Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19690g8.286ON32430614550.0
KAFR0B053708.286ON3293065742e-71
KLTH0G13112g8.286ON3493295669e-70
Kwal_56.236978.286ON3383145543e-68
SAKL0H16434g8.286ON5552735601e-66
NDAI0J010008.286ON3393145397e-66
Ecym_42828.286ON3403205362e-65
CAGL0B01991g8.286ON3303135273e-64
NCAS0B035908.286ON3293075247e-64
Skud_4.3878.286ON3363175143e-62
TPHA0C010708.286ON3333115118e-62
KNAG0H031108.286ON3313015082e-61
AGR065W8.286ON3263045082e-61
Kpol_1033.168.286ON3213005038e-61
ZYRO0D06600g8.286ON3303075012e-60
TDEL0F041308.286ON3283094987e-60
Suva_2.2898.286ON3353164952e-59
TBLA0D040408.286ON3293094925e-59
YDR126W (SWF1)8.286ON3363174822e-57
Smik_4.3728.286ON3353164743e-56
NCAS0C029208.389ON374511992e-16
KAFR0H019808.389ON361511963e-16
NDAI0G022508.389ON389501955e-16
CAGL0G08217g8.389ON326511945e-16
Smik_12.3068.389ON359501841e-14
KLTH0F08668g8.389ON358521841e-14
SAKL0H13860g8.389ON352501831e-14
TBLA0H009208.389ON360501832e-14
KNAG0A027108.389ON354521812e-14
Skud_12.3218.389ON356501813e-14
ZYRO0C04092g8.389ON366501787e-14
KLLA0D18370g8.389ON355511761e-13
Suva_10.3428.389ON356501761e-13
Kwal_23.33028.389ON353511742e-13
YLR246W (ERF2)8.389ON359501724e-13
TDEL0F051308.389ON359511717e-13
TPHA0C023608.389ON404501708e-13
AGL125C8.389ON3671081654e-12
TBLA0H001503.12ON345791628e-12
Kwal_56.224596.28ON383991592e-11
Ecym_41788.389ON368501565e-11
Smik_15.1676.28ON378631566e-11
KNAG0K025703.12ON328751549e-11
KAFR0A051306.28ON396481522e-10
Kpol_1014.293.12ON326731512e-10
TPHA0P015603.12ON331521503e-10
Skud_15.1596.28ON379631503e-10
YOL003C (PFA4)6.28ON378641485e-10
ADL197C3.12ON390761477e-10
ZYRO0C07546g6.28ON377661478e-10
CAGL0E02497g6.28ON376481469e-10
KNAG0F029306.28ON386491461e-09
NDAI0C026506.28ON389491461e-09
NCAS0E013003.12ON327751451e-09
SAKL0E01518g6.28ON3791321451e-09
TDEL0A003103.12ON329501441e-09
Suva_15.1726.28ON398661452e-09
KAFR0A085903.12ON331751432e-09
Kpol_1037.236.28ON378481432e-09
TPHA0J003906.28ON380491423e-09
NCAS0D021406.28ON376481414e-09
NDAI0G013403.12ON335501405e-09
TDEL0G044106.28ON381491397e-09
KLTH0C10978g6.28ON3771331398e-09
KLLA0C06204g6.28ON377591381e-08
KLTH0F19580g3.12ON342491371e-08
SAKL0C13596g3.12ON333501361e-08
ZYRO0C03410g3.12ON327771362e-08
Ecym_20143.12ON339751362e-08
Ecym_30326.28ON3771321362e-08
TBLA0B004806.28ON377401352e-08
CAGL0D02508g3.12ON332501334e-08
Kwal_55.221263.12ON360491317e-08
KLLA0E02069g3.12ON325481317e-08
Ecym_41145.579ON372801282e-07
Skud_14.153.12ON336501272e-07
YNL326C (PFA3)3.12ON336501272e-07
Suva_14.153.12ON330501263e-07
Smik_14.63.12ON334771263e-07
Kpol_1004.575.579ON362491255e-07
TDEL0A044405.579ON365771238e-07
KAFR0I011105.579ON3701621211e-06
CAGL0K06347g5.579ON352481192e-06
KLTH0G04972g5.579ON367471183e-06
TBLA0E028305.579ON386981159e-06
YDR459C (PFA5)5.579ON374471131e-05
Smik_4.7375.579ON378471131e-05
SAKL0G06160g5.579ON364471122e-05
Kwal_47.183665.579ON356771122e-05
ACL003C6.28ON375371103e-05
Suva_2.6345.579ON388481085e-05
Skud_4.7345.579ON380481077e-05
KLLA0D06149g5.579ON349471078e-05
ABR203W5.579ON359491023e-04
NCAS0F013905.579ON37448998e-04
KNAG0C028305.579ON35449980.001
ZYRO0D13860g5.579ON36547890.013
NDAI0H018905.579ON40649880.016
SAKL0C05918g1.199ON87545850.054
Smik_4.5155.626ON76456800.22
KAFR0C03660singletonON84743770.47
SAKL0D14542gna 1ON94634770.48
YDR264C (AKR1)5.626ON76443760.61
NDAI0H008505.626ON78655750.77
KLTH0E02420g5.626ON73440750.81
NCAS0I002707.17ON94434750.88
Smik_15.2135.626ON74440741.1
TPHA0C003705.626ON75956731.3
CAGL0M08712g5.626ON76356721.7
Skud_4.5275.626ON76454721.8
KLTH0B00352gsingletonON93427712.8
Ecym_13305.626ON73944702.9
TPHA0A037003.339ON1425111703.2
KLLA0E16721g5.626ON75244694.7
TBLA0A04280singletonON89227694.7
KAFR0H005705.626ON75745685.4
Kwal_34.15751na 2ON62834685.8
Ecym_5015na 3ON82725685.9
YOR034C (AKR2)5.626ON74956676.5
Kpol_526.325.626ON77755669.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19690g
         (324 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} simil...   565   0.0  
KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {...   225   2e-71
KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]...   222   9e-70
Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {...   218   3e-68
SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]...   220   1e-66
NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8....   212   7e-66
Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}...   211   2e-65
CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar...   207   3e-64
NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON}     206   7e-64
Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W ...   202   3e-62
TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {O...   201   8e-62
KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON...   200   2e-61
AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic hom...   200   2e-61
Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON} (35544.....   198   8e-61
ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {O...   197   2e-60
TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.28...   196   7e-60
Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W ...   195   2e-59
TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {...   194   5e-59
YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}  SWF1Palmit...   190   2e-57
Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W ...   187   3e-56
NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389     81   2e-16
KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.3...    80   3e-16
NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389     80   5e-16
CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {O...    79   5e-16
Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246...    75   1e-14
KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} simila...    75   1e-14
SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} simi...    75   1e-14
TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.3...    75   2e-14
KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.3...    74   2e-14
Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246...    74   3e-14
ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {...    73   7e-14
KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]...    72   1e-13
Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246...    72   1e-13
Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W...    72   2e-13
YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subun...    71   4e-13
TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {O...    70   7e-13
TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.3...    70   8e-13
AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON} S...    68   4e-12
TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}...    67   8e-12
Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003...    66   2e-11
Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar t...    65   5e-11
Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {...    65   6e-11
KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.1...    64   9e-11
KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa] ...    63   2e-10
Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON} (48992.....    63   2e-10
TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.1...    62   3e-10
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...    62   3e-10
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...    62   5e-10
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    61   7e-10
ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {...    61   8e-10
CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {...    61   9e-10
KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {O...    61   1e-09
NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28      61   1e-09
NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON...    60   1e-09
SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} simila...    60   1e-09
TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON} ...    60   1e-09
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...    60   2e-09
KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3....    60   2e-09
Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {O...    60   2e-09
TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28...    59   3e-09
NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {O...    59   4e-09
NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12      59   5e-09
TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {O...    58   7e-09
KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {...    58   8e-09
KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {...    58   1e-08
KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} simi...    57   1e-08
SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} simi...    57   1e-08
ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar...    57   2e-08
Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON} s...    57   2e-08
Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to ...    57   2e-08
TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28 ...    57   2e-08
CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar...    56   4e-08
Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL3...    55   7e-08
KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {O...    55   7e-08
Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}...    54   2e-07
Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}...    54   2e-07
YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}  P...    54   2e-07
Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON} ...    53   3e-07
Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON} ...    53   3e-07
Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa] ...    53   5e-07
TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {O...    52   8e-07
KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.5...    51   1e-06
CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa] ...    50   2e-06
KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {...    50   3e-06
TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.5...    49   9e-06
YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}...    48   1e-05
Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {...    48   1e-05
SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {...    48   2e-05
Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459...    48   2e-05
ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON} S...    47   3e-05
Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {...    46   5e-05
Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {...    46   7e-05
KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} simila...    46   8e-05
ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic ho...    44   3e-04
NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {O...    43   8e-04
KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {O...    42   0.001
ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]...    39   0.013
NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {O...    39   0.016
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    37   0.054
Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON...    35   0.22 
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    34   0.47 
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    34   0.48 
YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}  ...    34   0.61 
NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.6...    33   0.77 
KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {...    33   0.81 
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    33   0.88 
Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {...    33   1.1  
TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626...    33   1.3  
CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} simil...    32   1.7  
Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON...    32   1.8  
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    32   2.8  
Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar t...    32   2.9  
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    32   3.2  
KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} simi...    31   4.7  
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    31   4.7  
KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.6...    31   5.4  
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    31   5.8  
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    31   5.9  
YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON} ...    30   6.5  
Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}...    30   9.8  

