAG---PELEFKQLTNEKGEN--- 180

Query: 271 KKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAIAFEHVGIFKFFK 330
             G+E +   Q+    L ++ F K   L        P     KK AA    H    + F+
Sbjct: 181 -SGIEVINMSQSFISSLVNDVFLKGKNL--------P-----KKYAAAIISHCE--RLFR 224

Query: 331 NDPITAHI 338
           N+P    I
Sbjct: 225 NEPTLVEI 232

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 40/101 (39%), Gaps = 24/101 (23%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQ-----CA 425
           E + KA+E DP  S  Y +R   +  ++NF  A  D   A ELN  N+ AY +       
Sbjct: 30  ELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTNAIELNSSNLKAYHRRGLANIG 89

Query: 426 CLAFRDDR-------------------FDDCETLFSEARRK 447
            L F+  R                   FD CE +  E R K
Sbjct: 90  LLNFKSARNDFNIVLKYKPNDIIAKNGFDTCEKVIREERFK 130

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 55/95 (57%), Gaps = 1/95 (1%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTA 162
           AL  K++GN F K K F KAIE YT AI L     +++SNR+ A+  ++NF+  + D   
Sbjct: 12  ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           A+KL P   K + RRA +   L +F  A  DL+ +
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCA--CLA 428
           E + +A++LD   S  + +R   HF V+NF+ A  D D+A +L+P+NI AY + A  C+A
Sbjct: 33  EKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMA 92

Query: 429 F 429
            
Sbjct: 93  L 93

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/78 (43%), Positives = 52/78 (66%), Gaps = 1/78 (1%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTA 162
           A ALK +GN+   +KD++ A+E YT AI  L  + V+++NR+AAY +  N+++ V+D   
Sbjct: 101 AEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEE 160

Query: 163 ALKLKPDYSKCWLRRASA 180
           A+KL P YSK + R A A
Sbjct: 161 AIKLDPAYSKGYSRLAYA 178

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 46/68 (67%), Gaps = 1/68 (1%)

Query: 110 KGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKP 168
           +GN+   AK F++AIE YT AI +   + V+YSNR+AAY S+  +E+ V+D   A+++ P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 169 DYSKCWLR 176
            YSK + R
Sbjct: 161 TYSKGFSR 168

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISLKE-DPVFYSNRSAAYVSINNFEKVVEDTTA 162
           AL  K++GN   K +D+ KAIE Y  AI L +   V++SNR+  ++ ++NF+   +D   
Sbjct: 9   ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDK 68

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           AL L P   K + RR  A   L +F  A  DL+ V
Sbjct: 69  ALALDPKNVKAYHRRGLACVGLLEFKKARADLTVV 103

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 2/61 (3%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQ--CACLA 428
           E +DKA+ELD   S  + +R   H  ++NF+ A  D DKA  L+P+N+ AY +   AC+ 
Sbjct: 30  EKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHRRGLACVG 89

Query: 429 F 429
            
Sbjct: 90  L 90

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (58%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAA 163
           A ALK +GNE      +E+AI+ YT AI   ++  +YSNRS AY  +  +E  V D T A
Sbjct: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141

Query: 164 LKLKPDYSKCWLR 176
           + + P +SK + R
Sbjct: 142 INIDPSFSKAYSR 154

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 77/159 (48%), Gaps = 13/159 (8%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLKED-----PVFYSNRSAAYVSINNFEKVVEDTT 161
            K++GNEF+K K +  A E YT  I +K D        Y+NR+A  + + NF K +ED  
Sbjct: 77  FKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCK 136

Query: 162 AALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLE----RNMN 217
            AL       KC+ R   A+ ++ +F ++   +    L  +   +S++ LL+    R + 
Sbjct: 137 KALSFNVKNIKCYYRMGKAFLSVDRFDESKESIE-FGLKIDSENKSLKNLLQAIEKRQLE 195

Query: 218 KQATKVLGEKLK-ENQGKESPLPSNTSL--ASFFGIFNP 253
            Q  K +  K+K E +GK+  L +   L   +  G  NP
Sbjct: 196 IQRRKDMEMKIKLEKEGKKVILENAMKLRNITMIGTSNP 234

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/95 (35%), Positives = 54/95 (56%), Gaps = 1/95 (1%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISLKE-DPVFYSNRSAAYVSINNFEKVVEDTTA 162
           AL  K++GN + K K +++A+EYY+ AI L +   +++SNR+ + + ++NF    ED   
Sbjct: 10  ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDK 69

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           A+ L P   K   RR  +Y  L +F  A  DL  V
Sbjct: 70  AIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 28/48 (58%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENI 418
           EY+ KA+ELD   S  + +R      ++NF  A  D DKA  L+P+NI
Sbjct: 31  EYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIALDPKNI 78

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 51/74 (68%), Gaps = 1/74 (1%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTA 162
           A +LK +GN+    KD+E AI+ Y+ AIS+   + V+Y+NR+AA+ S+ N+++ ++D  +
Sbjct: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152

Query: 163 ALKLKPDYSKCWLR 176
           A+K+   YSK + R
Sbjct: 153 AVKVDSSYSKGYSR 166

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/104 (35%), Positives = 57/104 (54%), Gaps = 2/104 (1%)

Query: 96  TPEQVDKY-ALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNF 153
            P + D+  A   K++GN   K K F KAIE YT AI L     +++SNR+ ++  ++NF
Sbjct: 3   NPTEADRVKAHERKNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNF 62

Query: 154 EKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197
           +  + D   A+KL P   K + RRA +   L +F  A  DL+ +
Sbjct: 63  QSALNDCDEAIKLDPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCA--CLA 428
           E + +A++LD   +  + +R   HF V+NF+ A  D D+A +L+P+NI AY + A  C+A
Sbjct: 33  EKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPKNIKAYHRRALSCMA 92

Query: 429 F 429
            
Sbjct: 93  L 93

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 52/107 (48%), Gaps = 13/107 (12%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKED-----PVFYSNRSAAYVSINNFEKVVEDTTA 162
           K++GN+ +K K F  A E Y  AI +K D        Y+NR+A  + + N+ + + D   
Sbjct: 78  KNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKM 137

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDA--------MFDLSAVSLLG 201
           AL L P   KC+ R A A+  + +F D          FDL   SLL 
Sbjct: 138 ALSLNPKNIKCYFRMAKAFLAIEKFDDCKEAIQFGLKFDLENKSLLN 184

 Score = 34.7 bits (78), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 4/73 (5%)

Query: 370 KEYFDKALEL----DPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCA 425
           +E ++KA+++    D    ++Y +R      ++N++    D   A  LNP+NI  Y + A
Sbjct: 94  RELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKMALSLNPKNIKCYFRMA 153

Query: 426 CLAFRDDRFDDCE 438
                 ++FDDC+
Sbjct: 154 KAFLAIEKFDDCK 166

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 64/137 (46%), Gaps = 8/137 (5%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLKEDPV-----FYSNRSAAYVSINNFEKVVEDTT 161
            K++GN+ +K K F  A E YT  I +K D        Y+NR+A  + + NF   + D  
Sbjct: 81  FKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCK 140

Query: 162 AALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLE--RNMNKQ 219
            AL   P   KC+ R   A+  + +F  A   +     + +   +S E LL   +N  ++
Sbjct: 141 TALTYNPKNIKCYFRMGKAFTAINKFESARESIEFGQKI-DNDNKSFENLLNIIKNKEEE 199

Query: 220 ATKVLGEKLKENQGKES 236
             K   +KLK  Q +E+
Sbjct: 200 IRKYEEKKLKAQQDREN 216

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 58/94 (61%), Gaps = 1/94 (1%)

Query: 99  QVDKYALALKDKGNEFFKAKDFEKAIEYYTLAI-SLKEDPVFYSNRSAAYVSINNFEKVV 157
           ++   A ALK +GN+    KDFE AI  Y+ AI +L  + V+++NR+AAY S+  + + V
Sbjct: 93  EIKAKAEALKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAV 152

Query: 158 EDTTAALKLKPDYSKCWLRRASAYENLGQFSDAM 191
           ED  AA+K+ P YSK + R   A   LG+  +A+
Sbjct: 153 EDAEAAIKVNPSYSKGYSRLGFAQYALGRPEEAL 186

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 52/86 (60%), Gaps = 2/86 (2%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISL--KEDPVFYSNRSAAYVSINNFEKVVEDTTAAL 164
           LK+ GN+ +K K +E+A+ Y+T A+S       + YSNR+AA++ + ++ + +ED    +
Sbjct: 11  LKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCV 70

Query: 165 KLKPDYSKCWLRRASAYENLGQFSDA 190
           +L P++ K + R   AY  L +  +A
Sbjct: 71  ELAPNWDKGYSRVGVAYLGLQKLDEA 96

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G + F  +++ KA++ YT  I      PV + NR+A +  +    +V++D   A+ + P 
Sbjct: 436 GKQHFLNREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPS 495

Query: 170 YSKCWLRRASA 180
           Y K ++R+  A
Sbjct: 496 YIKAYVRKGFA 506

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 56/109 (51%), Gaps = 9/109 (8%)

Query: 92  KDEFTPEQVDKYALALKDK--GNEFFKAKDFEKAIEYYTLAISLKEDPVFYSNRSAAYVS 149
           + + +PE+ +K   A ++K  GN+ +K ++F++AI +YT A +  +D  + +N  AA   
Sbjct: 281 QQKLSPEETEKKRRADEEKRIGNDLYKKRNFKEAIIHYTKAWNTFQDITYLNNIGAAQFE 340

Query: 150 INNFEKVVEDTTAAL----KLKPD---YSKCWLRRASAYENLGQFSDAM 191
             ++  V++    A+       P+    +K ++R  +AY  +     A+
Sbjct: 341 RGDYGNVLKSLGQAVFFAEHTNPEPQVLAKSYIRMGNAYHRIWDHEHAI 389

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 52/89 (58%), Gaps = 5/89 (5%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLK-EDPV----FYSNRSAAYVSINNFEKVVEDTT 161
            K +GNE +KAK F+ A E YT  I+++ ED       ++NR+A  + + N+ + +ED +
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCS 145

Query: 162 AALKLKPDYSKCWLRRASAYENLGQFSDA 190
            AL + P   KC+ R + A+ +L +  +A
Sbjct: 146 KALTINPKNIKCYYRTSKAFFSLSKLEEA 174

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 56.6 bits (135), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 51/89 (57%), Gaps = 5/89 (5%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYT--LAISLKEDPV---FYSNRSAAYVSINNFEKVVEDTT 161
            K +GNE +KAK F+ A E Y+  LA+  ++  +    Y+NR+A  + + N+ + +ED +
Sbjct: 86  FKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCS 145

Query: 162 AALKLKPDYSKCWLRRASAYENLGQFSDA 190
            AL + P   KC+ R + A+  L +  +A
Sbjct: 146 KALTINPKNVKCYYRTSKAFFQLNKLEEA 174

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 51/81 (62%), Gaps = 1/81 (1%)

Query: 99  QVDKYALALKDKGNEFFKAKDFEKAIEYYTLAI-SLKEDPVFYSNRSAAYVSINNFEKVV 157
           ++   A + K +GN+   AKD+  AIE Y+ AI +L  + ++Y+NR+AAY S+  ++  +
Sbjct: 94  EIKATAESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAI 153

Query: 158 EDTTAALKLKPDYSKCWLRRA 178
           +D   A+++ P YSK + R A
Sbjct: 154 KDAEKAIEIDPAYSKGYSRLA 174

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/74 (40%), Positives = 47/74 (63%), Gaps = 1/74 (1%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTA 162
           A ALK +GN+    KDFE AI  Y+ AI  L  + ++Y+NR+AA+ S+  +++ V D   
Sbjct: 93  AEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEK 152

Query: 163 ALKLKPDYSKCWLR 176
           A+++ P YSK + R
Sbjct: 153 AIEIDPAYSKGYSR 166

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALK 165
           LK +GN+    KD+E AI  YT AI  L  + ++Y+NR+AA+ S+  +++ VED  +A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164

Query: 166 LKPDYSKCWLR 176
           + P Y + + R
Sbjct: 165 IDPTYFRGYSR 175

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 59/120 (49%), Gaps = 6/120 (5%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDPV-----FYSNRSAAYVSINNFEKVVEDTTA 162
           K++GN+ +KAK F+ A E Y   I +K D        Y+NR+A  + I N+ + + D   
Sbjct: 82  KNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCKT 141

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLERNMNKQATK 222
           AL+  P   KC+ R   A+  L    +A   +    L  + S + ++ LL+  + KQ  K
Sbjct: 142 ALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE-FGLQVDSSNKPLQSLLDIVLKKQEAK 200

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 52/92 (56%), Gaps = 5/92 (5%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPVF-----YSNRSAAYVSINNFEKVVE 158
           A   K +GNE +KAK F+ A E Y   ++++ +  F     ++N++A  + + N+ + +E
Sbjct: 83  AGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIE 142

Query: 159 DTTAALKLKPDYSKCWLRRASAYENLGQFSDA 190
           D + AL + P  +KC+ R + A+  L +  +A
Sbjct: 143 DCSKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 47/89 (52%), Gaps = 5/89 (5%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLK-----EDPVFYSNRSAAYVSINNFEKVVEDTTA 162
           K +GN+ +K K F  A E Y+  I +K      +   Y+NR+A  + I N+ + + D   
Sbjct: 85  KKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQ 144

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDAM 191
           AL+L P   KC+ R A A+  L +  +A+
Sbjct: 145 ALQLNPKNIKCYYRIAKAFTALERLDEAL 173

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 53.5 bits (127), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALK 165
           LK +GN+    KD+E AI  YT AI  L  + ++Y+NR+AA+ S+  +++ V+D  +A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAIS 164

Query: 166 LKPDYSKCWLR 176
           + P Y + + R
Sbjct: 165 IDPSYFRGYSR 175

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 62/112 (55%), Gaps = 9/112 (8%)

Query: 86  QPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKE------DPVF 139
           +P LS+K+    E V++ A+ LK +GN+  + ++++ AI+ YT AI L +      D  +
Sbjct: 69  EPKLSEKER---ELVNEQAIKLKLEGNKAVERENYKDAIDKYTRAIDLLKKNGLPVDRGY 125

Query: 140 YSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAM 191
            SN+S A      +E+  +D  A +K+ P +SK + R A A     ++ DAM
Sbjct: 126 LSNKSLALTKSGRYEEACDDALACIKIDPTFSKGYSRLAEAKIGQNKYEDAM 177

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 50/89 (56%), Gaps = 5/89 (5%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLK-EDPV----FYSNRSAAYVSINNFEKVVEDTT 161
            K +GNE +KAK F+ A E YT  ++++ ED       ++NR+A  + + N+ K VED  
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCG 145

Query: 162 AALKLKPDYSKCWLRRASAYENLGQFSDA 190
            AL + P   KC+ R + ++  L +  +A
Sbjct: 146 KALTINPKNIKCYYRISKSFFQLRKLEEA 174

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/89 (33%), Positives = 46/89 (51%), Gaps = 5/89 (5%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLKEDP-----VFYSNRSAAYVSINNFEKVVEDTT 161
            K++GNE +K K ++ A E Y   I +K D        +SNR+A  + + N+ + V D  
Sbjct: 81  FKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCR 140

Query: 162 AALKLKPDYSKCWLRRASAYENLGQFSDA 190
            AL+  P   KC+ R A A+  L +  DA
Sbjct: 141 QALQFNPTNIKCFYRIARAFFLLDKCEDA 169

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALK 165
           LK +GN+    KD+E AI  YT AI  L  + ++Y+NR+AA+ S+  +++ V+D  +++ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSIS 164

Query: 166 LKPDYSKCWLR 176
           + P Y + + R
Sbjct: 165 IDPSYFRGYSR 175

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 51/95 (53%), Gaps = 5/95 (5%)

