Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F20185g6.65ON28525211161e-154
ZYRO0D14190g6.65ON2951635143e-63
AGR270W6.65ON2942385064e-62
SAKL0A08426g6.65ON2992285004e-61
TBLA0G005506.65ON3182545015e-61
CAGL0L04620g6.65ON2641634881e-59
Kpol_1042.116.65ON2921644901e-59
KLTH0G15444g6.65ON2632404782e-58
KAFR0G025006.65ON2892374785e-58
YOR174W (MED4)6.65ON2841794733e-57
Smik_15.3526.65ON2881634734e-57
Suva_8.2276.65ON2871584709e-57
KNAG0M010206.65ON2791654663e-56
NCAS0F003306.65ON2811634612e-55
Kwal_56.232426.65ON2561614565e-55
Skud_15.3366.65ON2861634561e-54
NDAI0J013206.65ON3341614417e-52
TPHA0F025906.65ON3061634371e-51
Ecym_31246.65ON2741624342e-51
TDEL0G040606.65ON2201564013e-47
CAGL0I08877g5.166ON34459666.9
TPHA0M010503.265ON87739677.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F20185g
         (285 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   434   e-154
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   202   3e-63
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   199   4e-62
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   197   4e-61
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   197   5e-61
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   192   1e-59
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   193   1e-59
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   188   2e-58
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   188   5e-58
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   186   3e-57
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   186   4e-57
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   185   9e-57
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   184   3e-56
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   182   2e-55
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   180   5e-55
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   180   1e-54
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   174   7e-52
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   172   1e-51
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   171   2e-51
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   159   3e-47
CAGL0I08877g Chr9 complement(862629..863663) [1035 bp, 344 aa] {...    30   6.9  
TPHA0M01050 Chr13 complement(205757..208390) [2634 bp, 877 aa] {...    30   7.1  

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  434 bits (1116), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 219/252 (86%), Positives = 219/252 (86%)

Query: 14  ATLPFSAQDKTQEQVSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDK 73
           ATLPFSAQDKTQEQVSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDK
Sbjct: 14  ATLPFSAQDKTQEQVSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDK 73

Query: 74  KLYETLXXXXXXXXXXXXLSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQ 133
           KLYETL            LSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQ
Sbjct: 74  KLYETLEEFDEYYKIEEELSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQ 133

Query: 134 KVMLKQREKIHSKVVLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASX 193
           KVMLKQREKIHSKVVLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMAS 
Sbjct: 134 KVMLKQREKIHSKVVLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASL 193

Query: 194 XXXXXXXXXXXXXXXXXXXXTSKIDEMRNTNEDSVDDRFNNKEQVQDATEDTERRGSFEF 253
                               TSKIDEMRNTNEDSVDDRFNNKEQVQDATEDTERRGSFEF
Sbjct: 194 KKKELLLDALDEDNVNNDNNTSKIDEMRNTNEDSVDDRFNNKEQVQDATEDTERRGSFEF 253

Query: 254 TANGKEDSETKS 265
           TANGKEDSETKS
Sbjct: 254 TANGKEDSETKS 265

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  202 bits (514), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 122/163 (74%)

Query: 30  EELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXXXXXX 89
           +EL  V IY DL +YEE +  L +SVD FKPD+ ++ ++IE DK LY++L          
Sbjct: 41  DELSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRID 100

Query: 90  XXLSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVL 149
             L+RLDKE   +D KT+E+LETL+ CY  LN LPMLEQVEFE++ +LKQR K++S V+L
Sbjct: 101 SELNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLL 160

Query: 150 DYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMAS 192
           +YA KL+KFT+ PPTFDK  IGPNNF+WPAED+LR+GMLA+AS
Sbjct: 161 NYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIAS 203

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  199 bits (506), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 105/238 (44%), Positives = 136/238 (57%), Gaps = 11/238 (4%)

Query: 18  FSAQDKTQEQVSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYE 77
           F  QD +  +   +L SV IY+DL +YEE++Q+L  SVD F+PDL    ++IE D KLY 
Sbjct: 34  FQPQDASHVE-QNKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYS 92

Query: 78  TLXXXXXXXXXXXXLSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVML 137
            L            L +L++E K+ID +T +IL  L  CYN LN LPM+EQVEFE   M 
Sbjct: 93  NLAQLPKYDLIDSQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMK 152