>KLLA0F19690g Chr6 (1820355..1821329) [975 bp, 324 aa] {ON} similar
           to uniprot|Q04629 Saccharomyces cerevisiae YDR126W SWF1
           Spore Wall Formation
          Length = 324

 Score =  565 bits (1455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/306 (89%), Positives = 273/306 (89%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP
Sbjct: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78

Query: 79  YLYSLEKAFIPITIAFTSLTGVASVFVKPLGLQAGPQFQPDYIIFHPSAVCQTCKTIKVP 138
           YLYSLEKAFIPITIAFTSLTGVASVFVKPLGLQAGPQFQPDYIIFHPSAVCQTCKTIKVP
Sbjct: 79  YLYSLEKAFIPITIAFTSLTGVASVFVKPLGLQAGPQFQPDYIIFHPSAVCQTCKTIKVP 138

Query: 139 RSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXXXXXFRITX 198
           RSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNC             FRIT 
Sbjct: 139 RSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCLLLTYASLRLLTLFRITA 198

Query: 199 XXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNGNLVKDM 258
                              IAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNGNLVKDM
Sbjct: 199 FKKDKFFLSLFLLTTAFSLIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNGNLVKDM 258

Query: 259 DGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEIINLYDRGSFLDNLKE 318
           DGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEIINLYDRGSFLDNLKE
Sbjct: 259 DGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEIINLYDRGSFLDNLKE 318

Query: 319 RIHLLD 324
           RIHLLD
Sbjct: 319 RIHLLD 324

>KAFR0B05370 Chr2 complement(1105534..1106523) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  225 bits (574), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 126/306 (41%), Positives = 171/306 (55%), Gaps = 7/306 (2%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SP  K+  LF +YYQ I+ P   D  +Y+WKY LVP FY  +  + V L++ KLN  +  
Sbjct: 21  SPTLKEFWLFSFYYQRIFVPFLKDDRKYKWKYHLVPIFYVTLYTYMVLLYFTKLNPIIKS 80

Query: 79  YLYSLEK-AFIPITIAFTSLTGVASVFVKP---LGLQAGP--QFQPDYIIFHPSAVCQTC 132
            L  LE+   IP ++  + L+G+ ++ ++P   LG  + P   F+ D +IF+P+  C TC
Sbjct: 81  QLTILERWVIIPFSLLISLLSGILTMRIRPESSLGFNSSPYQDFEFDSLIFYPNTFCSTC 140

Query: 133 KTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXXXX 192
           +  K  RSKHC IC RC+ L DHHCIW NNC+G GNY+YFY+FL+SN             
Sbjct: 141 RLEKPARSKHCNICNRCVLLSDHHCIWANNCIGLGNYQYFYTFLVSNTLLLGYAFLRIIL 200

Query: 193 XFRITXXXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNG 252
               +                    I +VFTY Q  LV DGMT NE+DKW+ +QE+MR G
Sbjct: 201 LTAYSDIGFPNIVLTFLILSGAFFAILLVFTYLQFALVYDGMTTNEKDKWFTIQEFMREG 260