Query: 102 KYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDT 160
           K A  LK+KGNE  KAK + KAI  Y+ AI L   +  +Y+NR+ AY+  NNF+  + D 
Sbjct: 132 KKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDA 191

Query: 161 TAAL----KLKPDYSKCWLRRASAYENLGQFSDAM 191
             ++    K+ P   K + R   A   +G +  ++
Sbjct: 192 NKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSL 226

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 46/71 (64%), Gaps = 1/71 (1%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALK 165
           LK +GN+    K++E AI+ YT AI  L  + ++Y+NR+AA+ S+  +++ ++D  +A+ 
Sbjct: 105 LKIQGNKAMANKEYELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAIS 164

Query: 166 LKPDYSKCWLR 176
           + P Y + + R
Sbjct: 165 VDPSYFRGYSR 175

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 5/89 (5%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLKED-----PVFYSNRSAAYVSINNFEKVVEDTT 161
            K++GN+ ++AK ++ A E Y   I +K D        +SNR+A  + + N+ + V D  
Sbjct: 81  FKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCK 140

Query: 162 AALKLKPDYSKCWLRRASAYENLGQFSDA 190
            AL+      KC+ R A A+  L +  DA
Sbjct: 141 RALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 6/90 (6%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLKEDP------VFYSNRSAAYVSINNFEKVVEDT 160
            K++GN+ +KAK F+ A + Y   I ++ +         ++N++A  + + NF + + D 
Sbjct: 79  FKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFRRCINDC 138

Query: 161 TAALKLKPDYSKCWLRRASAYENLGQFSDA 190
             AL+L P   KC+ R   A+  L +  +A
Sbjct: 139 KNALQLNPKNVKCYFRMTRAFFALDKLEEA 168

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 72/139 (51%), Gaps = 12/139 (8%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLK--EDPV---FYSNRSAAYVSINNFEKVVEDTT 161
            K++ N+ +KAK F++A E Y   I +K  +D V    ++N +A  + I NF + +    
Sbjct: 81  FKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRRCINLCQ 140

Query: 162 AALKLKPDYSKCWLRRASAYENLGQFSDA----MFDLSAVSLLGEYSGQSVEQLLERNMN 217
            AL+  P   KC+ R A A+  L +  +A     F L+  S     S Q++E +++R   
Sbjct: 141 KALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDS--ENKSLQTLEGVIDRK-Q 197

Query: 218 KQATKVLGEKLKENQGKES 236
           ++  +   ++L+E Q KE+
Sbjct: 198 QELHEAEVKRLEEKQKKEN 216

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 9/91 (9%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAI-------SLKEDPVFYSNRSAAYVSINNFEKVVED 159
            K++ N+ +K K F  A E YT  I       S+ E    ++NR+A  + + N+   V D
Sbjct: 88  FKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINES--LFANRAACELELKNYRSCVAD 145

Query: 160 TTAALKLKPDYSKCWLRRASAYENLGQFSDA 190
              A+++ P   KC+ R   A+  LG+F +A
Sbjct: 146 CQKAMEINPMNLKCFYRMGKAFLALGKFKEA 176

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 45/90 (50%), Gaps = 8/90 (8%)

Query: 106 ALKDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAAL 164
            +K++GN  F+  +F  A EYY   I L+ E+P+ YSNR+ A + +  F + ++     L
Sbjct: 6   TVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGL 65

Query: 165 -------KLKPDYSKCWLRRASAYENLGQF 187
                  K +P   K   R   A E+L +F
Sbjct: 66  GKLEDNEKDEPIRKKLLYRLHLAQESLNKF 95

>KNAG0B02240 Chr2 complement(434466..436685) [2220 bp, 739 aa] {ON}
           Anc_7.412 YBL084C
          Length = 739

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 81/204 (39%), Gaps = 13/204 (6%)

Query: 355 YMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELN 414
           Y +LI  D GEA    + F+KA  LD   +  Y  +G  H   E +  A   + KA   +
Sbjct: 530 YFSLI-KDHGEA---IKAFEKATSLDRKFAYAYTLQGHEHAANETYDTAKIMYRKAIACD 585

Query: 415 PENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQ 474
           P++  AY      A R  ++D     F +AR   P    +       L   N  D A+  
Sbjct: 586 PQHYNAYYGLGDCASRLGKYDKALLYFEKARVINPVNAILICCCGHSLEKLNLPDQALTY 645

Query: 475 YDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIG 534
           Y++A KL+  +        P   KA  L    ++  F  A  +FE   K+ P        
Sbjct: 646 YELAEKLQPEM------TIPKYKKAQLLF---SLGKFSSAMYIFESLTKLSPEEVTVHFM 696

Query: 535 LAQLKLQQEEIDDAIQLFEDAADL 558
           L Q+        DAI+ +  A +L
Sbjct: 697 LGQIYQTMGRKKDAIKEYTIALNL 720

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLK--EDPV---FYSNRSAAYVSINNFEKVVEDTT 161
            K++GN+ F  K F +A + Y   I +K   D +    ++NR+A  + + N+   + D  
Sbjct: 83  FKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCINDCK 142

Query: 162 AALKLKPDYSKCWLRRASAYENLGQFSDA 190
            AL L P   KC+ R   A+  L    +A
Sbjct: 143 HALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 98  EQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKV 156
           E +++ A  LK KGN FFK  D+E AI YY  A +L   +P+++SN + A + +  +++ 
Sbjct: 35  ESMNETAEDLKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEA 94

Query: 157 V 157
           V
Sbjct: 95  V 95

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 45/93 (48%), Gaps = 5/93 (5%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDPV-----FYSNRSAAYVSINNFEKVVE 158
           A   K++GN+ +K K F+ A   Y  A+ +K D +      Y N +A  + I N+   + 
Sbjct: 70  ATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACELEIKNYRSCIN 129

Query: 159 DTTAALKLKPDYSKCWLRRASAYENLGQFSDAM 191
               ALKL     K + R   AY  LG+F D++
Sbjct: 130 YCREALKLNAKNVKAFFRIGKAYLELGRFEDSL 162

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 1/112 (0%)

Query: 372 YFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRD 431
           Y  K+LE+DPN S  +YH G++H +  ++  A   F +A   +  N   +     L ++ 
Sbjct: 294 YLLKSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 353

Query: 432 DRFDDCETLFSEARRKFPTAPEVPNFYAEIL-AAKNSLDAAIKQYDIAIKLE 482
            ++ D    ++ A R  P   EV      +     N L+ A+  Y  A +L+
Sbjct: 354 SQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLD 405

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G       D+  A + +  A++    +P+F+ +    Y  I+ +   ++  T A++L P 
Sbjct: 313 GRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 372

Query: 170 YSKCWLRRASAYENL-GQFSDAM 191
            S+ W    + YE    Q +DA+
Sbjct: 373 ISEVWYDLGTLYETCNNQLNDAL 395

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 106 ALKDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAAL 164
            LK KGN FFK  D+E A+ YY  AI+    +P+ YSN +   + +  + + V+     L
Sbjct: 6   TLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGL 65

Query: 165 KL 166
           K+
Sbjct: 66  KM 67

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 42/88 (47%), Gaps = 5/88 (5%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKEDPVFYS-----NRSAAYVSINNFEKVVEDTTA 162
           K++GN+ +K K F  A   Y   I +K D    S     NR+A  + + N+ + + D   
Sbjct: 81  KNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCRE 140

Query: 163 ALKLKPDYSKCWLRRASAYENLGQFSDA 190
           ALKL P   K + R   A+  L +  +A
Sbjct: 141 ALKLNPKNPKAFFRIGKAFLQLDKLEEA 168

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/89 (24%), Positives = 44/89 (49%), Gaps = 5/89 (5%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLKED-----PVFYSNRSAAYVSINNFEKVVEDTT 161
            K++GN+ ++A+ ++ A E Y   + +  D        + NR+A  + + N  + + D  
Sbjct: 83  FKNQGNDLYRARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCINDCK 142

Query: 162 AALKLKPDYSKCWLRRASAYENLGQFSDA 190
            AL+  P   KC+ R   A+ +L +  +A
Sbjct: 143 EALRYNPKNVKCFYRMGRAFFSLNKLEEA 171

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 44/88 (50%), Gaps = 6/88 (6%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKL 166
           K++GN  FK   ++ A E Y   + ++ E+P+ YSN++ A + +  + +VVE     L  
Sbjct: 7   KEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTF 66

Query: 167 KPD-----YSKCWLRRASAYENLGQFSD 189
            P+     Y K   R   A +N+   +D
Sbjct: 67  TPNTTDTVYKKLNYRLEMALKNMKHVND 94

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKL 166
           K  GN +FK  ++ KA+EYY   I ++ E+P+ YSN + + + +  + + +E     LK 
Sbjct: 7   KTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLKY 66

Query: 167 KPD 169
             D
Sbjct: 67  VND 69

>TDEL0D03600 Chr4 (661898..664537) [2640 bp, 879 aa] {ON} Anc_3.265
           YBR055C
          Length = 879

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 39/176 (22%), Positives = 77/176 (43%), Gaps = 11/176 (6%)

Query: 353 YIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFV-VENFKEAGADFDKAK 411
           YI +  I    G+  + +E +    +  P+C+ ++  + +   +  +    A ++ DKA 
Sbjct: 652 YIQLGQIYQYIGQPKKMRETYSIGSKTLPHCAILWILKAKADEIDFQQPTRARSELDKAL 711

Query: 412 ELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAA 471
             NP  I  Y+    +  R    D    +  +A +KFP +P++ +    +L AK    A+
Sbjct: 712 LKNPNEISLYLAKIQMEVRLGFQDQARLIVQQALQKFPNSPDLWSANISLLPAKR---AS 768

Query: 472 IKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPR 527
           +K+       +DAL   +     ++    +  R+     FV A + F+ A K DP+
Sbjct: 769 MKK----TMFQDALKKTNNSCQVLLEIGLSFYRD---SQFVTALKWFDRASKSDPK 817

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 40/83 (48%)

Query: 372 YFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRD 431
           Y  K+LE+DP+ +  +YH G++H V  ++  A   F +A   +  N   +     L ++ 
Sbjct: 303 YLLKSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 362

Query: 432 DRFDDCETLFSEARRKFPTAPEV 454
            ++ D    ++ A R  P   EV
Sbjct: 363 SQYRDALDAYTRAIRLNPYISEV 385

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G       D+  A + +  A++    +P+F+ +    Y  I+ +   ++  T A++L P 
Sbjct: 322 GRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 381

Query: 170 YSKCWLRRASAYENL-GQFSDAM 191
            S+ W    + YE    Q +DA+
Sbjct: 382 ISEVWYDLGTLYETCNNQLTDAL 404

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 54/116 (46%), Gaps = 26/116 (22%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAI-SLKEDP----VFYSNRSAAYVSINNFEKVVEDTTA 162
           KD+G EFFKA D+  A + Y  ++ SL ++     V YSN +AA   +  +++ + D  +
Sbjct: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336

Query: 163 ALKLKPDYSKCW---------------------LRRASAYENLGQFSDAMFDLSAV 197
           AL++ P     W                      RRA A+E++  +  A+ D  ++
Sbjct: 337 ALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSL 392

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALK 165
           LK +GN FF+  D+ +A  YY   I L+  +P+ YSN++ + +   N    VE     LK
Sbjct: 6   LKQEGNTFFQKGDYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLK 65

Query: 166 LKPDYSK 172
                +K
Sbjct: 66  YTSSSTK 72

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 40/83 (48%)

Query: 372 YFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRD 431
           +  K+LE+DP+ +  +YH G++H +  ++  A   F +A   +  N   +     L ++ 
Sbjct: 292 FLSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 351

Query: 432 DRFDDCETLFSEARRKFPTAPEV 454
            ++ D    ++ A R  P   EV
Sbjct: 352 SQYRDALDAYTRAIRLNPYISEV 374

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G       D+  A + +  A++    +P+F+ +    Y  I+ +   ++  T A++L P 
Sbjct: 311 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 370

Query: 170 YSKCWLRRASAYENL-GQFSDAM 191
            S+ W    + YE    Q +DA+
Sbjct: 371 ISEVWYDLGTLYETCNNQLTDAL 393

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 40/80 (50%)

Query: 375 KALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRF 434
           K+LE+DP+ +A +YH G++H +  ++  A   F +A   +  N   +     L ++  ++
Sbjct: 296 KSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 355

Query: 435 DDCETLFSEARRKFPTAPEV 454
            D    ++ A R  P   EV
Sbjct: 356 RDALDAYTRAIRLNPYISEV 375

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/57 (26%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 136 DPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLG-QFSDAM 191
           +P+F+ +    Y  I+ +   ++  T A++L P  S+ W    + YE    Q +DA+
Sbjct: 338 NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNKQLNDAL 394

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 40/83 (48%)

Query: 372 YFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRD 431
           Y  K+LE+DP+ +  +YH G++H +  ++  A   F +A   +  N   +     L ++ 
Sbjct: 292 YLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 351

Query: 432 DRFDDCETLFSEARRKFPTAPEV 454
            ++ D    ++ A R  P   EV
Sbjct: 352 SQYRDALDAYTRAIRLNPYISEV 374

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G       D+  A + +  A++    +P+F+ +    Y  I+ +   ++  T A++L P 
Sbjct: 311 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 370

Query: 170 YSKCWLRRASAYENL-GQFSDAM 191
            S+ W    + YE    Q +DA+
Sbjct: 371 ISEVWYDLGTLYETCNNQLTDAL 393

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 47/210 (22%), Positives = 85/210 (40%), Gaps = 9/210 (4%)

Query: 349 RPSTYIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFD 408
           +P T+  +   ++ K +     E F+KA ++DP  +  Y  +G      ++F  A   F 
Sbjct: 550 KPETWCCVGNYLSLKKDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFR 609

Query: 409 KAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSL 468
           KA   +P +  AY      + +   +D+    F +AR+ +P    +       L      
Sbjct: 610 KAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQIYPINAVLICCCGVALEKLEYQ 669

Query: 469 DAAIKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRS 528
           D A++ Y++A  L+   P  ++          A+ R      +  A + FEE  K+ P  
Sbjct: 670 DKALEYYELACTLQ---PNSNLARFKRANLLYAMGR------YNLALQSFEELSKLTPEE 720

Query: 529 EQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
                 L QL       ++AI+ F  A +L
Sbjct: 721 PTVHFVLGQLYQIMGRKNEAIREFTVAMNL 750

 Score = 38.9 bits (89), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 66/170 (38%), Gaps = 13/170 (7%)

Query: 391 GQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPT 450
           G++H+ + N++ A   F +  EL P  I      + L +    +    +L       +P 
Sbjct: 490 GKLHYEIVNYEMASIYFMQLFELQPYRISDTEIFSTLLWHLQDYKRLASLVDYLLTYYPN 549

Query: 451 APEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVEN 510
            PE        L+ K   + AI+ ++ A K++           P    A  L  +    N
Sbjct: 550 KPETWCCVGNYLSLKKDHEDAIEAFEKATKID-----------PKFAYAYTLQGHECSSN 598

Query: 511 --FVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
             F  A + F +A   DPR   A  G+    ++    D+A+  FE A  +
Sbjct: 599 DSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLGHYDEALLYFEKARQI 648

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 40/84 (47%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFR 430
           +Y  K+LE DP+ +  +YH G++H +  ++  A   F +A   +  N   +     L ++
Sbjct: 287 DYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 346

Query: 431 DDRFDDCETLFSEARRKFPTAPEV 454
             ++ D    ++ A R  P   EV
Sbjct: 347 ISQYRDALDAYTRAIRLNPYISEV 370

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G       D+  A + +  A++    +P+F+ +    Y  I+ +   ++  T A++L P 
Sbjct: 307 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 366