Query: 138 KQREKIHSKVVLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASXXXXX 197
           KQ++K++S V+L+YAMKL+KFTR PPTF+K  IGPNNFIWPAED++R+GMLAMAS     
Sbjct: 153 KQKDKVNSSVLLEYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKE 212

Query: 198 XXXXXXXXXXXXXXXXTSKIDEMRNTNEDSVDDRFNNKEQVQDATEDTERRGSFEFTA 255
                             K            D        ++ A     RRGSFEFT 
Sbjct: 213 LTSLPGQSDQEAEQASAGK----------EADTAGPGVSTLEPANGGHNRRGSFEFTG 260

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  197 bits (500), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 105/228 (46%), Positives = 138/228 (60%), Gaps = 3/228 (1%)

Query: 32  LQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXXXXXXXX 91
           L  V +Y D+  YEET+ +L  SVD FKPDL +  ++IE DKKL++ L            
Sbjct: 44  LSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGR 103

Query: 92  LSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVLDY 151
           L+ L+K+ + +D KT +ILE LN C+  LN LP LEQV  E+  MLKQREKI+S V+LDY
Sbjct: 104 LNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDY 163

Query: 152 AMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASXXXXXXXX---XXXXXXXX 208
           AMKLAKFTR PPTFDK M+GPNNFIWPAED++R+GMLAMAS                   
Sbjct: 164 AMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQENEEYEE 223

Query: 209 XXXXXTSKIDEMRNTNEDSVDDRFNNKEQVQDATEDTERRGSFEFTAN 256
                 ++ +  + T  ++      N+ +   A E+  RR SFEFTA+
Sbjct: 224 SEENRENEENGEKETKPETKSTLTENESETVAAREEIPRRSSFEFTAD 271

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  197 bits (501), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 111/254 (43%), Positives = 147/254 (57%), Gaps = 18/254 (7%)

Query: 15  TLPFSAQDKT-QEQVSE------------ELQSVGIYQDLERYEETIQQLSKSVDTFKPD 61
           TLP     KT    +SE            EL  +  Y DL +YEET+ +LS SVD +KPD
Sbjct: 7   TLPHHGHHKTLSTSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPD 66

Query: 62  LSLIDKVIECDKKLYETLXXXXXXXXXXXXLSRLDKEQKNIDNKTREILETLNTCYNSLN 121
           L     +I+ D+KLY TL            L +L+ + K +D KT+ +L++LN C+  LN
Sbjct: 67  LQYAYDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLN 126

Query: 122 ELPMLEQVEFEQKVMLKQREKIHSKVVLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAED 181
            LPMLEQVEFE+  MLKQREKI+SKV+LDYA KLAKFT+ PPTF+K+ +GPNNFIWPAED
Sbjct: 127 TLPMLEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAED 186

Query: 182 SLRKGMLAMASXXXXXXXXXXXXXXXXXXXXXTSKIDEMRNTNEDSVDDRFNNKEQVQDA 241
           +LR+GMLA+AS                      S+++    TN+D+  D       +   
Sbjct: 187 ALRRGMLAVASAHTEELTALPGSVGDEENSKDISQLNADDVTNKDNHMDM-----DITVE 241

Query: 242 TEDTERRGSFEFTA 255
            +D  RRGSF F +
Sbjct: 242 GQDRFRRGSFTFGS 255

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  192 bits (488), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 94/163 (57%), Positives = 115/163 (70%)

Query: 30  EELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXXXXXX 89
           +EL  V +Y DL  YEE + +L  SVD FKP L +  ++IE DKKLY TL          
Sbjct: 15  QELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKLYSTLDLLPQYDSVF 74

Query: 90  XXLSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVL 149
             L  LD E   +D +T+ IL  LN C++ LN LP+LE+VEFE+K++LKQREKI S V+L
Sbjct: 75  TRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKMILKQREKIKSNVLL 134

Query: 150 DYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMAS 192
           +YA KLAKFT+ PPTFDK  IGPNNFIWPAED+LRKGMLAMAS
Sbjct: 135 EYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMAS 177

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  193 bits (490), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 119/164 (72%)

Query: 29  SEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXXXXX 88
           S +L  V IY D+  YE T+ +L +SVD FKPD+ L  ++I+ D++L+++L         
Sbjct: 39  SNDLSKVQIYNDISEYENTLFKLVESVDKFKPDVKLAHQLIDVDERLFKSLDSFVEYDKI 98