Query: 253 NLVKDMDGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEIINLYDRGSF 312
            L++  +G          A  A   FYSTN YDH+ Y  +N   I  H+EI N+YD+GSF
Sbjct: 261 RLIRTDNGQWLIAHPEEPAGQATR-FYSTNAYDHTIYCPVNFRPITHHDEIPNIYDKGSF 319

Query: 313 LDNLKE 318
           L NLKE
Sbjct: 320 LKNLKE 325

>KLTH0G13112g Chr7 complement(1129318..1130367) [1050 bp, 349 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 349

 Score =  222 bits (566), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 114/329 (34%), Positives = 170/329 (51%), Gaps = 30/329 (9%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SP F+   +FRWYY  +++P+F D  R+RWK+  +P FY  I  +C  LF+  +   +  
Sbjct: 21  SPLFRTKPVFRWYYTRVFHPIFEDVNRFRWKFRAIPAFYLSIYAYCTFLFFKDIEGLIRS 80

Query: 79  YLYSLEKAFI-PITIAFTSLTGVASVFVKPLGLQAGPQFQP-DYIIFHPSAVCQTCKTIK 136
            L+ +E+  I P+ ++   +TG+ ++++KP    A P     D +IFH    C+TCK  K
Sbjct: 81  RLFGVERLLIIPVALSAPIITGLLTIWIKPKSTYASPMLDAYDELIFHSGVSCRTCKLPK 140

Query: 137 VPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXXXXXFRI 196
             R+KHCPIC++C+ L DHHC+W NNC+G GNY+YFY FL+SN               R 
Sbjct: 141 FARTKHCPICDQCVQLADHHCVWANNCIGRGNYQYFYLFLVSNVFLTNYGFLRLLFLQRF 200

Query: 197 TXXXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNGNLVK 256
                                I  VF+Y+Q  LV DGMT NE++KW ++ + +R   +V 
Sbjct: 201 V---HSRQLLILSILLGCFGVILAVFSYFQFVLVRDGMTTNEENKWLVIHDMIRARQMVT 257

Query: 257 DMDGVLYYRSMST-DAQTAEP------------------------IFYSTNLYDHSKYHL 291
           D  G  Y+R ++     +AE                         ++YSTN YD++ Y +
Sbjct: 258 DDTGKYYFRLLADCQEDSAESLTNPRHSSQGPNEFHLNDSSPDIYVYYSTNPYDNATYDV 317

Query: 292 INPAKILSHEEIINLYDRGSFLDNLKERI 320
            NP +ILS   I N+YD G F  NL  R+
Sbjct: 318 KNPKEILSTAAITNIYDEGGFWKNLMARV 346

>Kwal_56.23697 s56 complement(665965..666981) [1017 bp, 338 aa] {ON}
           YDR126W (PSL10) - Hypothetical ORF [contig 174] FULL
          Length = 338

 Score =  218 bits (554), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 118/314 (37%), Positives = 171/314 (54%), Gaps = 22/314 (7%)

Query: 27  LFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNPYLYSLEKA 86
           +F+WYY++++YP+F D  ++R+K+ +VP  Y  I ++C  LF+  +   ++  LY++E+ 
Sbjct: 27  VFKWYYRNVFYPIFEDADKFRFKFHVVPILYLAIYLYCCLLFFRDIEGLIHSRLYAIERW 86

Query: 87  FI-PITIAFTSLTGVASVFVKPLGLQAGPQF-QPDYIIFHPSAVCQTCKTIKVPRSKHCP 144
           FI P+ +      G+ ++ VKP      P   Q D I+FH    C+TCK  K  RSKHC 
Sbjct: 87  FIIPVALMTPISCGLLTMLVKPESTYIAPPVDQFDGILFHAGVECRTCKMPKYARSKHCA 146

Query: 145 ICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXXXXXFRITXXXXXXX 204
           IC RC  L DHHC+W NNC+G GNYEYFY FL SN                +        
Sbjct: 147 ICGRCTQLADHHCVWANNCIGKGNYEYFYLFLASN---VFLTVYGFTRLLYLQPTVKSRT 203

Query: 205 XXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNGNLVKDMDGVLYY 264
                        I ++F+Y+Q+ L+ DGMT NE+ KW +V + MR   LV D  G  YY
Sbjct: 204 LLTLALLLGSFALILVIFSYFQVVLIKDGMTTNEESKWLVVHDMMRARKLVVDNAGKFYY 263

Query: 265 R------SMSTDAQTAEP-----------IFYSTNLYDHSKYHLINPAKILSHEEIINLY 307
           R      S+S + ++ E             FYSTN YD+  Y +  P +I+ +EEI N+Y
Sbjct: 264 RIPENEDSLSPELKSNEGPELTTTSPSRYTFYSTNPYDNCTYTVKYPREIVDYEEITNIY 323

Query: 308 DRGSFLDNLKERIH 321
           D+GSF +NLK+RI 
Sbjct: 324 DKGSFCNNLKDRIR 337

>SAKL0H16434g Chr8 complement(1447419..1449086) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 555

 Score =  220 bits (560), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 121/273 (44%), Positives = 152/273 (55%), Gaps = 9/273 (3%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SP FK ++ F WYY HI++PLF D  RYRWKY +VP FY  I I+CV +FY  L   ++P
Sbjct: 19  SPLFKSVVPFHWYYAHIFHPLFKDTLRYRWKYNVVPLFYTSIYIYCVLMFYKDLYRDLSP 78

Query: 79  YLYSLEKAFI-PITIAFTSLTGVASVFVKPLGLQ--AGPQFQPDYIIFHPSAVCQTCKTI 135
           YL  LE+  I P+ +    +TG   + ++P   +  A  +   D IIFHP  +CQTC  I
Sbjct: 79  YLLFLERFLIVPLLLLGPIITGYLCMTIEPDSTKSLADCRVPFDEIIFHPGTICQTCHKI 138

Query: 136 KVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXX--XXXXXXX 193
           K  RSKHC IC +CI + DHHCIW+NNC+G GNY+YFY FLLSN                
Sbjct: 139 KPARSKHCSICNKCILMVDHHCIWVNNCIGKGNYKYFYGFLLSNVTLLSYSFLRLTSIQL 198