Query: 170 YSKCWLRRASAYENL-GQFSDAM 191
            S+ W    + YE    Q SDA+
Sbjct: 367 ISEVWYDLGTLYETCNNQLSDAL 389

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 40/84 (47%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFR 430
           +Y  K+LE DP+ +  +YH G++H +  ++  A   F +A   +  N   +     L ++
Sbjct: 285 DYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 344

Query: 431 DDRFDDCETLFSEARRKFPTAPEV 454
             ++ D    ++ A R  P   EV
Sbjct: 345 ISQYRDALDAYTRAIRLNPYISEV 368

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G       D+  A + +  A++    +P+F+ +    Y  I+ +   ++  T A++L P 
Sbjct: 305 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 364

Query: 170 YSKCWLRRASAYENL-GQFSDAM 191
            S+ W    + YE    Q SDA+
Sbjct: 365 ISEVWYDLGTLYETCNNQLSDAL 387

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 40/84 (47%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFR 430
           +Y  K+LE DP+ +  +YH G++H +  ++  A   F +A   +  N   +     L ++
Sbjct: 283 DYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 342

Query: 431 DDRFDDCETLFSEARRKFPTAPEV 454
             ++ D    ++ A R  P   EV
Sbjct: 343 ISQYRDALDAYTRAIRLNPYISEV 366

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G       D+  A + +  A++    +P+F+ +    Y  I+ +   ++  T A++L P 
Sbjct: 303 GRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 362

Query: 170 YSKCWLRRASAYENL-GQFSDAM 191
            S+ W    + YE    Q SDA+
Sbjct: 363 ISEVWYDLGTLYETCNNQLSDAL 385

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALK 165
           LK KGN  FK   + +AI +Y   IS+   +P+ YSN++ A +  + F++ +      L+
Sbjct: 6   LKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQ 65

Query: 166 L 166
           L
Sbjct: 66  L 66

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 41.2 bits (95), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 40/84 (47%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFR 430
           +Y  K+LE DP+ +  +YH G++H +  ++  A   F +A   +  N   +     L ++
Sbjct: 277 DYLLKSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ 336

Query: 431 DDRFDDCETLFSEARRKFPTAPEV 454
             ++ D    ++ A R  P   EV
Sbjct: 337 ISQYRDALDAYTRAIRLNPYISEV 360

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 119 DFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRR 177
           D+  A + +  A++    +P+F+ +    Y  I+ +   ++  T A++L P  S+ W   
Sbjct: 305 DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDL 364

Query: 178 ASAYENL-GQFSDAM 191
            + YE    Q SDA+
Sbjct: 365 GTLYETCNNQLSDAL 379

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 60/138 (43%), Gaps = 9/138 (6%)

Query: 372 YFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRD 431
           Y  K+LE+DP+ +  +YH G++H +  ++  A   F +A   +  N   +     L ++ 
Sbjct: 286 YLLKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 345

Query: 432 DRFDDCETLFSEARRKFPTAPEVPNFY---AEILAAKNSLDAAIKQYDIAIKLEDALPGI 488
            ++ D    ++ A R  P   EV  +Y          N L  A+  Y  A +L+     I
Sbjct: 346 SQYRDALDAYTRAIRLNPYISEV--WYDLGTLYETCNNQLSDALDAYKQAARLDPE--NI 401

Query: 489 HVGIAPMIGKATALIRNP 506
           H  I   +   TA + NP
Sbjct: 402 H--IRKRLETLTAQLENP 417

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 2/75 (2%)

Query: 119 DFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRR 177
           D+  A + +  A++    +P+F+ +    Y  I+ +   ++  T A++L P  S+ W   
Sbjct: 313 DYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDL 372

Query: 178 ASAYENL-GQFSDAM 191
            + YE    Q SDA+
Sbjct: 373 GTLYETCNNQLSDAL 387

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 43/92 (46%), Gaps = 5/92 (5%)

Query: 104 ALALKDKGNEFFKAKDFEKAIEYYTLAISLK--EDPV---FYSNRSAAYVSINNFEKVVE 158
           A   K++GN+ +K K ++ A   Y+  I +K  +D +    Y NR+A  + + NF   + 
Sbjct: 79  AANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACELELRNFRSCIN 138

Query: 159 DTTAALKLKPDYSKCWLRRASAYENLGQFSDA 190
           D   AL       K + R   AY  L +  +A
Sbjct: 139 DCKKALNFNAKCVKAFYRMGQAYFKLKKLEEA 170

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 69/151 (45%), Gaps = 22/151 (14%)

Query: 282 TGCYELADEEFTKAAELYKKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLE 341
           T  + L D+     +++ K  +++ P+N       +I++  +G +    ND   A   L+
Sbjct: 592 TVLWHLKDK--INLSQISKTLIDNYPNN-------SISWCFIGNYFSLINDHDKAIKYLK 642

Query: 342 ESLSLNPRPSTYIYM------ALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHF 395
           ++ ++NPR  TY Y       A I A     N Y+    KA+  DPN    YY  G    
Sbjct: 643 KATTINPR-FTYAYTLEGHEQASIDAFDTAKNCYR----KAIACDPNHYNAYYGLGTCCM 697

Query: 396 VVENFKEAGADFDKAKELNPENIFAYIQCAC 426
            +  + +A   F+KAK +NP N  A + C C
Sbjct: 698 RLGQYDQALLYFEKAKMINPSN--AILLCCC 726

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 73/185 (39%), Gaps = 21/185 (11%)

Query: 381 PNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETL 440
           PN S  +   G    ++ +  +A     KA  +NP   +AY          D FD  +  
Sbjct: 615 PNNSISWCFIGNYFSLINDHDKAIKYLKKATTINPRFTYAYTLEGHEQASIDAFDTAKNC 674

Query: 441 FSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGKAT 500
           +   R+     P   N Y  +     +    + QYD A+        ++   A MI  + 
Sbjct: 675 Y---RKAIACDPNHYNAYYGL----GTCCMRLGQYDQAL--------LYFEKAKMINPSN 719

Query: 501 ALIR---NPTVE--NFVE-ASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFED 554
           A++       +E  NF E A   +E AC + P S  AK  LA+L       + A+++ E 
Sbjct: 720 AILLCCCGSALEKLNFNEKALNYYELACNLQPNSSFAKFKLAKLLYSMSRYNLALEILEQ 779

Query: 555 AADLS 559
             +++
Sbjct: 780 VIEMA 784

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 37.0 bits (84), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALK 165
            K +GN++FK  ++  AI+ Y   I +  E+P+ YSN++ A +  N  ++ V      LK
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGLK 65

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 53/108 (49%), Gaps = 7/108 (6%)

Query: 456 NFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAP--MIGKATALIRNPTVENFVE 513
           N+  E+ A  N+  +A++  +  +K E A   +     P  +IG     I N   +   +
Sbjct: 629 NYMTEVYAKSNNWSSAVQIAERLVKAEKAKRVLQTMNWPYRVIG-----IGNLERQQESD 683

Query: 514 ASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADLSRS 561
           + E F+ A ++DP   ++ IGL Q  L    I+ +I++FE A +L  S
Sbjct: 684 SIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSS 731

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 72/349 (20%), Positives = 150/349 (42%), Gaps = 52/349 (14%)

Query: 114 FFKAKD-FEKAIEYYTLAISLKEDPVF---YSNRSAAYVSINNFEKVVEDTTAALK--LK 167
            ++A+D F KA + Y  A+++  DP     ++     Y+ +++ +K       AL     
Sbjct: 207 LYRARDMFHKASQLYERALAI--DPSLSDIWATLGHCYLMLDDLQKAYNAYQQALNNLSD 264

Query: 168 PDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLERNMN-KQATKV--- 223
           P+  K W      Y+  G                +++ ++ +++L+ + N ++A ++   
Sbjct: 265 PNVPKLWHGIGILYDRYGSL--------------DFAEEAFKKVLDLDPNFEKANEIYFR 310

Query: 224 LG----EKLKENQGKES-------PLPSNTSLASFFGIFNPETSFDDYDGENEADVELKK 272
           LG     K + N+  ES       P P  T    +F I N   +  D++G  +A   + K
Sbjct: 311 LGIIYKHKGRWNEAIESLNCILKRPPPPLTESDIWFQIGNILENKFDWNGAKDAYEHVSK 370

Query: 273 GLENLYKC--QTGC-YELADEEFTK---AAELYKKELESSPDNESLKKKAAIAFEHVGIF 326
              +  K   Q GC Y + + EF     A     K LE  P + +        + ++G  
Sbjct: 371 NNNSNPKLLKQLGCLYSMENVEFYNLDIAMGHLVKSLELDPTDST-------TWYYLGRI 423

Query: 327 KFFKNDPITAHINLEESLSLNPR-PSTYIYMALIMADKGEANQYKEYFDKALELDPNCSA 385
              K D   A+ +L+++++ + R P  +  + ++    G+ +   + + +A+ L+P  S 
Sbjct: 424 HMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQNHDALDAYTRAIRLNPYISE 483

Query: 386 VYYHRGQMHFVV-ENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDR 433
           V+Y+ G ++    +   +A   +++A  L+PEN     +   L  +D +
Sbjct: 484 VWYNLGTLYETCNDQITDALDSYERALSLDPENPVIQGRLNALKIQDKK 532

 Score = 38.1 bits (87), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 50/118 (42%), Gaps = 1/118 (0%)

Query: 372 YFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRD 431
           +  K+LELDP  S  +Y+ G++H   ++F  A     +A   +  N   +     L ++ 
Sbjct: 402 HLVKSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQI 461

Query: 432 DRFDDCETLFSEARRKFPTAPEVP-NFYAEILAAKNSLDAAIKQYDIAIKLEDALPGI 488
            +  D    ++ A R  P   EV  N         + +  A+  Y+ A+ L+   P I
Sbjct: 462 GQNHDALDAYTRAIRLNPYISEVWYNLGTLYETCNDQITDALDSYERALSLDPENPVI 519

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 1/112 (0%)

Query: 372 YFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRD 431
           Y  ++LE+D   S  +YH G++H +  ++  A   F +A   +  N   +     L ++ 
Sbjct: 274 YLLRSLEVDSEDSTTWYHLGRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQI 333

Query: 432 DRFDDCETLFSEARRKFPTAPEVPNFYAEIL-AAKNSLDAAIKQYDIAIKLE 482
            ++ D    ++ A R  P   EV      +     N L  A+  Y  A +LE
Sbjct: 334 YQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLE 385

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 2/75 (2%)

Query: 119 DFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRR 177
           D+  A E +  A++    +P+F+ +    Y  I  +   ++  T A++L P  S+ W   
Sbjct: 301 DYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQIYQYRDALDAYTRAIRLNPYISEVWYDL 360

Query: 178 ASAYENL-GQFSDAM 191
            + YE    Q +DA+
Sbjct: 361 GTLYETCNNQLTDAL 375

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 48/88 (54%), Gaps = 2/88 (2%)

Query: 114 FFKAKDFEKAIEYYTLAISLKEDPVFYSNR-SAAYVSINNFEKVVEDTTAALKLKPDYSK 172
           F+   D++K ++ +  A+++K D     NR  A+  + N  E+ ++    AL+LKP + +
Sbjct: 429 FYSNDDYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 488

Query: 173 CWLRRASAYENLGQFSDAM-FDLSAVSL 199
                A +  N+G F +A  + L+A+S+
Sbjct: 489 ARCNLAVSCMNMGCFKEAAEYLLTALSM 516

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 85/209 (40%), Gaps = 9/209 (4%)

Query: 350 PSTYIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDK 409
           P T+  M   ++ + +     + F+KA ++DPN +  Y  +G  H   ++F  A   + K
Sbjct: 535 PQTWCCMGNFLSLQKDHEDAIKAFEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRK 594

Query: 410 AKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLD 469
           A   +P++  AY        +  ++D+    F +AR   P    +       L      +
Sbjct: 595 ALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALEKLQYQE 654

Query: 470 AAIKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSE 529
            A+  Y++A +L+ +    +   A ++          ++  +  A + FEE  K+ P   
Sbjct: 655 KALSYYELACELQPSSSLANFKRAHLLY---------SMGRYSVALQYFEELTKLAPDEA 705

Query: 530 QAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
                L QL        DA++ F  A +L
Sbjct: 706 TVHFLLGQLYQILGRKKDAVKEFTIAMNL 734

 Score = 31.2 bits (69), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 31/147 (21%), Positives = 50/147 (34%), Gaps = 34/147 (23%)

Query: 370 KEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENI----------- 418
           K  + KAL  DP     YY  G     +  + EA   F+KA+ +NP N+           
Sbjct: 589 KNCYRKALACDPQHYNAYYGLGMSCMKLGQYDEALLHFEKARSINPINVILICCCGVALE 648

Query: 419 --------FAYIQCAC---------------LAFRDDRFDDCETLFSEARRKFPTAPEVP 455
                    +Y + AC               L +   R+      F E  +  P    V 
Sbjct: 649 KLQYQEKALSYYELACELQPSSSLANFKRAHLLYSMGRYSVALQYFEELTKLAPDEATVH 708

Query: 456 NFYAEILAAKNSLDAAIKQYDIAIKLE 482
               ++         A+K++ IA+ L+
Sbjct: 709 FLLGQLYQILGRKKDAVKEFTIAMNLD 735

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 36.2 bits (82), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 43/94 (45%), Gaps = 2/94 (2%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKL 166
           K++GNE +K   +  AI  Y   I+ + ++PV +SN++ A + +    + +E     L+L
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 167 KPDYSKCWLRRASAYE-NLGQFSDAMFDLSAVSL 199
                   LR    Y   L Q + A   +  V +
Sbjct: 68  AASPQHAALRAKLLYRLQLAQAAVAPLRIPVVEV 101

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 3/120 (2%)

Query: 372 YFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRD 431
           Y  K+LE+D   +  +YH G++H +  ++  A   F +A   +  N   +     L ++ 
Sbjct: 299 YLLKSLEVDSQDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 358

Query: 432 DRFDDCETLFSEARRKFPTAPEVPNFYAEIL-AAKNSLDAAIKQYDIAIKLEDALPGIHV 490
            ++ D    ++ A R  P   EV      +     N L+ A+  Y  A +L+     IH+
Sbjct: 359 SQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLDPE--NIHI 416

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 57/123 (46%), Gaps = 20/123 (16%)

Query: 292 FTKAAELYKKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLS--LNPR 349
           F +AAELY++ L+ +PD        +  +  +G      +D   A+ + +++L    NP 
Sbjct: 111 FQRAAELYERALQYNPD-------LSDVWATLGHCYLMLDDLTRAYNSYQQALYHLTNPN 163

Query: 350 -PSTYIYMALIMADKGEANQYKEYFDKALELDPN----------CSAVYYHRGQMHFVVE 398
            P  +  + ++    G  +  +E F K LELDP+             +Y H+G+ +  +E
Sbjct: 164 VPKLWHGIGILYDRYGSLDYAEEAFAKVLELDPHFEKANEIYFRLGIIYKHQGKWNQALE 223

Query: 399 NFK 401
            F+
Sbjct: 224 CFR 226

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G       D+  A + +  A++    +P+F+ +    Y  I+ +   ++  T A++L P 
Sbjct: 318 GRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 377

Query: 170 YSKCWLRRASAYENL-GQFSDAM 191
            S+ W    + YE    Q +DA+
Sbjct: 378 ISEVWYDLGTLYETCNNQLNDAL 400

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 37/77 (48%)

Query: 378 ELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDC 437
           E+DP+ +A +YH G++H +  ++  A   F +A   +  N   +     L ++  ++ D 
Sbjct: 307 EIDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 366

Query: 438 ETLFSEARRKFPTAPEV 454
              ++ A R  P   EV
Sbjct: 367 LDAYTRAIRLNPYISEV 383

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 135 EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENL-GQFSDAM 191
            +P+F+ +    Y  I+ +   ++  T A++L P  S+ W    + YE    Q SDA+
Sbjct: 345 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDAL 402