Query: 89  XXXLSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVV 148
              L   DKE   +D KT+EIL TLN C+  LN LPMLEQVEFE+ ++LKQR KI+SK++
Sbjct: 99  STKLEECDKEAAELDTKTKEILGTLNECHGLLNSLPMLEQVEFEKDIILKQRSKINSKLL 158

Query: 149 LDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMAS 192
           LDYA KL+KFT+ PPTF+K  IGPNNFIWPAED+LR+GMLAMAS
Sbjct: 159 LDYATKLSKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAMAS 202

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  188 bits (478), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 103/240 (42%), Positives = 140/240 (58%), Gaps = 11/240 (4%)

Query: 26  EQVSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXX 85
           + V   L  + +Y D+  +E+T+ +L  SVD F PDL L   +IE DK+LY++L      
Sbjct: 16  DSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKY 75

Query: 86  XXXXXXLSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHS 145
                    LD+E ++ D KT  ILETL  C + LN LPMLEQVEFE++ MLKQREK+ +
Sbjct: 76  DEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFT 135

Query: 146 KVVLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASXXXXXXXXXXXXX 205
            V+LDYAMKLAKFT  PPTFDK  +GPNNF+WPAED++R+GMLA+AS             
Sbjct: 136 DVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLRASEGANAQEQQ 195

Query: 206 XXXXXXXXTSKIDEMRNTNEDS-VDDRFNNKEQVQDATEDTERRGSFEFTANGKEDSETK 264
                     K  E  + NE++  D R  + ++     E   RR SF F  +G +D E++
Sbjct: 196 ASSEQ-----KTSEKSSENEEAQTDIRSPDTKE-----EPVARRPSFGFDGSGAKDHESE 245

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  188 bits (478), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 143/237 (60%), Gaps = 9/237 (3%)

Query: 28  VSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXXXX 87
            S  +  VGIY DL +YEET+ +L +S+DT+KPD  +  ++I+ D KL+ +L        
Sbjct: 37  ASPAITKVGIYSDLSQYEETLSRLIQSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDR 96

Query: 88  XXXXLSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKV 147
               L   +K++K    KT+EILETLN C+N+LN LP ++QV FE   ML+QR+KI+S V
Sbjct: 97  ISSRLKDFEKQEKESTLKTKEILETLNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSV 156

Query: 148 VLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASXXXXXXXXXXXXXXX 207
           +LDYA KL+KFT+ PPTFDK  IGPNNF+WPAED+LR+GMLA+A+               
Sbjct: 157 LLDYATKLSKFTKIPPTFDKGSIGPNNFVWPAEDALRRGMLALAASHTDELTKIAGVEMS 216

Query: 208 XXXXXXTSKIDEMRNTNEDSVDDRFNNKEQVQDATEDTERRGSFEFTANGKEDSETK 264
                  + +DE++     SVD     +  + +  + + RRGS+ F     +++E K
Sbjct: 217 LSDDNSIA-LDEIK-----SVD---AGEGPIPEKKDSSSRRGSYIFAGQSGKNAEHK 264

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  186 bits (473), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 87/179 (48%), Positives = 125/179 (69%)

Query: 14  ATLPFSAQDKTQEQVSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDK 73
           +++   A+  +     ++L  V +Y+DL RYE+T+ +L +SVD FKP+L +   +I  D+
Sbjct: 19  SSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAKDLIRTDE 78

Query: 74  KLYETLXXXXXXXXXXXXLSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQ 133
            L+E +            L ++DK+ + +D+KTR+ILE LN C++ L  LPMLEQVEFE+
Sbjct: 79  ALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPMLEQVEFEK 138

Query: 134 KVMLKQREKIHSKVVLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMAS 192
             +L+QR KI+S  +LDYA KL+KFT+ PPTFDK  +GPNNFIWPAED+LR+GMLAMAS
Sbjct: 139 NTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRGMLAMAS 197

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  186 bits (473), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 119/163 (73%)

Query: 30  EELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXXXXXX 89
           ++L  V +Y+DL RYE+T+++L +SVD FKPD+ +   +I+ D+ L+  +          
Sbjct: 35  DKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVARDLIKIDESLFNNVDLLSEYDNID 94