Query: 194 FRITXXXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNGN 253
              T                    I  VF Y Q  LV+DGMT NEQDKW+ VQE+MR+GN
Sbjct: 199 MSQTENIKTKPMLVLTILTGCFDIIVAVFGYTQFNLVHDGMTTNEQDKWFTVQEFMRDGN 258

Query: 254 LVKDMDGVLYYR----SMSTDAQTAEPIFYSTN 282
           LV+D  G  Y+R    S S   Q  E   Y +N
Sbjct: 259 LVRDKKGHYYFRILDESSSDRDQKEEEDSYRSN 291

 Score = 38.5 bits (88), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 2/76 (2%)

Query: 245 VQEYMRNGNLVKDMDGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEII 304
           V    R  +L KD+ G     S  +  +     FYSTN YD   YH+ +   I   +++ 
Sbjct: 480 VNALGRELDLAKDIGGGFPGHSNVSPKKNYR--FYSTNPYDDLTYHVEDYDVIKDPKDLN 537

Query: 305 NLYDRGSFLDNLKERI 320
           N+YD+G+F  NL +RI
Sbjct: 538 NIYDKGNFWANLWDRI 553

>NDAI0J01000 Chr10 (229188..230207) [1020 bp, 339 aa] {ON} Anc_8.286
           YDR126W
          Length = 339

 Score =  212 bits (539), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 119/314 (37%), Positives = 166/314 (52%), Gaps = 14/314 (4%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SP++K+   F  YY+H++ P+  D  RYRWKY LVP FY  + I+  + +Y K+   +  
Sbjct: 21  SPRYKNRSPFSIYYRHVFQPIVQDSHRYRWKYHLVPFFYLTLFIYLTYCYYTKVEPLIAS 80

Query: 79  YLYSLEK-AFIPITIAFTSLTGVASVFVKPLGLQAGPQFQP-------DYIIFHPSAVCQ 130
            LY +E   +IP  I    + G+ ++   P  +      +        D I+++P+  C+
Sbjct: 81  QLYFIEVWIWIPFMIFSPVIFGILTMVTIPNTVNNRRNQEKVLYRYPYDEIMYYPNIECR 140

Query: 131 TCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXX 190
           TC  +K  RSKHC IC  CI L DHHC+W+NNC+G GNY YFYSFLL NC          
Sbjct: 141 TCGIVKPARSKHCEICNSCILLCDHHCLWVNNCIGEGNYLYFYSFLLCNCITMTYSFIRL 200

Query: 191 XXXFRITXXXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMR 250
              +                       I   FT+ QL+LV DGMT NEQDKW+ +QEYMR
Sbjct: 201 FLMYCQGHAPSSRNILTLLILCGSFAVICAGFTFLQLQLVKDGMTTNEQDKWFTLQEYMR 260

Query: 251 NGNLVKDMDGVLYYRSMSTDAQT----AEPIFYSTNLYDHSKYHLINPAKILSHE--EII 304
           +G L++  D   ++ +   D  T    A+ IFYSTN YDH  YHL +    +  +  +I 
Sbjct: 261 DGKLIRTKDENKWFIANPNDDATITINADTIFYSTNAYDHEGYHLSSDEYTIVEDPRQIT 320

Query: 305 NLYDRGSFLDNLKE 318
           NLYD G F  NLK+
Sbjct: 321 NLYDSGDFFTNLKD 334

>Ecym_4282 Chr4 complement(608898..609920) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii AGR065W
          Length = 340

 Score =  211 bits (536), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 123/320 (38%), Positives = 165/320 (51%), Gaps = 16/320 (5%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SP FK    FRWYY  ++ PLF     Y+WKYWLVP FY  I I+C  +FY  +   +  
Sbjct: 21  SPLFKSWQPFRWYYAAVFRPLFRQEEEYKWKYWLVPAFYTGIYIYCSFVFYVHVYGEIRS 80

Query: 79  YLYSLEKAFIPITIAFTSLTGVASVFVKPLGL--QAGPQFQPDYIIFHPSAVCQTCKTIK 136
            LY+LE   +P+ +A   L+G  ++   P       GP+   D IIFH + VC++C+  K
Sbjct: 81  GLYTLEARCLPVVLALPLLSGYYTIVTSPHDTITYVGPEIPFDGIIFHDNIVCRSCRLKK 140

Query: 137 VPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXXXXXFRI 196
             RSKHC IC RCI + DHHC+W+NNC+G GNY+YFY FLLSNC                
Sbjct: 141 AARSKHCSICGRCILVADHHCVWLNNCIGLGNYQYFYLFLLSNCSMLSYATIRLSSVAPS 200

Query: 197 TXXXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNGNLVK 256
                                I+I FTY Q  LV DGMT NE+DKWY + + MRN  L+K
Sbjct: 201 GLWRSNKSFLSLMILVCCFAVISISFTYMQFALVRDGMTTNEKDKWYTIHKLMRNEQLLK 260

Query: 257 DMDGVLYYRSMSTDAQTAEPI------------FYSTNLYDHSKYHLINPA--KILSHEE 302
             +   +Y  +      +               +YSTN YD   Y L + +   + S+++
Sbjct: 261 LNNDCKFYIRIKNSPTPSSHTSTSTRTTHYQYEYYSTNPYDPKTYSLSDTSYHVVNSYQD 320

Query: 303 IINLYDRGSFLDNLKERIHL 322
           I N+YDR SF  NLK+R  L
Sbjct: 321 IPNIYDRCSFWQNLKQRCVL 340

>CAGL0B01991g Chr2 (182894..183886) [993 bp, 330 aa] {ON} similar to
           uniprot|Q04629 Saccharomyces cerevisiae YDR126w
          Length = 330

 Score =  207 bits (527), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 114/313 (36%), Positives = 171/313 (54%), Gaps = 16/313 (5%)

Query: 20  PKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNPY 79
           P+F+D  +FRWYY  +Y P+  D +RYR K+++VP FY  +  + V++FY++    ++P 
Sbjct: 21  PQFRDKFIFRWYYDEVYKPMILDNSRYRIKFYVVPVFYLSVYSYMVYIFYSRTFAIISPM 80