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 64/151 (42%), Gaps = 28/151 (18%)

Query: 264 NEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAIAFEHV 323
           N++  +    L NLY+ +        + F +AAELY++ L  +P+   +       +  +
Sbjct: 93  NQSSTKALTSLANLYRSR--------DMFQRAAELYERALSVNPELSDV-------WATL 137

Query: 324 GIFKFFKNDPITAHINLEESLSL--NPR-PSTYIYMALIMADKGEANQYKEYFDKALELD 380
           G      +D   A+   +++L    NP  P  +  + ++    G     +E F K LELD
Sbjct: 138 GHCYLMLDDLQRAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLEYAEEAFAKVLELD 197

Query: 381 PN----------CSAVYYHRGQMHFVVENFK 401
           PN             +Y H+G+    +E F+
Sbjct: 198 PNFEKANEIYFRLGIIYKHQGKWTQALECFR 228

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 40/210 (19%), Positives = 86/210 (40%), Gaps = 9/210 (4%)

Query: 349 RPSTYIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFD 408
           +P T+  +  + + + + ++    FDKA +LDPN    Y  +G  +  ++++  A   + 
Sbjct: 589 KPETWCAVGNLFSLQKDHDEAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYR 648

Query: 409 KAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSL 468
           KA   +  +  AY      + +   ++     F +AR   P+   +       +    + 
Sbjct: 649 KAISNDLHHYNAYYGMGMCSMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQ 708

Query: 469 DAAIKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRS 528
           + A+  Y++A +++          A ++          ++  + +A + FEE  KI P  
Sbjct: 709 EKALNYYELACQIQPTSSLAKFKRAHLLY---------SMAKYTQALDAFEELIKIAPEE 759

Query: 529 EQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
              +  L QL        DAI+ +  A +L
Sbjct: 760 ATVQFILGQLYQIMGRKKDAIKRYTIAMNL 789

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 40/83 (48%)

Query: 372 YFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRD 431
           +  K+LE++P+ +  +YH G++H +  ++  A   F +A   +  N   +     L ++ 
Sbjct: 264 FLLKSLEVNPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQI 323

Query: 432 DRFDDCETLFSEARRKFPTAPEV 454
            ++ D    ++ A R  P   EV
Sbjct: 324 SQYRDALDAYTRAIRLNPYISEV 346

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 67/147 (45%), Gaps = 17/147 (11%)

Query: 281 QTGC-YELADEEF---TKAAELYKKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITA 336
           Q GC Y +   +F    KA     K LE +P +       A  + H+G     ++D   A
Sbjct: 243 QLGCLYGMNTVQFYDPQKALNFLLKSLEVNPSD-------ATTWYHLGRVHMIRSDYTAA 295

Query: 337 HINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFD---KALELDPNCSAVYYHRGQM 393
           +   +++++ + R    I+   I     + +QY++  D   +A+ L+P  S V+Y  G +
Sbjct: 296 YDAFQQAVNRDSR--NPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTL 353

Query: 394 HFVVEN-FKEAGADFDKAKELNPENIF 419
           +    N   +A   + +A  L+PEN+ 
Sbjct: 354 YETCNNQLTDALDAYKQAARLDPENVH 380

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 38/83 (45%), Gaps = 2/83 (2%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G       D+  A + +  A++    +P+F+ +    Y  I+ +   ++  T A++L P 
Sbjct: 283 GRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 342

Query: 170 YSKCWLRRASAYENL-GQFSDAM 191
            S+ W    + YE    Q +DA+
Sbjct: 343 ISEVWYDLGTLYETCNNQLTDAL 365

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 66/151 (43%), Gaps = 28/151 (18%)

Query: 264 NEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNESLKKKAAIAFEHV 323
           N+A  +    L +LY+ +        + F KAAELY+K L  +P+   +       +  +
Sbjct: 56  NQASTKALTSLAHLYRSR--------DMFQKAAELYEKALAVNPELSDV-------WATL 100

Query: 324 GIFKFFKNDPITAHINLEESLSL--NPR-PSTYIYMALIMADKGEANQYKEYFDKALELD 380
           G      +D   A+   +++L    NP  P  +  + ++    G  +  +E F K LELD
Sbjct: 101 GHCYLMLDDLQKAYNAYQQALYHLSNPNVPKLWHGIGILYDRYGSLDYAEEAFAKVLELD 160

Query: 381 PN----------CSAVYYHRGQMHFVVENFK 401
           P+             +Y H+G+ +  +E F+
Sbjct: 161 PHFEKANEIYFRLGIIYKHQGKWNQALECFR 191

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 36.6 bits (83), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 82  DANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFY 140
           D N Q +L   +    +++       KD GNE FK  +++ AIE Y   ISL+  + V Y
Sbjct: 13  DVNRQRNLKHWNNGLQDKLTMSFQHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGY 72

Query: 141 SNRSAAYV 148
           SN + AY+
Sbjct: 73  SNLAMAYL 80

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 59/126 (46%), Gaps = 4/126 (3%)

Query: 342 ESLSLNPRPSTYIYMALIMA--DKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVEN 399
           E++ +  R + + Y  + +A  ++ + ++  E+F  AL +DPN    +   GQ +F    
Sbjct: 675 EAIKMELRSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGR 734

Query: 400 FKEAGADFDKAKELNPENIFA-YIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFY 458
            + +   F+KA E++P +++A Y     LA     F++C  +     +  P        Y
Sbjct: 735 VEASTKVFEKAIEIDPLHLYAQYFNSLSLA-EMGCFEECIEILKNITQLNPEELAFQVSY 793

Query: 459 AEILAA 464
           + IL +
Sbjct: 794 SSILVS 799

>YBR055C Chr2 complement(344602..347301) [2700 bp, 899 aa] {ON}
           PRP6Splicing factor, component of the U4/U6-U5 snRNP
           complex
          Length = 899

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 44/99 (44%), Gaps = 1/99 (1%)

Query: 353 YIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFV-VENFKEAGADFDKAK 411
           ++ +  I    G     +E +     L PNC  ++    ++  + ++N   A +  D+  
Sbjct: 671 FLQLGQIYHSMGNIEMSRETYLSGTRLVPNCPLLWVSLSKIDEIDLKNPVRARSILDRGL 730

Query: 412 ELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPT 450
             NP+++  YI    +  R    D  E L ++A +KFP+
Sbjct: 731 LKNPDDVLFYIAKIQMEIRLGNLDQAELLVTQALQKFPS 769

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 38.1 bits (87), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 114 FFKAKDFEKAIEYYTLAISLKEDPVFYSNR-SAAYVSINNFEKVVEDTTAALKLKPDYSK 172
           F+  +D++K I+ +  A+++K D     NR  A+  + N  E+ ++    AL+LKP + +
Sbjct: 432 FYANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 491

Query: 173 CWLRRASAYENLGQFSDAM-FDLSAVSL 199
                A +  N+G + +A  + L+A+S+
Sbjct: 492 ARYNLAVSSMNIGCYKEAAEYLLTALSM 519

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 37.7 bits (86), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 69/148 (46%), Gaps = 19/148 (12%)

Query: 281 QTGC-YELADEEF---TKAAELYKKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITA 336
           Q GC Y + +  F    KA  L  K LE       +    A ++ H+G     +ND  +A
Sbjct: 325 QLGCLYGMNNVSFYDPQKALNLLLKSLE-------IDSTDATSWYHLGRIHMIRNDYTSA 377

Query: 337 HINLEESLSLNPR-PSTYIYMALIMADKGEANQYKEYFD---KALELDPNCSAVYYHRGQ 392
           +   +++++ + R P+ +  + ++     +  QY++  D   +A+ L+P  S V+Y  G 
Sbjct: 378 YDAFQQAVNRDSRNPTFWCSIGVLYY---QIAQYRDALDAYTRAIRLNPYISEVWYDLGT 434

Query: 393 MHFVVEN-FKEAGADFDKAKELNPENIF 419
           ++    N   +A   + +A  L+P N+ 
Sbjct: 435 LYETCNNQVNDALDAYKQAARLDPNNVH 462

 Score = 35.4 bits (80), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 37/80 (46%)

Query: 375 KALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRF 434
           K+LE+D   +  +YH G++H +  ++  A   F +A   +  N   +     L ++  ++
Sbjct: 349 KSLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQY 408

Query: 435 DDCETLFSEARRKFPTAPEV 454
            D    ++ A R  P   EV
Sbjct: 409 RDALDAYTRAIRLNPYISEV 428

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 35.4 bits (80), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNF 153
            K KGN  +K  +F  A+ +Y  AI+    +PV YSN + A + +NN+
Sbjct: 7   FKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNY 54

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 37.7 bits (86), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 53/261 (20%), Positives = 109/261 (41%), Gaps = 17/261 (6%)

Query: 230 ENQGKESPLPSNTS--LASFFGIFNPETSFDDYDGENEADVELKKGL-ENLYKCQTGC-- 284
           +N  ++ PL  +    + SF  I    + +D Y      + ++ + + EN+  CQ     
Sbjct: 409 QNSQQQQPLSISLVEIMYSFAKIMKTSSLYDSYKAIRLLNNDIPQHIRENMPWCQAQLGK 468

Query: 285 --YELADEEFTKAAELYKKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEE 342
             YEL + E +    L  K L+ S   +          E      +  ND     I   E
Sbjct: 469 LHYELVNYEVSLQYFLNLKTLQPSRVKD---------LEIYSTLLWHLNDKSKLSILSSE 519

Query: 343 SLSLNPR-PSTYIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFK 401
            ++ NPR P T+  +   ++ +   ++  + F+KA ++DP  +  Y  +G  +   ++F 
Sbjct: 520 LITSNPRIPETWCCLGNFLSLQKNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFD 579

Query: 402 EAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEI 461
            A   + KA   +P +  AY     ++ +  ++++    F +AR   P    +       
Sbjct: 580 VAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVA 639

Query: 462 LAAKNSLDAAIKQYDIAIKLE 482
           L   +  + A++ Y++A +L+
Sbjct: 640 LEKLSYQEKALQYYELACELQ 660

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 52/147 (35%), Gaps = 34/147 (23%)

Query: 370 KEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENI----------- 418
           K  + KA+  DP     YY  G +   +  ++EA   F+KA+ +NP N+           
Sbjct: 582 KRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSINPINVVLVCCGGVALE 641

Query: 419 --------FAYIQCAC---------------LAFRDDRFDDCETLFSEARRKFPTAPEVP 455
                     Y + AC               L +   R+      F E +   P    V 
Sbjct: 642 KLSYQEKALQYYELACELQPSSSLATFKRAHLLYSMGRYTLALKFFEELKHVAPDEATVH 701

Query: 456 NFYAEILAAKNSLDAAIKQYDIAIKLE 482
               +I +       AIK+Y IA+ L+
Sbjct: 702 FLLGQIYSILGRKKDAIKEYTIALNLD 728

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 37/181 (20%), Positives = 71/181 (39%), Gaps = 16/181 (8%)

Query: 381 PNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETL 440
           P C A     G++H+ + N++ +   F   K L P  +      + L +  +       L
Sbjct: 460 PWCQA---QLGKLHYELVNYEVSLQYFLNLKTLQPSRVKDLEIYSTLLWHLNDKSKLSIL 516

Query: 441 FSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGKAT 500
            SE     P  PE        L+ + +   AIK ++ A +++           P    A 
Sbjct: 517 SSELITSNPRIPETWCCLGNFLSLQKNHHEAIKAFEKATQVD-----------PKFAYAY 565

Query: 501 ALIRN--PTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
            L  +   + ++F  A   + +A   DP    A  GL  + ++  + ++A+  FE A  +
Sbjct: 566 TLQGHEYTSSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQYEEALLFFEKARSI 625

Query: 559 S 559
           +
Sbjct: 626 N 626

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 29/60 (48%), Gaps = 1/60 (1%)

Query: 370 KEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAF 429
           K YF KA+  D      YY  G     +  F+ A   F+KA+ +NP N+   I C  +AF
Sbjct: 619 KNYFRKAVSTDSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINPSNVIL-ICCCGVAF 677

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 41/172 (23%), Positives = 69/172 (40%), Gaps = 15/172 (8%)

Query: 391 GQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPT 450
           G +  + ++ KEA   F+K  +L+P   + Y   A     DD FD  +  F   R+   T
Sbjct: 572 GNLFSLQKDHKEAIKAFEKVTKLDPTFTYGYTLQAHEYLSDDSFDLAKNYF---RKAVST 628

Query: 451 APEVPNFYAEILAAKNSL---DAAIKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPT 507
             +  N Y  I      L   + A+  ++ A  +  +    +V +    G A   +  P 
Sbjct: 629 DSQHYNAYYGIGMCSMKLGEFEHALLYFEKARSINPS----NVILICCCGVAFEKLSYPE 684

Query: 508 VENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADLS 559
                +A   +E AC++ P S  AK   A L         A++ FE+   L+
Sbjct: 685 -----KALSYYELACQVQPSSSLAKFKRAHLLYSMANYPLALECFEELTKLA 731

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 43/212 (20%), Positives = 82/212 (38%), Gaps = 19/212 (8%)

Query: 357 ALIMADKGEANQYK--EYFDKALELD-----PNCSAVYYHRGQMHFVVENFKEAGADFDK 409
           ALI+    + N YK     +  L        P C +     G +HF + N++ +   F+K
Sbjct: 466 ALILKTSSQYNSYKAIRLINSLLPTHIRDEMPWCQS---QLGMLHFEIVNYEMSLKYFEK 522

Query: 410 AKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLD 469
            ++L P  +      + L +          L +E  ++F   P+       + + +    
Sbjct: 523 LRKLQPTRLKDLETYSTLLWHLHDKIKLTVLSNELLKEFKNEPQTWCCLGNLFSLQKDHK 582

Query: 470 AAIKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSE 529
            AIK ++   KL+   P    G      +A   + +   ++F  A   F +A   D +  
Sbjct: 583 EAIKAFEKVTKLD---PTFTYGYT---LQAHEYLSD---DSFDLAKNYFRKAVSTDSQHY 633

Query: 530 QAKIGLAQLKLQQEEIDDAIQLFEDAADLSRS 561
            A  G+    ++  E + A+  FE A  ++ S
Sbjct: 634 NAYYGIGMCSMKLGEFEHALLYFEKARSINPS 665

>TPHA0E01110 Chr5 (228116..230197) [2082 bp, 693 aa] {ON} Anc_5.352
           YDR320C
          Length = 693

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 48/100 (48%), Gaps = 17/100 (17%)

Query: 80  PVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAIS--LKEDP 137
           PV +  Q +LS  +EF            KD+G E+FK  D+  A E Y  +++   K  P
Sbjct: 385 PVISINQIELSGYNEF------------KDRGTEYFKKGDYVSATEQYEKSLNSLSKLHP 432

Query: 138 ---VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCW 174
              +  SN  A+ +   ++  ++  +T+AL L P  SK W
Sbjct: 433 LRIIASSNLLASLLKTGDYTSMITISTSALDLFPKESKLW 472

>Kwal_27.10740 s27 complement(476617..478503) [1887 bp, 628 aa] {ON}
           YBL084C (CDC27) - component of the anaphase-promoting
           complex [contig 33] FULL
          Length = 628

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 43/209 (20%), Positives = 86/209 (41%), Gaps = 9/209 (4%)

Query: 350 PSTYIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDK 409
           P T+  +  + + K +  +  + F ++ +LDP+ +  Y  +G  +   + F  A   + K
Sbjct: 410 PETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRK 469

Query: 410 AKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLD 469
           A   N ++  AY      + +  ++++C   F +AR   P    +       L   +  +
Sbjct: 470 ALASNSQHYNAYYGLGMCSLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQE 529