Query: 90  XXLSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVL 149
             L ++DK+ + +D+KT+ ILE +N C++ L  LPMLEQVEFE+  +L+QR KI+S  +L
Sbjct: 95  RNLRKIDKDSEELDSKTKRILEIMNECHDELGALPMLEQVEFEKNTILQQRSKINSTALL 154

Query: 150 DYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMAS 192
           DYA KL+KFTR PPTFDK  IGPNNFIWPAED+LR+GMLAMAS
Sbjct: 155 DYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRGMLAMAS 197

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  185 bits (470), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 85/158 (53%), Positives = 117/158 (74%)

Query: 35  VGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXXXXXXXXLSR 94
           V +Y+DL RYE+ + +L +SVD FKP+L +   +I+ D+ L+  +            L +
Sbjct: 40  VQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRK 99

Query: 95  LDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVLDYAMK 154
           +DK+ + +D+KTR+ILE LN C++ L+ LPMLEQVEFE+K +L+QR KI+S  +LDYA K
Sbjct: 100 IDKDSEELDSKTRKILEILNECHDELSALPMLEQVEFEKKTILQQRSKINSTALLDYATK 159

Query: 155 LAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMAS 192
           L+KFTR PPTFDK  +GPNNFIWPAED+LR+GMLAMAS
Sbjct: 160 LSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMAS 197

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  184 bits (466), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 84/165 (50%), Positives = 119/165 (72%)

Query: 28  VSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXXXX 87
           ++E+L+ V IY  +  YE+T+  L +SVD++KPD+++  ++++ DK+L+ +L        
Sbjct: 36  LAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDE 95

Query: 88  XXXXLSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKV 147
               L  L  +   +D KTR+ILE LN C++ LN+LP LEQV+FE   +L+QREKI+S  
Sbjct: 96  ISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSE 155

Query: 148 VLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMAS 192
           +LDYA KL+KFTR PPTFDK  IGPNNFIWPAED+LRKGMLA+A+
Sbjct: 156 LLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAA 200

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  182 bits (461), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 115/163 (70%)

Query: 30  EELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXXXXXX 89
           +++  V IY DL  YE+ +  L  SVD FKPD++   ++IE D+ L++TL          
Sbjct: 39  DDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNAARELIEVDRHLFQTLDSFEEYDKID 98

Query: 90  XXLSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVL 149
             L +L+ E   +D +T+EIL  LN C++ LN LPML+QVEFE + +L+QR KI+S V+L
Sbjct: 99  NSLKKLNAESIELDARTKEILGILNECHDELNALPMLKQVEFEMETILQQRSKINSSVLL 158

Query: 150 DYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMAS 192
           DYA KL+KFT+ PPTFDK  IGPNNFIWPAED+LR+GMLA+AS
Sbjct: 159 DYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALRRGMLALAS 201

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  180 bits (456), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 85/161 (52%), Positives = 108/161 (67%)

Query: 32  LQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXXXXXXXX 91
           L    IY D+  +EET+ +L  SVD F PDL + + +IE DK+L +TL            
Sbjct: 22  LSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRYDEIDLR 81

Query: 92  LSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVLDY 151
              LD++    D +   ILETL  C   LN LPMLEQVEFE++ MLKQREK+ + V+LDY
Sbjct: 82  AKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFTNVLLDY 141

Query: 152 AMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMAS 192
           AMKLAKFT  PPTFDK  +GPNNF+WPAED++R+GMLA+AS
Sbjct: 142 AMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIAS 182

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  180 bits (456), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 83/163 (50%), Positives = 116/163 (71%)

Query: 30  EELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXXXXXX 89
           ++L  V +Y+DL RYE  + +L +SVD FKPDL +   +I  D+ L+  +          
Sbjct: 35  DKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDLISADESLFNNVKLLADYDNID 94

Query: 90  XXLSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVL 149
             L ++DK+ + +D+K+R+ILE LN C++ L+ LP LEQVEFE+  +L+QR KI+S  +L
Sbjct: 95  RNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQVEFEKNTILQQRSKINSTALL 154

Query: 150 DYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMAS 192
           DYA KL+KFT+ PPTFDK  +GPNNFIWPAED+LR+GMLAMAS
Sbjct: 155 DYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGMLAMAS 197