Query: 80  LYSLEK-AFIPITIAFTSLTGVASVFVKPLGLQA-----GPQFQPDYIIFHPSAVCQTCK 133
           L S+E    IP+ +      G  S+ +KP    A       ++  D +++ P   C+TCK
Sbjct: 81  LTSIETYVVIPLMLILPLFFGSMSMIIKPDSSNAHQIGSEKRYPYDNLLYFPQHECRTCK 140

Query: 134 TIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXX--- 190
            +K  RSKHC +C  CI L DHHC+WINNCVG GNY YFYSFL SN              
Sbjct: 141 QVKPARSKHCTVCNSCIYLADHHCVWINNCVGMGNYMYFYSFLCSNLLLLSYSFIRLIFI 200

Query: 191 ---XXXFRITXXXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQE 247
                 +  T                    +A V+ Y+  +LVN GMT NE+DKW +V +
Sbjct: 201 QFNKSAYNTTPTGEKSLLILSILCGSFTVILA-VYCYFVFELVNSGMTTNEKDKWQMVHD 259

Query: 248 YMRNGNLVKDMDGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEIINLY 307
           Y+  G+LV+D +G  Y+          E  FYST+ YD ++Y +++   + S  EI N+Y
Sbjct: 260 YINTGDLVRDPEGK-YFIKYQNGGNNYE--FYSTDSYDGTQYTIVDYFTVKSPAEITNIY 316

Query: 308 DRGSFLDNLKERI 320
           D+G+F++NL+E I
Sbjct: 317 DKGNFINNLREFI 329

>NCAS0B03590 Chr2 complement(636400..637389) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  206 bits (524), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 111/307 (36%), Positives = 174/307 (56%), Gaps = 7/307 (2%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SP+++ +  F  YY+ +++PL  D  +++ K++++P FY  + ++ ++ +Y+K+   +N 
Sbjct: 20  SPRYRLIWPFSVYYKKVFHPLIQDNKKFKIKFYIIPIFYFVLYLYLIYCYYSKVAPFINN 79

Query: 79  YLYSLEK-AFIPITIAFTSLT-GVASVFVKPL-----GLQAGPQFQPDYIIFHPSAVCQT 131
            L++ EK  +IP+ I  + L  GV ++F KP        +   ++  D +IF+P  +C+T
Sbjct: 80  QLWAFEKYMWIPLIIIASPLIFGVFTMFTKPTYTKKYSDEIDNEYAFDNLIFYPQILCRT 139

Query: 132 CKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXXX 191
           C++ K  RSKHC IC+RC+ + DHHCIW+NNCVG GNY YFY FL++N            
Sbjct: 140 CQSYKPARSKHCSICDRCVLVADHHCIWVNNCVGKGNYTYFYMFLITNTFSLTYAFIRLL 199

Query: 192 XXFRITXXXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRN 251
             F  T                    I  +FT+ QL L  +GMT NE+DKW+ V E+MR+
Sbjct: 200 TIFYTTNVYLPKNTLTLTILCGCFSVICGIFTFLQLNLAQEGMTTNEKDKWFTVHEFMRD 259

Query: 252 GNLVKDMDGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEIINLYDRGS 311
           G LV+   G  Y+        + + +FYSTN YDH++Y L N   I     I N+YDRG 
Sbjct: 260 GKLVRTQSGRWYFADPHDSDISEDSVFYSTNGYDHTEYTLRNFEIIEDPSRITNIYDRGD 319

Query: 312 FLDNLKE 318
           FL NL++
Sbjct: 320 FLANLRD 326

>Skud_4.387 Chr4 (675002..676012) [1011 bp, 336 aa] {ON} YDR126W
           (REAL)
          Length = 336

 Score =  202 bits (514), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 113/317 (35%), Positives = 163/317 (51%), Gaps = 14/317 (4%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SP FK    F   Y+ ++ P  +D  +YRWK+ LVP FY  I ++ V+ ++ K+   +  
Sbjct: 20  SPVFKSTWPFSTLYRRVFQPFVSDDQKYRWKFHLVPLFYTSIYLYLVYTYHAKVEPLIKN 79

Query: 79  YLYSLEKAFIPITIAFTSLT-GVASVFVKPLGLQ-----AGPQFQPDYIIFHPSAVCQTC 132
            L+ LE+  I   I    +  G+ ++  K          +  ++  DY+I++P   C TC
Sbjct: 80  DLFLLERILIGPIIILPPVALGILAMVTKAEDSNVHRPGSTEKYPYDYLIYYPDVQCSTC 139

Query: 133 KTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXXXX 192
           +  K  RS+HC IC RCI + DHHCIW+NNC+G GNY  FY FL+SN             
Sbjct: 140 RITKPARSRHCSICNRCILVADHHCIWVNNCIGKGNYIQFYLFLISNIVSMSYAFLRLCS 199

Query: 193 XFRITXXXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNG 252
               +                    I  +FTY QL +V +GMT NEQDKWY +QEYMR G
Sbjct: 200 ISLKSSTALPRAVLTLSILCGCFTIICAIFTYLQLAIVREGMTTNEQDKWYTIQEYMREG 259

Query: 253 NLVKDM--DGVLYYRSMSTDAQTAEPI------FYSTNLYDHSKYHLINPAKILSHEEII 304
            LV+ +  D   ++  ++     AEP+      FYSTN YDH +Y L++   I    EI 
Sbjct: 260 KLVRSLNDDPQSWFLKLTEKGDAAEPLQDQQGTFYSTNAYDHKRYILMHYITIKDASEIT 319

Query: 305 NLYDRGSFLDNLKERIH 321
           N+YD+G+FL N  + I 
Sbjct: 320 NVYDKGTFLANFTDLIQ 336

>TPHA0C01070 Chr3 complement(244556..245557) [1002 bp, 333 aa] {ON}
           Anc_8.286 YDR126W
          Length = 333

 Score =  201 bits (511), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 120/311 (38%), Positives = 157/311 (50%), Gaps = 13/311 (4%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SP  K+   F  YY+ +Y P   D   Y+WKY +VPGFY  I ++ V+ +Y K+   +  
Sbjct: 19  SPFLKNRWPFSVYYRRLYVPYLKDVNSYKWKYHVVPGFYFSIYLYLVYCYYAKVEYLIVN 78