Query: 470 AAIKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSE 529
            A++ YD+A +L+       +    +  +A  L+    +  +  A E FE+  KI P   
Sbjct: 530 RALQNYDLACELQP------MSSLALFKRAQLLL---AMGKYNYALESFEKLVKIAPDEA 580

Query: 530 QAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
                L QL        DA++    A +L
Sbjct: 581 TIHFLLGQLYQIVGRKQDAVKELTIAMNL 609

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 51/113 (45%), Gaps = 3/113 (2%)

Query: 315 KAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPR-PSTYIYMALIMADKGEANQYKEYF 373
           K+AI +  +G       D   A   L+++ +L+PR    Y       ++    +  K  +
Sbjct: 455 KSAITWCCLGNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCY 514

Query: 374 DKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCAC 426
            KAL ++PN    +Y  G     +  + EA   F+KA+ +NP N+   + C C
Sbjct: 515 RKALAINPNHYNAHYGLGMSCIKLGQYDEALLHFEKARSINPVNVI--LNCCC 565

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 26/128 (20%), Positives = 58/128 (45%), Gaps = 8/128 (6%)

Query: 289 DEEFTKAAELYKKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNP 348
           ++ F  A   Y+K L  +P++ +      ++   +G +         A ++ E++ S+NP
Sbjct: 504 NDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYD-------EALLHFEKARSINP 556

Query: 349 RPSTYIYMALIMADK-GEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADF 407
                     +  ++ G   +  +++  A EL PN S   + + Q+ F +  +  A  +F
Sbjct: 557 VNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNF 616

Query: 408 DKAKELNP 415
           +K ++L P
Sbjct: 617 EKLEQLTP 624

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 34/60 (56%)

Query: 359 IMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENI 418
           ++ + G+ +   + F+K  +L PN + +++  GQ++ +V   K+A   F  A  L+P+ I
Sbjct: 602 LLFNLGQYSNALQNFEKLEQLTPNEAPIHFLLGQLYQIVGRKKDAITQFTIAMNLDPKGI 661

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 87/210 (41%), Gaps = 9/210 (4%)

Query: 349 RPSTYIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFD 408
           +P T+  +  + + + + ++   YF+KA E+DP+ +  Y  +G  H   ++   A   + 
Sbjct: 508 KPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDSIDMAKTCYR 567

Query: 409 KAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSL 468
           KA   +P++  AY        +  ++++    F +AR   P    +       L   +  
Sbjct: 568 KAIASDPQHYNAYYGLGMCCMKLGQYEEALLYFEKARSINPVNVILICCCGVALEKMSYQ 627

Query: 469 DAAIKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRS 528
           + A++ Y++A +L+ +             KA  L     +  +  A E FEE  ++ P  
Sbjct: 628 EKALQYYELASELQPS------SSLAKFKKAHLLY---VMARYSVALENFEELAELAPDE 678

Query: 529 EQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
                 L QL        DA++ F  A +L
Sbjct: 679 ATVHFLLGQLYQIMGRKKDAVKEFTIAMNL 708

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 48/88 (54%), Gaps = 2/88 (2%)

Query: 114 FFKAKDFEKAIEYYTLAISLKEDPVFYSNR-SAAYVSINNFEKVVEDTTAALKLKPDYSK 172
           F+   D++K ++ +  A++++ D     NR  A+  + N  E+ ++    AL+LKP + +
Sbjct: 436 FYSNDDYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVR 495

Query: 173 CWLRRASAYENLGQFSDAM-FDLSAVSL 199
                A +  N+G + +A  + L+A+S+
Sbjct: 496 ARCNLAVSCMNMGCYKEAAEYLLTALSM 523

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 5/73 (6%)

Query: 107 LKDKGNEFFKAKDFEKAIEYY-----TLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTT 161
            K +G ++FK  D+  A+E Y     TL +      + YSN  A+ + I    + V D  
Sbjct: 365 FKARGTDYFKNGDYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQ 424

Query: 162 AALKLKPDYSKCW 174
            A+KL P+    W
Sbjct: 425 EAMKLLPEEKSLW 437

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 3/88 (3%)

Query: 340 LEESLSLNPR-PSTYIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVE 398
           L+++ SLNP+    Y       ++    +  K  + KAL ++PN    +Y  G     + 
Sbjct: 461 LKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLG 520

Query: 399 NFKEAGADFDKAKELNPENIFAYIQCAC 426
            + EA   F+KA+ +NP N+   + C C
Sbjct: 521 QYDEALLHFEKARSINPVNVI--LNCCC 546

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/128 (20%), Positives = 58/128 (45%), Gaps = 8/128 (6%)

Query: 289 DEEFTKAAELYKKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNP 348
           ++ F  A   Y+K L  +P++ +      ++   +G +         A ++ E++ S+NP
Sbjct: 485 NDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQYD-------EALLHFEKARSINP 537

Query: 349 RPSTYIYMALIMADK-GEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADF 407
                     +  ++ G   +  +++  A EL PN S   + + Q+ F +  +  A  +F
Sbjct: 538 VNVILNCCCGVALERLGRREKALDFYQLACELQPNSSLALFKKSQLLFNLGQYSNALQNF 597

Query: 408 DKAKELNP 415
           +K ++L P
Sbjct: 598 EKLEQLTP 605

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 33/60 (55%)

Query: 359 IMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENI 418
           ++ + G+ +   + F+K  +L PN + V++  GQ++ +V   K+A   F  A  L+P  I
Sbjct: 583 LLFNLGQYSNALQNFEKLEQLTPNEAPVHFLLGQLYQIVGRKKDAITQFTIAMNLDPNGI 642

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 37/80 (46%), Gaps = 1/80 (1%)

Query: 362 DKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFA- 420
           +K E +   E+F  AL +DPN    +   GQ +      + +   FDKA EL P + +A 
Sbjct: 707 EKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIELQPSHTYAR 766

Query: 421 YIQCACLAFRDDRFDDCETL 440
           Y +   L    +  +  ETL
Sbjct: 767 YFRALSLCDMGEYLESLETL 786

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 3/76 (3%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLKE--DPVFYSNRSAAYVSINNFEKVVEDTTAALK 165
           K +GN  FK  D+  A ++Y L I ++E  +P+ YSN++ + +   +F++ +      L 
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCI-MEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGLL 65

Query: 166 LKPDYSKCWLRRASAY 181
              D     ++R   Y
Sbjct: 66  YSSDPEHEAIKRKLQY 81

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 45/104 (43%), Gaps = 26/104 (25%)

Query: 110 KGNEFFKAKDFEKAIEYY-----TLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTTAAL 164
           +G+ FFK  D+  A+E Y     TL  S     + YSN +AA + I  +  +V+    AL
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422

Query: 165 KLKPD---------------------YSKCWLRRASAYENLGQF 187
           KL P                      +SK  LR+A A E+L  F
Sbjct: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENF 466

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 88/212 (41%), Gaps = 13/212 (6%)

Query: 349 RPSTYIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFD 408
           +P T+  +  +++ + + +   + F+KA +LDPN +  Y  +G  H   ++   A   + 
Sbjct: 539 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 598

Query: 409 KAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSL 468
           KA   +P++  AY      A +  ++++    F +AR   P    +       L      
Sbjct: 599 KALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYK 658

Query: 469 DAAIKQYDIAIKLE--DALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDP 526
           + A++ Y++A  L+   +L    +G          L+ + T  N   A + FEE  K+ P
Sbjct: 659 EKALQYYELACHLQPTSSLSKYKMG---------QLLYSMTRYNV--ALQTFEELVKLVP 707

Query: 527 RSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
               A   L Q         DAI+    A +L
Sbjct: 708 DDATAHYLLGQTYRIVGRKKDAIKELTVAMNL 739

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 68/172 (39%), Gaps = 15/172 (8%)

Query: 391 GQMHFVVENFKEAGADFDKAKELNPENIFAY-IQCACLAFRDDRFDDCETLFSEARRKFP 449
           G++HF + N+  +   F++ K+L P  +    I    L    D+      L +      P
Sbjct: 479 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKS-SNLANGLMDTMP 537

Query: 450 TAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVE 509
             PE       +L+ +   DAAIK ++ A +L+           P    A  L  +    
Sbjct: 538 NKPETWCCIGNLLSLQKDHDAAIKAFEKATQLD-----------PNFAYAYTLQGHEHSS 586

Query: 510 NFV--EASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADLS 559
           N     A   + +A   DP+   A  GL    ++  + ++A+  FE A  ++
Sbjct: 587 NDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLGQYEEALLYFEKARSIN 638

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 41/92 (44%), Gaps = 5/92 (5%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFA-YIQCACLAF 429
           E+F  AL +DPN    +   GQ +F     + +   F+KA EL+P++ +A Y     LA 
Sbjct: 705 EWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELSPDHNYAKYFNSVALA- 763

Query: 430 RDDRFDDCETLFSEARRKFPTAPEVPNFYAEI 461
              + D+ E      R      PE   F  E+
Sbjct: 764 ---QMDEFERAIDILRHVLKDEPEKEVFKMEL 792

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 30/51 (58%)

Query: 509 ENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADLS 559
           +N  ++ E F+ A ++DP   ++ +GL Q       ++ +I++FE A +LS
Sbjct: 698 QNETDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELS 748

>KLTH0C06204g Chr3 complement(538533..540416) [1884 bp, 627 aa] {ON}
           some similarities with uniprot|P38042 Saccharomyces
           cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 627

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/133 (20%), Positives = 60/133 (45%)

Query: 350 PSTYIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDK 409
           P T+  +  + + K +  +  + F ++ +LDP+ +  Y  +G  +   + F  A   + K
Sbjct: 409 PETWCCIGNLFSLKKDHEESIKAFQRSTQLDPSFTYAYTLQGHEYSSNDAFDTAMTCYRK 468

Query: 410 AKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLD 469
           A   NP++  A+        +  ++++C   F +AR   P    +       L   +  +
Sbjct: 469 ALGSNPQHYNAHYGLGMCCLKLGQYEECLLHFEKARSINPVNVILICCCGVALEKLSHQE 528

Query: 470 AAIKQYDIAIKLE 482
            A++ YD+A +L+
Sbjct: 529 KALQYYDLACELQ 541

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 56/130 (43%), Gaps = 8/130 (6%)

Query: 288 ADEEFTKAAELYKKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLN 347
           +++ F  A   Y+K L S+P + +      +    +G ++          ++ E++ S+N
Sbjct: 455 SNDAFDTAMTCYRKALGSNPQHYNAHYGLGMCCLKLGQYE-------ECLLHFEKARSIN 507

Query: 348 PRPSTYIYMALIMADK-GEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGAD 406
           P     I    +  +K     +  +Y+D A EL P  S   + R Q+   +  +  A  +
Sbjct: 508 PVNVILICCCGVALEKLSHQEKALQYYDLACELQPVSSLALFKRAQLLLAMGKYNFALEN 567

Query: 407 FDKAKELNPE 416
           F+K   + P+
Sbjct: 568 FEKLVTIAPD 577

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 77/175 (44%), Gaps = 21/175 (12%)

Query: 256 SFDDYDGENEA--DVELKKGLENLYKCQTGC-YELADEEF---TKAAELYKKELESSPDN 309
           S  ++ G  EA   V L+         Q GC Y + + +F     A  L  K LE     
Sbjct: 248 SMGEWQGAREAYEHVLLQNERHAKVLQQLGCLYGMNNVQFYDPQTALNLLLKSLE----- 302

Query: 310 ESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPR-PSTYIYMALIMADKGEANQ 368
             +    A  + H+G     +ND   A+   +++++ + R P+ +  + ++     + +Q
Sbjct: 303 --VDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYY---QISQ 357

Query: 369 YKEYFD---KALELDPNCSAVYYHRGQMHFVVEN-FKEAGADFDKAKELNPENIF 419
           Y++  D   +A+ L+P  S V+Y  G ++    N   +A   + +A  L+P N+ 
Sbjct: 358 YRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPNNVH 412

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 37/80 (46%)

Query: 375 KALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRF 434
           K+LE+D   +  +YH G++H V  ++  A   F +A   +  N   +     L ++  ++
Sbjct: 299 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQY 358

Query: 435 DDCETLFSEARRKFPTAPEV 454
            D    ++ A R  P   EV
Sbjct: 359 RDALDAYTRAIRLNPYISEV 378

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 37/83 (44%), Gaps = 2/83 (2%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G       D+  A + +  A++    +P F+ +    Y  I+ +   ++  T A++L P 
Sbjct: 315 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 374

Query: 170 YSKCWLRRASAYENL-GQFSDAM 191
            S+ W    + YE    Q +DA+
Sbjct: 375 ISEVWYDLGTLYETCNNQLTDAL 397

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 5/71 (7%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISL--KEDP---VFYSNRSAAYVSINNFEKVVEDTTAALK 165
           G EFFK  D++ A+  Y  +++   ++ P   + YSN  AA + +  + + V+D   AL+
Sbjct: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612

Query: 166 LKPDYSKCWLR 176
           L P   K W +
Sbjct: 613 LFPKNDKQWTQ 623

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 114 FFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSK 172
           F+   DF+K I+ +  A+ +   D + ++   A+  + N  E+ ++    AL+LKP + +
Sbjct: 467 FYTKDDFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 526

Query: 173 CWLRRASAYENLGQFSDAM-FDLSAVSL 199
                A +  N+G F +A  + LS +S+
Sbjct: 527 ARYNLAVSSMNIGCFKEAAGYLLSVLSM 554

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 114 FFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSK 172
           F+   DF+K I+ +  A+ +   D + ++   A+  + N  E+ ++    AL+LKP + +
Sbjct: 468 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 527

Query: 173 CWLRRASAYENLGQFSDAM-FDLSAVSL 199
                A +  N+G F +A  + LS +S+
Sbjct: 528 ARYNLAVSSMNIGCFKEAAGYLLSVLSM 555

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALK- 165
           K+ GN  FK   + +A++ Y   I+ + ++PV YSN++ A + +  +   ++     L+ 
Sbjct: 12  KELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRY 71

Query: 166 -LKPDYS 171
            L P+++
Sbjct: 72  ALGPEHA 78

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 48/88 (54%), Gaps = 2/88 (2%)

Query: 114 FFKAKDFEKAIEYYTLAISLKEDPVFYSNR-SAAYVSINNFEKVVEDTTAALKLKPDYSK 172
           F+  +DF+K I+ +  A++++ D     NR  A+  + N  E+ ++    A++LKP + +
Sbjct: 427 FYANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVR 486

Query: 173 CWLRRASAYENLGQFSDAM-FDLSAVSL 199
                A +  N+G + +A    L+A+S+
Sbjct: 487 ARYNLAVSSMNIGCYREAAEHLLTALSM 514

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 47/223 (21%), Positives = 91/223 (40%), Gaps = 9/223 (4%)

Query: 336 AHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHF 395
           +H++ E   +L  +P T+  +  + + + +     +YF+KA ++D N +  Y  +G  H 
Sbjct: 468 SHLSNELVETLPNKPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHS 527

Query: 396 VVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVP 455
             ++   A   + +A   +P++  AY        +  ++D     F +AR   P    + 
Sbjct: 528 SNDSIDTAKNCYRRALACDPQHYNAYYGLGMCYMKLGQYDKALLFFEKARNINPVNVILI 587

Query: 456 NFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVENFVEAS 515
                 L   +  + A++ Y+ A +L+ +             KA  L    ++  +  A 
Sbjct: 588 CCCGVALEKLSYQEKALQYYEQACELQPS------SSLAKFKKAHLLY---SMARYSAAL 638

Query: 516 ELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
           E FEE  K+ P        L QL        DA++ F  A +L
Sbjct: 639 ENFEELAKLAPDEATVHFLLGQLYQIMGRKKDAVKEFTVAMNL 681