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  174 bits (441), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 83/161 (51%), Positives = 110/161 (68%)

Query: 32  LQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXXXXXXXX 91
           L  V IY D+  YE+ + +L  SVD FKP+L++  ++I+ DK L++TL            
Sbjct: 76  LSEVRIYDDIITYEKALSRLIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLH 135

Query: 92  LSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVLDY 151
           L  L+ +   ID  T+  L+TLN C++ LN+LP L Q+EFE   +L QR KI+S ++LDY
Sbjct: 136 LKALETKASKIDELTQSTLQTLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDY 195

Query: 152 AMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMAS 192
           A KL+KFT+ PPTFDK  IGPNNFIWPAEDSLR+GMLAMAS
Sbjct: 196 ATKLSKFTKIPPTFDKGSIGPNNFIWPAEDSLRRGMLAMAS 236

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  172 bits (437), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 117/163 (71%)

Query: 30  EELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXXXXXX 89
           + L +V IY D++ YE+T+ +L  S+D F+PD+ +   +IE DK+LY+ L          
Sbjct: 55  DSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEID 114

Query: 90  XXLSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVL 149
             +S++  + + +D +T+ IL+ LN   N LN LPMLE++ FE+ VM ++++KI+SK++L
Sbjct: 115 TKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIYFERDVMHEKQKKINSKILL 174

Query: 150 DYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMAS 192
           DYA K++KFT+ PPTF+K  IGPNNFIWPAED+LR+GMLA+AS
Sbjct: 175 DYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAVAS 217

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  171 bits (434), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 92/162 (56%), Positives = 116/162 (71%)

Query: 31  ELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXXXXXXX 90
            +Q V +Y+DL ++EE +Q+L  SVD F PDL     +I  D KLY TL           
Sbjct: 21  HVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDI 80

Query: 91  XLSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVLD 150
            L +LD E + ID +T +IL  L+ CYN+LN+LPM+EQVEFE K+M KQ+EKI S V+L+
Sbjct: 81  QLKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIKSGVLLE 140

Query: 151 YAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMAS 192
           YAMKLAKFTR PPTF+K  IGPNNFIWPAED++R+GMLAMAS
Sbjct: 141 YAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMAS 182

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  159 bits (401), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 73/156 (46%), Positives = 108/156 (69%), Gaps = 3/156 (1%)

Query: 37  IYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLXXXXXXXXXXXXLSRLD 96
           +Y DL RYEE + +L +SVD F+PDLS   +++E D+ L ++L            L RLD
Sbjct: 4   VYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRLD 63

Query: 97  KEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKVVLDYAMKLA 156
           +E + ++  T   LETL+ CY +L+ LPMLEQV+FEQ+ +L+QR +++S V+L+YA KL+
Sbjct: 64  RESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKLS 123

Query: 157 KFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMAS 192
           KFT+ P       +GPNNF+WPAED+LR+G LA+A+
Sbjct: 124 KFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAA 156

>CAGL0I08877g Chr9 complement(862629..863663) [1035 bp, 344 aa] {ON}
           similar to uniprot|P53292 Saccharomyces cerevisiae
           YGR165w
          Length = 344

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 16  LPFSAQDKTQEQVSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKK 74
            P +   KT   VSEEL++  IY D+E    + QQ+S +     P +  I K+++ +KK
Sbjct: 136 FPSNPHCKTNYMVSEELKAQ-IYNDIETNGLSTQQVSHNYGLKIPRVEAIVKLMKVEKK 193

>TPHA0M01050 Chr13 complement(205757..208390) [2634 bp, 877 aa] {ON}
           Anc_3.265 YBR055C
          Length = 877

 Score = 30.4 bits (67), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 28  VSEELQSVGIYQDLERYEETIQQLSKSVDT--FKPDLSL 64
           V  +LQ   IY+DL +YEE  +QL   +++  F+P LS+
Sbjct: 646 VKLKLQRSQIYRDLGQYEEACKQLKLDIESLPFEPKLSI 684

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,774,802
Number of extensions: 913652
Number of successful extensions: 3990
Number of sequences better than 10.0: 56
Number of HSP's gapped: 4080
Number of HSP's successfully gapped: 56
Length of query: 285
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 177
Effective length of database: 41,097,471
Effective search space: 7274252367
Effective search space used: 7274252367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)