Query: 79  YLYSLEKA-FIPITIAFTSLTGVASVFVKPLGLQAGP---------QFQPDYIIFHPSAV 128
           +L   E+   +P+ I  T   G+ ++  KP+ +             +F  D II+H   V
Sbjct: 79  HLNLFERGILLPLLIVLTPSFGILTMVTKPINIHGNGISQHDKLKNKFPFDNIIYHSGNV 138

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXX-XXX 187
           C TC   K  RSKHC IC  CI L DHHCIW+NNC+G GNY+YF+ FLL N         
Sbjct: 139 CSTCNIEKPARSKHCNICGTCILLQDHHCIWVNNCIGLGNYKYFFMFLLLNTISLSYAFL 198

Query: 188 XXXXXXFRITXXXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQE 247
                                         I  VF Y Q+K VN+GMT NE DKWY VQE
Sbjct: 199 RLLHITLSKPDVPKSKNILALCILTGSFSVICGVFFYLQMKQVNNGMTTNETDKWYAVQE 258

Query: 248 YMRNGNLVKDMDGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSH-EEIINL 306
            MR G L+K  D   +  S + DA  +    YSTN YD+  Y + N   I+    EI N+
Sbjct: 259 LMREGKLIKSEDNNWFALS-TEDAPDSPSQVYSTNFYDNKTYKISNDYHIVKDASEIPNV 317

Query: 307 YDRGSFLDNLK 317
           YDRG+FLDNLK
Sbjct: 318 YDRGTFLDNLK 328

>KNAG0H03110 Chr8 complement(584877..585872) [996 bp, 331 aa] {ON}
           Anc_8.286 YDR126W
          Length = 331

 Score =  200 bits (508), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/301 (36%), Positives = 162/301 (53%), Gaps = 15/301 (4%)

Query: 30  WYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNPYLYSLEKAFI- 88
           WYY+ +Y P   D TRYR KY++VP FY  +  + ++L+ ++L   +   LY +E  F  
Sbjct: 31  WYYEKVYRPFLADPTRYRVKYYIVPVFYFSLYCYMLNLYRSELLPVIWGRLYFIELYFFQ 90

Query: 89  PITIAFTSLTGVASVFVKPLGLQ--------AGPQFQPDYIIFHPSAVCQTCKTIKVPRS 140
           P+ +A   ++G+ ++F +P G          +  Q+  D I+++P+  C++C T+K  RS
Sbjct: 91  PLLLAAIPVSGLLTMFTRPEGCGGRDQGVAPSEGQWPYDGILYYPNTTCRSCHTVKWARS 150

Query: 141 KHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXXXXXFRITXXX 200
           KHC IC RCI L DHHCIW N C+G GN+ YFY FL  +C               +    
Sbjct: 151 KHCSICRRCIQLADHHCIWFNTCIGRGNFFYFYVFLACHCLILTYAFARLFFFVVVADNK 210

Query: 201 XXXXXXXXXXXXXXXXXIAIV--FTYYQLKLVNDGMTNNEQDKWYLVQEYMRNGNLVK-D 257
                              +V  FTY+Q+ LV +GMT NEQDKW+L+ EYMR+G  V   
Sbjct: 211 LTSTRSTLTLLMLTGTFALLVDLFTYWQMMLVKEGMTTNEQDKWFLIHEYMRDGKCVNVS 270

Query: 258 MDGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEIINLYDRGSFLDNLK 317
            +G      + +D       FYSTN YDH+ Y L N   + +  EIIN+YD+GSF +N K
Sbjct: 271 CNGSTKKWFLESDEDGK---FYSTNAYDHTAYTLTNYHIVKNASEIINMYDKGSFWENFK 327

Query: 318 E 318
           +
Sbjct: 328 D 328

>AGR065W Chr7 (835871..836851) [981 bp, 326 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR126W (SWF1)
          Length = 326

 Score =  200 bits (508), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 114/304 (37%), Positives = 154/304 (50%), Gaps = 12/304 (3%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           +P  +    F WYY  ++  +  D  R+RWKYW  P FYA +  +CV LFY ++   +  
Sbjct: 19  APALRAYWPFSWYYHVVFRTVLQDTQRHRWKYWATPAFYAGVYAYCVWLFYGEVYAEIAK 78

Query: 79  YLYSLEKAFIPITIAFTSLTGVASVFVKPLGLQAGPQFQPDYIIFHPSAVCQTCKTIKVP 138
            L+  E+  +P  +   +  GVA+                D ++FH    C+TC+  K  
Sbjct: 79  ALWVPERWVLPAAVVAPAAAGVAAAATPAAVPA---DAAYDGLLFHDGVECRTCRVRKPA 135

Query: 139 RSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXXXXXFRITX 198
           RS+HC +C RC+PL DHHC+W+NNCVG GNY  FY  L ++C                  
Sbjct: 136 RSRHCGVCGRCVPLADHHCVWLNNCVGRGNYGLFYLALGAHC--ALLTYGAVRLPLAAPA 193

Query: 199 XXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNGNLVKDM 258
                              + + FT  Q+ LV DGMT NEQDKWY VQE MR G LV+ +
Sbjct: 194 GRWPRALLALELLVASFAVLCVWFTATQVALVRDGMTTNEQDKWYAVQESMREGTLVR-L 252

Query: 259 DGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINP--AKILSHEEIINLYDRGSFLDNL 316
            G  Y+R    D       FYSTN YDH  Y L N   A + SHEEI N+YD GSF +NL
Sbjct: 253 RGRFYHRVEGGDGVE----FYSTNAYDHRTYALHNEPYAVVTSHEEIPNVYDTGSFCENL 308

Query: 317 KERI 320
           ++R+
Sbjct: 309 RQRL 312

>Kpol_1033.16 s1033 (35544..36509) [966 bp, 321 aa] {ON}
           (35544..36509) [966 nt, 322 aa]
          Length = 321

 Score =  198 bits (503), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 114/300 (38%), Positives = 156/300 (52%), Gaps = 15/300 (5%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SP FK       YY   Y P F D  RYRWKY+LVPG Y  + +F +  ++ ++N  VNP
Sbjct: 19  SPIFKLTWPLSIYYTKFYRPFFLDKERYRWKYYLVPGLYLGLYLFVIIYYHLRVNFMVNP 78