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLKE--DPVFYSNRSAAYVSINNFEKVVEDTTAAL 164
           L+ KGN+ +   ++E A+ YY  A SL E  +PV  +N S A + +  +E  +     AL
Sbjct: 11  LRSKGNDLYSKGEYETAVLYYKNA-SLAEPSNPVHLANMSMALLKLERWEDALSACDRAL 69

Query: 165 KL 166
           ++
Sbjct: 70  EI 71

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 35.8 bits (81), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 47/109 (43%), Gaps = 1/109 (0%)

Query: 375 KALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRF 434
           K+LE D   +  +YH G++H V  ++  A   F +A   +  N   +     L ++  ++
Sbjct: 303 KSLEADSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQY 362

Query: 435 DDCETLFSEARRKFPTAPEVPNFYAEIL-AAKNSLDAAIKQYDIAIKLE 482
            D    ++ A R  P   EV      +     N L  A+  Y  A++L+
Sbjct: 363 RDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAVRLD 411

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 24/108 (22%), Positives = 54/108 (50%), Gaps = 8/108 (7%)

Query: 317 AIAFEHVGIFKFFKNDPITAHINLEESLSLNPR-PSTYIYMALIMADKGEANQYKEYFD- 374
           A  + H+G     +ND   A+   +++++ + R P+ +  + ++     + +QY++  D 
Sbjct: 312 ATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYY---QISQYRDALDA 368

Query: 375 --KALELDPNCSAVYYHRGQMHFVVEN-FKEAGADFDKAKELNPENIF 419
             +A+ L+P  S V+Y  G ++    N   +A   + +A  L+P N+ 
Sbjct: 369 YTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAVRLDPNNVH 416

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 36/75 (48%), Gaps = 2/75 (2%)

Query: 119 DFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRR 177
           D+  A + +  A++    +P F+ +    Y  I+ +   ++  T A++L P  S+ W   
Sbjct: 327 DYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDL 386

Query: 178 ASAYENL-GQFSDAM 191
            + YE    Q SDA+
Sbjct: 387 GTLYETCNNQLSDAL 401

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score = 35.4 bits (80), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 26/111 (23%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAI-SLKEDP----VFYSNRSAAYVSINNFEKVVEDTT 161
            K KG+ FFK  D+  +++ Y  ++ SL  +     +  SN  A+ + +  + K +E+++
Sbjct: 377 FKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENSS 436

Query: 162 AALKLKPDYSKCW---------------------LRRASAYENLGQFSDAM 191
            AL L P     W                     +RRA ++E+L  FS+A+
Sbjct: 437 MALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNAL 487

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 36/80 (45%)

Query: 375 KALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRF 434
           K+LE+D   +  +YH G++H V  ++  A   F  A   +  N   +     L ++  ++
Sbjct: 303 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQY 362

Query: 435 DDCETLFSEARRKFPTAPEV 454
            D    ++ A R  P   EV
Sbjct: 363 RDALDAYTRAIRLNPYISEV 382

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 36/75 (48%), Gaps = 2/75 (2%)

Query: 119 DFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRR 177
           D+  A + +  A++    +P F+ +    Y  I+ +   ++  T A++L P  S+ W   
Sbjct: 327 DYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDL 386

Query: 178 ASAYENL-GQFSDAM 191
            + YE    Q +DA+
Sbjct: 387 GTLYETCNNQLTDAL 401

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 37/80 (46%)

Query: 375 KALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRF 434
           K+LE+D   +  +YH G++H V  ++  A   F +A   +  N   +     L ++  ++
Sbjct: 369 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQY 428

Query: 435 DDCETLFSEARRKFPTAPEV 454
            D    ++ A R  P   EV
Sbjct: 429 RDALDAYTRAIRLNPYISEV 448

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 68/148 (45%), Gaps = 19/148 (12%)

Query: 281 QTGC-YELADEEF---TKAAELYKKELESSPDNESLKKKAAIAFEHVGIFKFFKNDPITA 336
           Q GC Y + + +F     A  L  K LE       +    A  + H+G     +ND   A
Sbjct: 345 QLGCLYGMNNVQFYDPQTALNLLLKSLE-------VDSTDATTWYHLGRIHMVRNDYTAA 397

Query: 337 HINLEESLSLNPR-PSTYIYMALIMADKGEANQYKEYFD---KALELDPNCSAVYYHRGQ 392
           +   +++++ + R P+ +  + ++     + +QY++  D   +A+ L+P  S V+Y  G 
Sbjct: 398 YDAFQQAVNRDSRNPTFWCSIGVLYY---QISQYRDALDAYTRAIRLNPYISEVWYDLGT 454

Query: 393 MHFVVEN-FKEAGADFDKAKELNPENIF 419
           ++    N   +A   + +A  L+P N+ 
Sbjct: 455 LYETCNNQLNDALDAYKQAARLDPNNVH 482

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 37/83 (44%), Gaps = 2/83 (2%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G       D+  A + +  A++    +P F+ +    Y  I+ +   ++  T A++L P 
Sbjct: 385 GRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 444

Query: 170 YSKCWLRRASAYENL-GQFSDAM 191
            S+ W    + YE    Q +DA+
Sbjct: 445 ISEVWYDLGTLYETCNNQLNDAL 467

>SAKL0H02244g Chr8 (216327..218213) [1887 bp, 628 aa] {ON} similar
           to uniprot|P16522 Saccharomyces cerevisiae YHR166C CDC23
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 628

 Score = 35.4 bits (80), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%)

Query: 349 RPSTYIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFD 408
           RP T   +A   + K E  +   YF +AL L+ NC++ +   G     ++N   A   + 
Sbjct: 397 RPETCCIVANYYSAKQEHEKSIMYFRRALTLNKNCTSAWTLMGHEFVELKNSHAAIESYR 456

Query: 409 KAKELNPENIFAY 421
           +A ++NP +  A+
Sbjct: 457 RAVDINPRDFKAW 469

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 86/210 (40%), Gaps = 9/210 (4%)

Query: 349 RPSTYIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFD 408
           +P T+  +  +++ + + +   + F+KA +LDPN +  Y  +G  H   ++   A   + 
Sbjct: 532 KPETWCCVGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 591

Query: 409 KAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSL 468
           KA   +P++  AY      + +  ++++    F +AR   P    +       L      
Sbjct: 592 KALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYK 651

Query: 469 DAAIKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRS 528
           + A++ Y++A  L+   P   +    M     ++ R      +  A + FEE  K+ P  
Sbjct: 652 EKALQYYELACHLQ---PTSSLSKYKMGQLLYSMTR------YSVALQTFEELVKLVPDD 702

Query: 529 EQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
             A   L Q         DAI+    A +L
Sbjct: 703 ATAHYLLGQTYRIVGRKKDAIKELTVAMNL 732

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 68/172 (39%), Gaps = 15/172 (8%)

Query: 391 GQMHFVVENFKEAGADFDKAKELNPENIFAY-IQCACLAFRDDRFDDCETLFSEARRKFP 449
           G++HF + N+  +   F++ K+L P  +    I    L    D+      L +      P
Sbjct: 472 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIFSTLLWHLHDKVKS-SNLANGLMDTMP 530

Query: 450 TAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVE 509
             PE       +L+ +   DAAIK ++ A +L+           P    A  L  +    
Sbjct: 531 NKPETWCCVGNLLSLQKDHDAAIKAFEKATQLD-----------PNFAYAYTLQGHEHSS 579

Query: 510 NFV--EASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADLS 559
           N     A   + +A   DP+   A  GL    ++  + ++A+  FE A  ++
Sbjct: 580 NDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSIN 631

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 381 PNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETL 440
           P  S  ++  G  +F + N  EA   F KA  L+P   +A++  A     +   +   + 
Sbjct: 419 PKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 478

Query: 441 FSEARRKFPTAPEVPNFY 458
           +S A R FP    +P+ Y
Sbjct: 479 YSTAARFFP-GTHLPHLY 495

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 74/186 (39%), Gaps = 9/186 (4%)

Query: 373 FDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDD 432
           F+KA ELDP  +  Y  +G  +   E+F  A   + KA   + ++  AY        ++ 
Sbjct: 517 FNKATELDPRFAYAYTLQGHEYASNESFDTARTFYRKALACDSQHYNAYYGLGTCDSQNG 576

Query: 433 RFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGI 492
             D     F +AR   P    +       L    + + A+K YD A KL+   P      
Sbjct: 577 NHDRSLLFFEKARMINPVNIVLICCCGVELEKVRNYELALKYYDFASKLQ---PN---SA 630

Query: 493 APMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLF 552
                KA  L    ++  +  A ELFE+  K+D  +      L ++        DA++ +
Sbjct: 631 LAKYRKAELLF---SLGRYSLAVELFEDLIKLDSENPNLHYMLGKIYQTMGRKKDAVKEY 687

Query: 553 EDAADL 558
             A +L
Sbjct: 688 TVAMNL 693

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/164 (22%), Positives = 65/164 (39%), Gaps = 9/164 (5%)

Query: 370 KEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAF 429
           + ++ KAL  D      YY  G       N   +   F+KA+ +NP NI     C     
Sbjct: 548 RTFYRKALACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEKARMINPVNIVLICCCGVELE 607

Query: 430 RDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIH 489
           +   ++     +  A +  P +       AE+L +      A++ ++  IKL+   P +H
Sbjct: 608 KVRNYELALKYYDFASKLQPNSALAKYRKAELLFSLGRYSLAVELFEDLIKLDSENPNLH 667

Query: 490 VGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKI 533
                M+GK        T+    +A + +  A  +DP+  Q  I
Sbjct: 668 Y----MLGKIYQ-----TMGRKKDAVKEYTVAMNLDPKGNQYII 702

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 68/177 (38%), Gaps = 16/177 (9%)

Query: 381 PNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETL 440
           P C A     G++H+ ++N+K A + F++ + + P  +      + L +          L
Sbjct: 426 PWCQA---QLGKLHYEIQNYKMALSHFERLRIIQPTRLNDLEIFSTLLWHLHDKVKLSNL 482

Query: 441 FSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGKAT 500
            +E    FP A +         + +   D AIK ++ A +L+           P    A 
Sbjct: 483 ANELIDNFPEAAQTWCVLGNHFSLQKDHDEAIKAFNKATELD-----------PRFAYAY 531

Query: 501 ALIRN--PTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDA 555
            L  +   + E+F  A   + +A   D +   A  GL     Q    D ++  FE A
Sbjct: 532 TLQGHEYASNESFDTARTFYRKALACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEKA 588

>KNAG0A04120 Chr1 complement(556919..558727) [1809 bp, 602 aa] {ON}
           Anc_8.470 YDR244W
          Length = 602

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 114 FFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSK 172
           F+   DF K I+ +  A+ +   D + ++   AA  + N  E+ ++    AL+LKP + +
Sbjct: 456 FYANDDFNKTIDCFKTALQVNPNDELMWNRLGAALANSNRSEESIKAYHRALQLKPSFVR 515

Query: 173 CWLRRASAYENLGQFSDAMFDLSAVSLLGEYSG 205
                A +  N+G + +A+  L     + E  G
Sbjct: 516 ARYNLAVSSMNIGCYKEAVEHLLTALSMHEVEG 548

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 36/80 (45%)

Query: 375 KALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRF 434
           K+LE+D   +  +YH G++H V  ++  A   F  A   +  N   +     L ++  ++
Sbjct: 307 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQY 366

Query: 435 DDCETLFSEARRKFPTAPEV 454
            D    ++ A R  P   EV
Sbjct: 367 RDALDAYTRAIRLNPYISEV 386

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/83 (22%), Positives = 37/83 (44%), Gaps = 2/83 (2%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISL-KEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G       D+  A + +  A++    +P F+ +    Y  I+ +   ++  T A++L P 
Sbjct: 323 GRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPY 382

Query: 170 YSKCWLRRASAYENL-GQFSDAM 191
            S+ W    + YE    Q +DA+
Sbjct: 383 ISEVWYDLGTLYETCNNQLTDAL 405

>Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii ACR168W
          Length = 717

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 35/78 (44%), Gaps = 1/78 (1%)

Query: 381 PNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETL 440
           P  S  ++  G  +F + N  EA   F KA  L+P   +A++  A     +   +   + 
Sbjct: 429 PKSSVTWFAVGTYYFSINNIPEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 488

Query: 441 FSEARRKFPTAPEVPNFY 458
           +S A R FP    +P+ Y
Sbjct: 489 YSTAARFFP-GTHLPHLY 505

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFA-YIQCACLAF 429
           E+F  AL +D N    +   GQ ++     + +   F+KA EL P+++FA Y +   LA 
Sbjct: 699 EWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATELAPDHLFAGYFKAISLAG 758

Query: 430 RDDRFDDCETLFSEARRKFP 449
             + ++ C  + +    K P
Sbjct: 759 IGE-YEQCIEIIAALLEKLP 777

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 39/210 (18%), Positives = 80/210 (38%), Gaps = 43/210 (20%)

Query: 349 RPSTYIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFD 408
           +P T+  +  +++ + + +   + F+KA +LDPN +  Y  +G  H   ++   A   + 
Sbjct: 544 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 603

Query: 409 KAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSL 468
           KA   +P++  AY      + +  ++++    F +AR   P    +      I     SL
Sbjct: 604 KALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVL------ICCCGGSL 657

Query: 469 DAAIKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRS 528
           +                          +G    ++            + +E AC++ P S
Sbjct: 658 EK-------------------------LGYKEKVL------------QYYELACQLQPTS 680

Query: 529 EQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
             +K  + QL       + A+Q FE+   L
Sbjct: 681 SLSKYKMGQLLYSMTRYNVALQTFEELVKL 710

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 68/172 (39%), Gaps = 15/172 (8%)

Query: 391 GQMHFVVENFKEAGADFDKAKELNPENIFAY-IQCACLAFRDDRFDDCETLFSEARRKFP 449
           G++HF + N+  +   F++ K+L P  +    I    L    D+      L +      P
Sbjct: 484 GKLHFEIINYDMSLKYFNRLKDLQPARVKDMEIYSTLLWHLHDKVKS-SNLANGLMDTMP 542

Query: 450 TAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVE 509
             PE       +L+ +   DAAIK ++ A +L+           P    A  L  +    
Sbjct: 543 NKPETWCCIGNLLSLQKDHDAAIKAFEKATQLD-----------PNFAYAYTLQGHEHSS 591

Query: 510 NFV--EASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADLS 559
           N     A   + +A   DP+   A  GL    ++  + ++A+  FE A  ++
Sbjct: 592 NDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLGQYEEALLYFEKARSIN 643

>KNAG0K02630 Chr11 (523259..526489) [3231 bp, 1076 aa] {ON} Anc_3.5
           YOL145C
          Length = 1076

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 81/175 (46%), Gaps = 13/175 (7%)

Query: 391 GQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDD-CETLFSEARRKFP 449
           G   + +++++ A + +++A EL+PEN  A I C    F +   D   +T F+E+  K  
Sbjct: 234 GLCFWQLKDYQMAISAWERALELDPENKTASILCLLGKFHNSITDSKNDTQFTESFTKVL 293

Query: 450 TAPEVPNFYAE------ILAAKNSLDAAIKQYDIAIKLEDA--LPGIHVGIAPMIGKATA 501
           T  E+ + Y        +L    S       Y   IK+ +A   P   +    ++  +T 
Sbjct: 294 T--ELNDIYTNNKENPVLLILLQSYYYFTGDYSRVIKIYEAKISPNASLITPTLMSDSTF 351

Query: 502 LIRNP--TVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFED 554
                   + N+ EA  +F+E+ K +  +  A+ G+ Q +++   ++++I  FE+
Sbjct: 352 WCGRAQYALNNYREAFVMFQESLKTNEDNLLARFGVGQSQIKTNLVEESILTFEN 406