Query: 79  YLYSLEKAFIPITIAFTSLT--GVASVFVKPL-----GLQAGPQFQPDYIIFHPSAVCQT 131
           +LY  EK  I + I FTSL   GV ++  KP      G+ +  +++ D I++ P+  C+T
Sbjct: 79  HLYWFEKGLI-LPIMFTSLPYFGVMTMITKPENSIEHGINSNNRYRFDEILYFPNVSCKT 137

Query: 132 CKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXXX 191
           C+  K  RSKHC IC++CI L DHHCIW+NNC+G GNY++FY F+  N            
Sbjct: 138 CRKPKPARSKHCSICDKCILLQDHHCIWVNNCIGMGNYKWFYLFIGGNSLTMIYCFTRLL 197

Query: 192 XXFRITXXXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRN 251
                                     I  VFTY QL LV+ G+T NE DKWY + EY R+
Sbjct: 198 FISIKYKVTSSRAILTMNILCGSFAIICSVFTYLQLDLVSQGITTNEMDKWYTIHEYCRD 257

Query: 252 GNLVKDMDGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEIINLYDRGS 311
           G L +   G  +          +   FYSTN+YDH++Y       I    +I N+YD+GS
Sbjct: 258 GKLARSKSGNWF-------LIDSNNTFYSTNIYDHTRYSPTQYTIINDPTDIQNIYDKGS 310

>ZYRO0D06600g Chr4 complement(573724..574716) [993 bp, 330 aa] {ON}
           similar to uniprot|Q04629 Saccharomyces cerevisiae
           YDR126W SWF1 Spore Wall Formation
          Length = 330

 Score =  197 bits (501), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 161/307 (52%), Gaps = 8/307 (2%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SP FK    F  YY++++ PLF D  R+RWK++LVP FY+ I +  VHL    +   ++P
Sbjct: 19  SPLFKYQWPFSLYYKYVFLPLFQDNDRFRWKFYLVPLFYSSIYLGVVHLAIKNVIPQLSP 78

Query: 79  YLYSLEK-AFIPITIAFTSLTGVASVFVKPLGLQAGP-----QFQPDYIIFHPSAVCQTC 132
            L   +   FIP  I  T  TG+ +  + P   ++       +F+ D ++F+P+  C+TC
Sbjct: 79  GLNFFDYWFFIPFFIVLTPATGILAAIIGPETTKSCKRRNIDKFRYDNLLFYPNINCRTC 138

Query: 133 KTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXXXX 192
           +  K  RSKHC +C +C+   DHHCIWINNCVG GNY YFY FL+ N             
Sbjct: 139 QLPKPARSKHCNVCNQCVLAVDHHCIWINNCVGLGNYLYFYLFLVLNSLSMSYAFIRSMS 198

Query: 193 XFRIT-XXXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRN 251
              +                      I IVFTY QL +V +GMT NE+DKW+ + EYMR 
Sbjct: 199 IVGLKPNIKYPRSILAFNLLTGCFALICIVFTYLQLCMVREGMTTNEKDKWFTIHEYMRE 258

Query: 252 GNLVKDMDGVLYYR-SMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEIINLYDRG 310
             LVK   G  YY  +   D  T +  F+STN YD   Y L +   I   E I N+YD G
Sbjct: 259 KRLVKSSSGKWYYDLTDRLDLPTDQHEFFSTNPYDGRLYRLQSYTLIEDAERINNIYDEG 318

Query: 311 SFLDNLK 317
           SF+ NL+
Sbjct: 319 SFMANLR 325

>TDEL0F04130 Chr6 (759451..760437) [987 bp, 328 aa] {ON} Anc_8.286
           YDR126W
          Length = 328

 Score =  196 bits (498), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 110/309 (35%), Positives = 162/309 (52%), Gaps = 14/309 (4%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SP +K    F WYY  I+ PL  +  R+RWK+++VP FY  +  + + +    +   +  
Sbjct: 22  SPFYKVKWPFSWYYTRIFRPLLQEDQRFRWKFYVVPAFYLSLYCYIIFVLIRDVIPVIGN 81

Query: 79  YLYSLEK-AFIPITIAFTSLTGVASVFVKP---LGLQAGP--QFQPDYIIFHPSAVCQTC 132
            L S+EK   IP+ +  T + G  S+ VK     G Q G   ++  DYI+++P+  C+TC
Sbjct: 82  RLLSVEKLCIIPVLVVATPVLGWLSMTVKAKTSRGCQPGSAQEYDYDYILYYPNVQCRTC 141

Query: 133 KTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXXXX 192
              K  RS+HC +C  C+ + DHHC+W+NNC+G GNY++FY+FL+ N             
Sbjct: 142 HIEKPARSRHCNLCRECVLVADHHCVWVNNCIGKGNYQFFYAFLVVNVISLSYGFLRVLW 201

Query: 193 XFRITXXXXXXXXXXXXXXXXXXXXIAI---VFTYYQLKLVNDGMTNNEQDKWYLVQEYM 249
              +                      AI   VFTY QL+LVNDGMT  E+DKWY +Q+ M
Sbjct: 202 ISVMKDPSMVVYPRSILIFTILCGTFAIICGVFTYLQLQLVNDGMTTGEKDKWYTIQQIM 261

Query: 250 RNGNLVKDMDGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEIINLYDR 309
           R GNLV+ +DG  + +      Q     FYSTN YD   Y   N + +   ++I N+YD+
Sbjct: 262 REGNLVRTLDGQFFIQDQQNPNQ-----FYSTNAYDSKLYVPQNYSIVNDPKDITNIYDQ 316

Query: 310 GSFLDNLKE 318
           GSF   L+ 
Sbjct: 317 GSFWYKLER 325

>Suva_2.289 Chr2 (498420..499427) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  195 bits (495), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 116/316 (36%), Positives = 164/316 (51%), Gaps = 14/316 (4%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SP FK    F  +Y+ ++ P  TD  +YRWK+ LVP FY  I ++ V  ++ ++   +  
Sbjct: 20  SPVFKSTWPFSTFYRRVFQPFVTDDHKYRWKFHLVPLFYTSIYLYLVFTYHTRVEPLIKN 79