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 45/97 (46%), Gaps = 1/97 (1%)

Query: 110 KGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKP 168
           +G  ++   DF+K IE +  ++ +   D V ++   A+  + N  E  ++    AL LKP
Sbjct: 437 RGLLYYAEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLKP 496

Query: 169 DYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSG 205
            + +     A A  N+G + +A   L  V  + +  G
Sbjct: 497 SFVRARYNLAVASMNIGCYKEAGEHLLTVLRMHQVEG 533

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 23/93 (24%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 114 FFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSK 172
           F+   D++K I+ +  A+++   D + ++   A+  + N  E+ V     AL LKP + +
Sbjct: 503 FYTTADYDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLKPSFVR 562

Query: 173 CWLRRASAYENLGQFSDAMFDLSAVSLLGEYSG 205
                A +  N+G F +A   L     + E +G
Sbjct: 563 ARYNLAVSSINIGCFKEAAEHLLTALSMHEING 595

>YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski
           complex component and TPR protein, mediates 3'-5' RNA
           degradation by the cytoplasmic exosome; null mutants
           have superkiller phenotype of increased viral dsRNAs and
           are synthetic lethal with mutations in 5'-3' mRNA decay
          Length = 1432

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 29/59 (49%)

Query: 362 DKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFA 420
           +K E +   E+F  AL +DPN    +   GQ +      + +   FDKA +L P + FA
Sbjct: 714 EKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTFA 772

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 34.7 bits (78), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 44/93 (47%), Gaps = 1/93 (1%)

Query: 115 FKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKC 173
           +   DF+K +E +  A+ +   D + ++   A+  + N  E+ ++    A+ LKP + + 
Sbjct: 452 YSNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRA 511

Query: 174 WLRRASAYENLGQFSDAMFDLSAVSLLGEYSGQ 206
               A A  N+G + +A   L  V  + +  GQ
Sbjct: 512 RYNLAVASMNIGCYQEAAGHLLTVLKMHQVHGQ 544

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 32.3 bits (72), Expect = 0.84,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 108 KDKGNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALK 165
           K++GN  FK   + +A+  Y   I+ + ++PV YSN++ A + +  + + ++     L+
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLR 66

>ZYRO0A03036g Chr1 (245136..247739) [2604 bp, 867 aa] {ON} similar
           to uniprot|P19735 Saccharomyces cerevisiae YBR055C PRP6
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 867

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 13/45 (28%), Positives = 24/45 (53%)

Query: 381 PNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCA 425
           PNC   Y   GQ+H+ +   +E+   F++  ++ P+ I  +I  A
Sbjct: 631 PNCPKFYLQLGQIHYDLGQTEESQMAFERGTKMLPQGIPLWISLA 675

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 34.3 bits (77), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 49/115 (42%), Gaps = 28/115 (24%)

Query: 105 LALKDKGNEFFKAKDFEKAIEYY--TLAISLKEDP---VFYSNRSAAYVSINNFEKVVED 159
           +  K +G+E FK  D+  A++ Y  +L    +  P   + YSN  A  + I  + K +ED
Sbjct: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474

Query: 160 TTAALKLKPD-----------------------YSKCWLRRASAYENLGQFSDAM 191
              AL L P                        +SK  +R+A +YE+L  +  A+
Sbjct: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLAL 529

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 29/46 (63%)

Query: 513 EASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
           +A E F+ A +I+P + ++ +GL Q  L    I+ +I++FE A +L
Sbjct: 686 DAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATEL 731

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 371 EYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFA 420
           E+F  AL ++PN    +   GQ +      + +   F+KA EL+P++++A
Sbjct: 689 EWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDPDHLYA 738

>Kpol_339.13 s339 complement(21257..23317) [2061 bp, 686 aa] {ON}
           complement(21257..23317) [2061 nt, 687 aa]
          Length = 686

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 56/135 (41%), Gaps = 40/135 (29%)

Query: 107 LKDKGNEFFKAKDFEKAIEYY-----TLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTT 161
            K++G E FK  D+  A+E Y     TL I      +  SN  A+      + K +E +T
Sbjct: 397 FKERGTENFKTGDYVTALEAYQKSLNTLPIKHPLRIIASSNILASMSKTGEYRKSIEIST 456

Query: 162 AALKLKPDYSKCW---------------------LRRASAYENLGQFSDAMFDLSAVSLL 200
           +AL+  P   K W                     L+RA A+E++  + +A+         
Sbjct: 457 SALEQFPGDQKQWNEFIQDSEPQRTYKDIWPKIVLKRAEAFEHIESYENAL--------- 507

Query: 201 GEYSGQSVEQLLERN 215
                ++ +Q++E+N
Sbjct: 508 -----ETYQQMIEKN 517

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 48/102 (47%), Gaps = 6/102 (5%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G  F+  ++F K I+ +  A+ +   D + ++   A+  + N  E+ ++    AL LKP 
Sbjct: 423 GTLFYANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPS 482

Query: 170 YSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSGQSVEQL 211
           + +     A +  N+G + +A     A SLL   S   VE +
Sbjct: 483 FVRARYNLAISSMNIGCYKEA-----AESLLSALSMHEVENV 519

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 45/88 (51%), Gaps = 2/88 (2%)

Query: 114 FFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSK 172
           F+   DF+K I+ +  A+ +   D + ++   A+  + N  E+ ++    AL+LKP + +
Sbjct: 467 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 526

Query: 173 CWLRRASAYENLGQFSDAM-FDLSAVSL 199
                A +  N+G   +A  + LS +S+
Sbjct: 527 ARYNLAVSSMNIGCLKEAAGYLLSVLSM 554

>TPHA0A00690 Chr1 complement(124257..126425) [2169 bp, 722 aa] {ON}
           Anc_3.101 YOL095C
          Length = 722

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 90/234 (38%), Gaps = 48/234 (20%)

Query: 136 DPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSK-----CWL---------RRASAY 181
           D +  +  +A    INNF  +    T  L   PD+ K     C L            S+ 
Sbjct: 367 DLIIMTRTNAKLDIINNFLSLYGIETKCLSSNPDWIKNSAIQCLLDITKLVYSLTEDSSM 426

Query: 182 ENLGQFSDAMFDLSAVSLLGEYSGQSVEQLLERNMNKQATKVLGEKLKEN---------Q 232
           + + ++S    D S + +L    G          + K + K L E  ++N         Q
Sbjct: 427 DEVEEYSILKSDFSTIIMLNHVKG----------IGKISIKNLFEGAQKNNCSLWHYISQ 476

Query: 233 GKESPLPSNTS----LASFFGIFNPETSFDDYDGENEADVELKKGLENL-YKCQTGCYEL 287
           G    LP N +    +  F  +FNP       +  N A  EL + + N+ YK  TG +E 
Sbjct: 477 GSSESLPVNNTTKNKIIEFVKLFNPIIEEKVLNNLNSAH-ELLENITNIAYKLNTGIFEF 535

Query: 288 ADEEFTKAAELYKKELESSPDNESLKKKAAIAFEHVGIFKFF----KNDPITAH 337
            +++     EL+K+ L        LK  AA   + + + K+F    ++  I  H
Sbjct: 536 ENDQ---QKELFKENLYEFS--RVLKNCAATKDDDMSLLKWFLQSYRDQTIVTH 584

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/77 (23%), Positives = 35/77 (45%)

Query: 378 ELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDC 437
           E DP+ +  +YH G++H +  ++  A   F +A   +  N   +     L ++  ++ D 
Sbjct: 279 EFDPSDATTWYHLGRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 338

Query: 438 ETLFSEARRKFPTAPEV 454
              ++ A R  P   EV
Sbjct: 339 LDAYTRAIRLNPYISEV 355

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 51/107 (47%), Gaps = 6/107 (5%)

Query: 317 AIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEYFD-- 374
           A  + H+G     + D   A+   +++++ + R    I+   I     + +QY++  D  
Sbjct: 285 ATTWYHLGRIHMIRTDYTAAYDAFQQAVNRDSR--NPIFWCSIGVLYYQISQYRDALDAY 342

Query: 375 -KALELDPNCSAVYYHRGQMHFVVEN-FKEAGADFDKAKELNPENIF 419
            +A+ L+P  S V+Y  G ++    N   +A   + +A  L+PEN+ 
Sbjct: 343 TRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLDPENVH 389

>KAFR0C00360 Chr3 (73892..76375) [2484 bp, 827 aa] {ON} Anc_3.296
          Length = 827

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 382 NCSAVYYHRGQMHFVVE---NFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCE 438
           +CS++YY   ++   ++   N  +A   F KA  L PE    +I  A L  R  + DD  
Sbjct: 304 HCSSLYYMIARVLLKLDGKSNIYQAYECFQKALNLTPERPCLWISVASLYLRLGQLDDAL 363

Query: 439 TLFSEA 444
           + +S+A
Sbjct: 364 STYSQA 369

>CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189w SKI3
           antiviral protein
          Length = 1411

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 28/46 (60%)

Query: 513 EASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
           E+ + F+ A +IDP   ++ IGL Q  L    ++ ++++FE A DL
Sbjct: 697 ESIQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERALDL 742

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 40/78 (51%), Gaps = 1/78 (1%)

Query: 114 FFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSK 172
           F+   DF+K I+ +  A+ +   D + ++   A+  + N  E+ ++    AL+LKP + +
Sbjct: 467 FYTKDDFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 526

Query: 173 CWLRRASAYENLGQFSDA 190
                A +  N+G + +A
Sbjct: 527 ARYNLAVSSMNIGCYKEA 544

>Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR189W
           (REAL)
          Length = 1417

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%)

Query: 362 DKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFA 420
           +K E +   E+F  AL +DPN    +   GQ +      + +   FDKA +L P + +A
Sbjct: 699 EKQEESDSIEWFQSALRIDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTYA 757

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 47/88 (53%), Gaps = 2/88 (2%)

Query: 114 FFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSK 172
           F+   +F+K I+ +  A+S+   D + ++   A+  + N  E+ ++    AL+LKP + +
Sbjct: 406 FYADSEFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQLKPSFVR 465

Query: 173 CWLRRASAYENLGQFSDAM-FDLSAVSL 199
                A +  N+G + +A  + LSA+ +
Sbjct: 466 ARYNLAVSSINIGCYKEAAEYLLSALKM 493

>KLLA0F08459g Chr6 complement(787966..790479) [2514 bp, 837 aa] {ON}
           similar to uniprot|P12945 Saccharomyces cerevisiae
           YDL040C NAT1 Subunit of the N-terminal acetyltransferase
           NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
           proteins which influences multiple processes such as the
           cell cycle heat-shock resistance mating sporulation and
           telomeric silencing
          Length = 837

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 48/108 (44%), Gaps = 1/108 (0%)

Query: 351 STYIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKA 410
           +TY ++AL    + +  Q   Y DKA+   P    VY  + ++   +   +EA    DK 
Sbjct: 385 TTY-FLALHYLHRKQFEQANAYADKAMNHTPTLVEVYILKSRVLKHLGLLEEASEVIDKG 443

Query: 411 KELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFY 458
           +EL+ ++ F   +      R D+ D+   + S   +   +   VP+ +
Sbjct: 444 RELDLQDRFINAKTVKYMLRADKIDEATKIVSLFTKNDQSPNGVPDLH 491

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/88 (23%), Positives = 46/88 (52%), Gaps = 2/88 (2%)

Query: 114 FFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSK 172
           F+   +F+K I+ +  A+ +   D + ++   A+  + N  E+ ++    AL LKP + +
Sbjct: 460 FYSNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVR 519

Query: 173 CWLRRASAYENLGQFSD-AMFDLSAVSL 199
                A +  N+G + + A + L+A+S+
Sbjct: 520 ARYNLAVSSINIGCYKEAAQYLLTALSM 547

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 24/43 (55%)

Query: 142 NRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENL 184
           NR+A +  I + +K ++D   A + +P   KC+LRR    + L
Sbjct: 76  NRAATWEKIGDLKKALKDANRATRFEPYNLKCYLRRGKILQKL 118

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 23/100 (23%), Positives = 49/100 (49%), Gaps = 5/100 (5%)

Query: 114 FFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSK 172
           F+   +F++ I+ +  A+ +   D + ++   A+  + N  E+ ++    AL+LKP + +
Sbjct: 434 FYANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVR 493

Query: 173 CWLRRASAYENLGQFSDA----MFDLSAVSLLGEYSGQSV 208
                A +  N+G + +A    +  LS   + GE+  QS 
Sbjct: 494 ARYNLAVSSMNIGCYKEAAEHLLTALSMHDVEGEFEVQST 533

>NCAS0A10540 Chr1 (2097795..2100428) [2634 bp, 877 aa] {ON}
           Anc_3.265 YBR055C
          Length = 877

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 40/85 (47%), Gaps = 8/85 (9%)

Query: 508 VENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADLSRSFDE--- 564
           + NF +A  + EE C I PRS++  + L  ++L    I     L   A   +   +    
Sbjct: 246 IRNFKQARSIIEEGCNICPRSDE--LWLENIRLNSSNIQHCKVLIATAIRFNSKSESLWL 303

Query: 565 ---KLQATTFAEATKVQKKIRADPF 586
              +L++ TF +   V+K ++A P+
Sbjct: 304 KAVELESETFNKYRVVRKALQAIPY 328

>YKL022C Chr11 complement(394726..397248) [2523 bp, 840 aa] {ON}
           CDC16Subunit of the anaphase-promoting complex/cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; required for sporulation
          Length = 840

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 69/313 (22%), Positives = 124/313 (39%), Gaps = 25/313 (7%)

Query: 249 GIFNPETSFDDYDGENEADV-ELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSP 307
            +  P+  +D +D  +  +  E K+ ++NLYK     Y +  E+ TK+ E+  K+ + + 
Sbjct: 403 NLLTPQEEWDLFDSLDFKEFGEDKEIMKNLYKINLSKY-INTEDITKSNEILAKDYKLAD 461

Query: 308 DNESLKKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEAN 367
           + + ++ K  I +      KF         + L E++  N   +T I  A I      +N
Sbjct: 462 NVDVVRSKVDICYTQC---KF------NECLELCETVLENDEFNTNILPAYIGCLYELSN 512

Query: 368 QYKEYF--DKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCA 425
           + K +    +  E  P  +  ++     +  ++   EA   + K+  L+P    A++  A
Sbjct: 513 KNKLFLLSHRLAETFPKSAITWFSVATYYMSLDRISEAQKYYSKSSILDPSFAAAWLGFA 572

Query: 426 CLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDAL 485
                +   D   T +S A R FP       F      A NSL+ A   + +A  +    
Sbjct: 573 HTYALEGEQDQALTAYSTASRFFPGMHLPKLFLGMQFMAMNSLNLAESYFVLAYDICPND 632

Query: 486 PGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSE-----QAKIGLAQLKL 540
           P +   +  M  K     +N  V+      +  E    +DP S      Q  +G    KL
Sbjct: 633 PLVLNEMGVMYFK-----KNEFVKAKKYLKKALEVVKDLDPSSRTTISIQLNLGHTYRKL 687

Query: 541 QQEEIDDAIQLFE 553
            + EI  AI+ F 
Sbjct: 688 NENEI--AIKCFR 698

>AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR189W
           (SKI3)
          Length = 1390

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 27/47 (57%)

Query: 513 EASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADLS 559
           E+ E F+ A +ID    +A IGL Q       I+ +I++FE A +LS
Sbjct: 678 ESIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKVFERALELS 724

>NDAI0J00130 Chr10 complement(10432..14643) [4212 bp, 1403 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1403

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 27/46 (58%)

Query: 516 ELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAIQLFEDAADLSRS 561
           E F+ A ++DP   ++ +GL Q  L    I+ ++++FE A +L  S
Sbjct: 690 EWFQSAIRVDPNDIESWVGLGQAYLACGRIEASMKVFEKAMELDGS 735

>Smik_11.290 Chr11 (480666..482963) [2298 bp, 765 aa] {ON} YKR027W
           (REAL)
          Length = 765

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 29/53 (54%)

Query: 151 NNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEY 203
           N++E  +  +T A KL  D  + WL  + +Y  L Q+  A+  ++++  L EY
Sbjct: 355 NDYELSLSISTLATKLSSDSFESWLLLSKSYVFLQQYDKALLTINSMPCLAEY 407

>NDAI0F00400 Chr6 complement(96274..98568) [2295 bp, 764 aa] {ON}
           Anc_5.689 YOR080W
          Length = 764

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 25/49 (51%)

Query: 142 NRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDA 190
           NR+A +  +   EK + D T    ++P   KC++R+    + L +  DA
Sbjct: 99  NRAACWEKMGELEKALRDATKMCFIEPYNLKCFIRKGKILQKLHKLKDA 147

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 30.8 bits (68), Expect = 4.4,   Method: Composition-based stats.
 Identities = 15/61 (24%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 107 LKDKGNEFFKAKDFEKAIEYYTLAISLKE-DPVFYSNRSAAYVSINNFEKVVEDTTAALK 165
           LK +GN  ++ +D+  A+ +Y   +     +P+ +SNR+   + +N  ++  +   A L 
Sbjct: 7   LKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEAQKACQAGLA 66

Query: 166 L 166
           L
Sbjct: 67  L 67

>ZYRO0A02926g Chr1 complement(238036..239769) [1734 bp, 577 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 577

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 45/93 (48%), Gaps = 1/93 (1%)

Query: 114 FFKAKDFEKAIEYYTLAISLKE-DPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSK 172
           F+    F+K I+ +  A+S+   D + ++   A+  + +  E+ ++    AL+LKP + +
Sbjct: 436 FYVDDQFDKTIDCFKAALSVNSNDELMWNRLGASLANSSRSEEAIQAYHRALQLKPSFVR 495

Query: 173 CWLRRASAYENLGQFSDAMFDLSAVSLLGEYSG 205
                A +  N+G + +A   L     + E SG
Sbjct: 496 ARYNLAVSSINIGCYKEAAEHLLTALSMHEVSG 528

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 2/57 (3%)

Query: 370 KEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCAC 426
           K  F KAL ++       Y  G     +  F+EA   F+KA+ LNP N+   + C C
Sbjct: 546 KSCFRKALTIEKTHYNALYGLGMCCVKLGKFEEALLFFEKARALNPVNVI--LNCCC 600

>KLTH0H14234g Chr8 (1236691..1237878) [1188 bp, 395 aa] {ON} similar
           to uniprot|P47103 Saccharomyces cerevisiae YJR032W CPR7
           Peptidyl-prolyl cis-trans isomerase (cyclophilin)
           catalyzes the cis-trans isomerization of peptide bonds
           N-terminal to proline residues binds to Hsp82p and
           contributes to chaperone activity
          Length = 395

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 6/70 (8%)

Query: 353 YIYMALIMADKGEANQYKEYFDKALELDPNCSAV-----YYHRGQMHFVVENFKEAGADF 407
           Y+ + L+M ++ +     +Y    LE+ P  S +     YY  G  H + + F +A ADF
Sbjct: 297 YLNLILVMFNQKKYEDAIKYSVYLLEI-PEASGLDRAKAYYRSGNCHLMKKRFDKALADF 355

Query: 408 DKAKELNPEN 417
           +  KE NP +
Sbjct: 356 NACKEHNPND 365

>Skud_16.493 Chr16 (854949..859226) [4278 bp, 1425 aa] {ON} YPR189W
           (REAL)
          Length = 1425

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 35/80 (43%), Gaps = 1/80 (1%)

Query: 362 DKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFA- 420
           +K E +   E+F  AL +DPN    +   GQ +      + +   FDKA  L P + +A 
Sbjct: 707 EKQEESDSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIGLKPSHTYAQ 766

Query: 421 YIQCACLAFRDDRFDDCETL 440
           Y +   L    +  +  E L
Sbjct: 767 YFKAVSLCDMGEYLESLEIL 786

>SAKL0D03564g Chr4 (287287..290013) [2727 bp, 908 aa] {ON} similar
           to uniprot|P19735 Saccharomyces cerevisiae YBR055C PRP6
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 908

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 35/144 (24%), Positives = 64/144 (44%), Gaps = 16/144 (11%)

Query: 403 AGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAE-- 460
           A +DFD A   NP++   Y++ A +  R    D    + S+A +KFP +    + + E  
Sbjct: 734 ARSDFDLAIIKNPDSDLLYVEKAKMEARLGNKDQARLIVSQALKKFPKS---AHLWVENM 790

Query: 461 ILAAKNSLDAAIKQYDIAIKLEDALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEE 520
            L AK SL  ++         +DAL         ++    +   N T   + +A + FE 
Sbjct: 791 KLVAKKSLKRSM--------FQDALKNTENACQVLVEIGVSFY-NET--QYDKALKWFER 839

Query: 521 ACKIDPRSEQAKIGLAQLKLQQEE 544
           + K +P+   + + L +  L+ E+
Sbjct: 840 STKTNPQQGDSWVWLYRCYLKLEK 863

>Suva_13.441 Chr13 complement(758967..761369) [2403 bp, 800 aa] {ON}
           YMR257C (REAL)
          Length = 800

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 24/53 (45%)

Query: 434 FDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALP 486
           FD CETLFSE  +     P + +         N++  A++ Y  AI   D  P
Sbjct: 190 FDTCETLFSEYIKHCKVEPRMISLGLTSFIRNNNIQLAVEFYTQAITNPDTFP 242

>Smik_16.46 Chr16 (80717..83158) [2442 bp, 813 aa] {ON} YGR261C
           (REAL)
          Length = 813

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 53/135 (39%), Gaps = 14/135 (10%)

Query: 322 HVGIFKFFKNDP--ITAHIN-LEESLS-LNPRPSTYIYMALIMADKGEANQYKEYFDKAL 377
           H+ + +F +NDP      IN L++SLS  NP    +   AL             +  K L
Sbjct: 102 HLYLLRFAENDPNLTLLSINSLQKSLSDSNPELRCFALSALSDMKMTSLAPIILHTVKKL 161

Query: 378 ELDPNCSAVYYHRGQMHFVVENFKEAGAD------FDKAKELNPENIFAYIQCACLAFRD 431
             DP+       RG++   +     AG +       D  KEL  +     I C  LAF++
Sbjct: 162 VTDPSAMV----RGEVALAIIKLYRAGKNEYHEELLDILKELMADTDPKVISCTVLAFKE 217

Query: 432 DRFDDCETLFSEARR 446
              D  E L    RR
Sbjct: 218 CYADHLELLHGHFRR 232

>Kwal_34.16092 s34 complement(198730..199917) [1188 bp, 395 aa] {ON}
           YJR032W (CPR7) - peptidyl-prolyl cis/trans isomerase
           [contig 270] FULL
          Length = 395

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 35/70 (50%), Gaps = 6/70 (8%)

Query: 353 YIYMALIMADKGEANQYKEYFDKALELDPNCSAV-----YYHRGQMHFVVENFKEAGADF 407
           Y+ ++L+M +     +   Y    LE+ P  S++     YY  G  HF  + + +A +DF
Sbjct: 297 YLNLSLVMFNLKRYEEAITYTTYLLEI-PEASSIDKAKAYYRSGNCHFAKKRYDKALSDF 355

Query: 408 DKAKELNPEN 417
              KE NP++
Sbjct: 356 KCCKENNPDD 365

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 87/212 (41%), Gaps = 13/212 (6%)

Query: 349 RPSTYIYMALIMADKGEANQYKEYFDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFD 408
           +P T+  +  +++ + + +   + F+KA +LDPN +  Y  +G  H   ++   A   + 
Sbjct: 550 KPETWCCIGNLLSLQKDHDAAIKAFEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYR 609

Query: 409 KAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSL 468
           KA   + ++  AY      + +  ++++    F +AR   P    +       L      
Sbjct: 610 KALACDSQHYNAYYGLGTSSMKLGQYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYK 669

Query: 469 DAAIKQYDIAIKLE--DALPGIHVGIAPMIGKATALIRNPTVENFVEASELFEEACKIDP 526
           + A++ Y++A  L+   +L    +G          L+ + T  N   A + FEE  K+ P
Sbjct: 670 EKALQYYELACHLQPTSSLSKYKMG---------QLLYSMTRYNV--ALQTFEELVKLVP 718

Query: 527 RSEQAKIGLAQLKLQQEEIDDAIQLFEDAADL 558
               A   L Q         DAI+    A +L
Sbjct: 719 DDATAHYLLGQTYRIVGRKKDAIKELTVAMNL 750

>TPHA0A05290 Chr1 complement(1198497..1200497) [2001 bp, 666 aa]
           {ON} Anc_5.72 YHR166C
          Length = 666

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 38/82 (46%), Gaps = 1/82 (1%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G+EF + K+ + AIE Y  A+ +   D   +     AY  ++     +     A  LKP 
Sbjct: 478 GHEFVELKNSQAAIECYRHAVDINPRDFKAWYGLGQAYEVLDMHLYSLYYFQKACTLKPL 537

Query: 170 YSKCWLRRASAYENLGQFSDAM 191
             + W   AS Y  +G F+DA+
Sbjct: 538 DKRMWQALASCYVKIGNFNDAI 559

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 41/78 (52%), Gaps = 1/78 (1%)

Query: 114 FFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSK 172
           F+   +F+K I+ +  A+ +  ED + ++   A+  + +  E+ ++    AL+LKP + +
Sbjct: 441 FYSNNEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLKPSFVR 500

Query: 173 CWLRRASAYENLGQFSDA 190
                A +  N+G + +A
Sbjct: 501 ARYNLAVSSINIGCYKEA 518

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/96 (21%), Positives = 45/96 (46%), Gaps = 1/96 (1%)

Query: 111 GNEFFKAKDFEKAIEYYTLAISLK-EDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPD 169
           G  F+   +F+K I+ +  A+ ++  D   ++   A+  + N  E+ ++    A++LKP 
Sbjct: 428 GVLFYANDEFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPA 487

Query: 170 YSKCWLRRASAYENLGQFSDAMFDLSAVSLLGEYSG 205
           + +     A +  N+G + +A   L     + E  G
Sbjct: 488 FVRARYNLAVSSMNIGCYKEAAEQLLTALSMHEVEG 523

>NCAS0C02770 Chr3 complement(522391..524694) [2304 bp, 767 aa] {ON}
           Anc_8.415 YDR206W
          Length = 767

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 2/73 (2%)

Query: 103 YALALKDKGNEFFKAKDFEKAIEYYTLAISLKED-PVFYSNRSAAYVSINNFEKVV-EDT 160
           Y ++L +K +  +   DF+K+  Y  LAI+L     V Y+N++   +  N+F   + E  
Sbjct: 193 YHMSLIEKTSNVYLKDDFKKSERYIDLAITLLPSMGVSYANKAMVSLRYNDFTSTIFEAI 252

Query: 161 TAALKLKPDYSKC 173
             +L   PD + C
Sbjct: 253 RGSLIRLPDLNYC 265

>TBLA0G02100 Chr7 (549066..555773) [6708 bp, 2235 aa] {ON} Anc_4.310
            YLR430W
          Length = 2235

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 21/35 (60%)

Query: 295  AAELYKKELESSPDNESLKKKAAIAFEHVGIFKFF 329
            + E YK+EL+  PD E +  +   + E +G +KFF
Sbjct: 1626 SKEFYKRELKDGPDMEKITARPWHSLEALGPYKFF 1660

>SAKL0G08140g Chr7 complement(692376..693443) [1068 bp, 355 aa] {ON}
           similar to uniprot|P38803 Saccharomyces cerevisiae
           YHR085W IPI1 Protein of unknown function essential for
           viability may be involved in rRNA processing
          Length = 355

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 5/51 (9%)

Query: 409 KAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARRKFPTAPEVPNFYA 459
           K + +N E +  +I+C C+  + D  +  ET+FS         PE P  YA
Sbjct: 222 KYRSMNLETLVEFIKCGCIEEKKDENEQEETMFSRY-----LVPEYPQPYA 267

>Skud_13.428 Chr13 complement(753597..755999) [2403 bp, 800 aa] {ON}
           YMR257C (REAL)
          Length = 800

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 24/54 (44%)

Query: 433 RFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALP 486
            FD+CETLFSE  +     P + +         N+   A++ Y  AI   D  P
Sbjct: 189 HFDNCETLFSEYIKYCKVNPHMISLGLNSFTRNNNTQLAVEFYTQAITNPDTFP 242

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 44/110 (40%), Gaps = 26/110 (23%)

Query: 107 LKDKGNEFFKAKDFEKAIEYY-----TLAISLKEDPVFYSNRSAAYVSINNFEKVVEDTT 161
            KD+  E FK  D+  A++ Y     TL        + YSN  A+ +    +++ +   +
Sbjct: 348 FKDRAGELFKTGDYVAALQEYEKSANTLPHGHPLRIISYSNLMASQLKTGQYKESLHVAS 407

Query: 162 AALKLKPDYSKCWL---------------------RRASAYENLGQFSDA 190
            ALKL P+ +  W                      RRA A+E+   F +A
Sbjct: 408 MALKLFPEDTTQWTQLIQNSEPSKTYRDMWPKIVQRRAEAFEHSENFQEA 457

>CAGL0C05313g Chr3 (506270..508789) [2520 bp, 839 aa] {ON} similar
           to uniprot|P12945 Saccharomyces cerevisiae YDL040c NAT1
          Length = 839

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 26/106 (24%), Positives = 46/106 (43%), Gaps = 10/106 (9%)

Query: 388 YHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDDRFDDCETLFSEARR- 446
           Y   Q +  +++F +A +  DKA +  P  +  YIQ A +       D    +  EAR+ 
Sbjct: 388 YFLSQHYLYLKDFTQAQSYIDKAMDHTPTMVEFYIQKARILKHLGLLDSASDILEEARKL 447

Query: 447 ----KFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDALPGI 488
               +F     V     + L   N +D A++   +  K ED++ G+
Sbjct: 448 DLQDRFINCKSV-----KYLLRANKIDEAVEVASLFTKNEDSVNGL 488

>SAKL0C01166g Chr3 (102520..104016) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P17709 Saccharomyces cerevisiae
           YCL040W GLK1 Glucokinase catalyzes the phosphorylation
           of glucose at C6 in the first irreversible step of
           glucose metabolism one of three glucose phosphorylating
           enzymes expression regulated by non- fermentable carbon
           sources
          Length = 498

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 8/114 (7%)

Query: 474 QYDIAIKLE-DALPGIHVGIAPMIGKATA-LIRNPTVENFVEASELFEEACKID--PRSE 529
           +YDIAI  +  + PG H+    + G     L+RN  V+   +   +F +  + +  P   
Sbjct: 302 KYDIAIDQKYSSNPGFHLFEKRVSGMFLGELLRNVLVDLHAQGL-IFSQYSRYEHLPHHL 360

Query: 530 QAKIGLAQLKLQQEEIDDAIQLFEDAADLSRSFDEKLQATTFAEATKVQKKIRA 583
           +    L+   L   EIDD+ +L E    L +S       TT+AE  ++QK +RA
Sbjct: 361 KTPFDLSSEVLSHIEIDDSSKLRETELSLLQSLR---LPTTYAERVEIQKLVRA 411

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,673,541
Number of extensions: 2643199
Number of successful extensions: 8798
Number of sequences better than 10.0: 288
Number of HSP's gapped: 8647
Number of HSP's successfully gapped: 444
Length of query: 604
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 489
Effective length of database: 40,294,809
Effective search space: 19704161601
Effective search space used: 19704161601
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)