Query: 79  YLYSLEKAFIPITIAFTSLT-GVASVFVKPLG-----LQAGPQFQPDYIIFHPSAVCQTC 132
            L+ LE+  I   I    +  G+ ++  K        L +  ++  DY++++P   C TC
Sbjct: 80  ELFLLERILIVPIIILPPVVLGILAMVTKAEDSNNHKLGSTEKYPYDYLLYYPGVKCSTC 139

Query: 133 KTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXXXX 192
           +TIK  RSKHC IC RC+ + DHHCIW+NNC+G GNY  FY FL SN             
Sbjct: 140 RTIKAARSKHCSICNRCVLVADHHCIWVNNCIGKGNYLQFYLFLFSNIFSMSYAFLRLYF 199

Query: 193 XFRITXXXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNG 252
               +                    I  +FTY QL +V +GMT NEQDKWY +QEYMR G
Sbjct: 200 ISFNSTAVLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREG 259

Query: 253 NLVK--DMDGVLYYRSMSTDAQTAEPI------FYSTNLYDHSKYHLINPAKILSHEEII 304
            LV+  D D   ++   +    T +P+      FYSTN YDH +Y L +   I    EI 
Sbjct: 260 KLVRSLDDDSRSWFLKFTEKGDTGQPLQDQHVTFYSTNAYDHHRYRLKHYTTIKDASEIT 319

Query: 305 NLYDRGSFLDNLKERI 320
           N+YD+G+FL NL + I
Sbjct: 320 NIYDKGTFLANLVDLI 335

>TBLA0D04040 Chr4 complement(1006179..1007168) [990 bp, 329 aa] {ON}
           Anc_8.286 YDR126W
          Length = 329

 Score =  194 bits (492), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 112/309 (36%), Positives = 158/309 (51%), Gaps = 12/309 (3%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SP FK+      YY++ Y P+  D  +YRWK+ +VP FY  + I+ V  FY K+   ++ 
Sbjct: 21  SPFFKNTPFISIYYKYAYEPVVQDNKKYRWKFHIVPIFYITLFIYLVINFYAKVEPLIHD 80

Query: 79  YLYSLEKAF-IPITIAFTSLTGVASVFVKP-----LGLQAGPQFQPDYIIFHPSAVCQTC 132
            L   E+ F IPI+I  T   G+ ++ + P         +  ++  D I++ P   C+TC
Sbjct: 81  KLTYFERFFFIPISIISTPFFGIITMLINPDTALMYSNDSIKKYAYDRILYFPDTECKTC 140

Query: 133 KTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXX---X 189
           K  K  RSKHC +C++CI ++DHHC+W+NNC+G GN+ YFY FL  N             
Sbjct: 141 KVEKPARSKHCAVCDQCILVNDHHCVWVNNCIGRGNFLYFYLFLFDNTLFMSYASMRLLE 200

Query: 190 XXXXFRITXXXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYM 249
               FR                      I   F+Y QL +V DGMT NE+DKWY +Q  M
Sbjct: 201 ITLNFRRAGENVPRDVMTLDILCGCFLFICGTFSYMQLLIVKDGMTTNEKDKWYTIQCLM 260

Query: 250 RNGNLVKDMDGVLYYRSMSTDAQTAEPIFYSTNLYDHSKYHLINPAKILSHEEIINLYDR 309
            +  LVK  D   Y   ++   +T    FYSTN YDH KY L     I + E+I N+YD+
Sbjct: 261 EDKKLVKSSDNNWYISFVNDQGETE---FYSTNAYDHKKYQLTEYKVIDNVEDIPNIYDK 317

Query: 310 GSFLDNLKE 318
           GS   N K+
Sbjct: 318 GSLWKNFKD 326

>YDR126W Chr4 (703234..704244) [1011 bp, 336 aa] {ON}
           SWF1Palmitoyltransferase that acts on transmembrane
           proteins, including the SNAREs Snc1p, Syn8p, Tlg1p and
           likely all SNAREs; contains an Asp-His-His-Cys-cysteine
           rich (DHHC-CRD) domain; may have a role in vacuole
           fusion
          Length = 336

 Score =  190 bits (482), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 113/317 (35%), Positives = 166/317 (52%), Gaps = 15/317 (4%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SP FK    F  +Y++++ P   D  +YRWK  LVP FY  I ++ V+ ++ ++  T+  
Sbjct: 20  SPVFKSTWPFSTFYRNVFQPFLVDDQKYRWKLHLVPLFYTSIYLYLVYTYHMRVESTIKN 79

Query: 79  YLYSLEKAFIPITIAFTSLT-GVASVFVKPLGLQ-----AGPQFQPDYIIFHPSAVCQTC 132
            L+ LE+  I   I    +  G+ ++  +    +     +  ++  DY++++P+  C TC
Sbjct: 80  ELFLLERILIVPIIILPPVALGILAMVSRAEDSKDHKSGSTEEYPYDYLLYYPAIKCSTC 139

Query: 133 KTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXXXX 192
           + +K  RSKHC IC RC+ + DHHCIWINNC+G GNY  FY FL+SN             
Sbjct: 140 RIVKPARSKHCSICNRCVLVADHHCIWINNCIGKGNYLQFYLFLISNIFSMCYAFLRLWY 199

Query: 193 XFRITXXXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNG 252
               +                    I  +FTY QL +V +GMT NEQDKWY +QEYMR G
Sbjct: 200 ISLNSTSTLPRAVLTLTILCGCFTIICAIFTYLQLAIVKEGMTTNEQDKWYTIQEYMREG 259

Query: 253 NLVKDMDG---VLYYRSMSTDAQTAEPI------FYSTNLYDHSKYHLINPAKILSHEEI 303
            LV+ +D      +++        AEP+      FYSTN YDH  Y+L +   I    EI
Sbjct: 260 KLVRSLDDDCPSWFFKCTEQKDDAAEPLQDQHVTFYSTNAYDHKHYNLTHYITIKDASEI 319

Query: 304 INLYDRGSFLDNLKERI 320
            N+YD+G+FL NL + I
Sbjct: 320 PNIYDKGTFLANLTDLI 336

>Smik_4.372 Chr4 (664437..665444) [1008 bp, 335 aa] {ON} YDR126W
           (REAL)
          Length = 335

 Score =  187 bits (474), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 156/316 (49%), Gaps = 13/316 (4%)

Query: 19  SPKFKDLILFRWYYQHIYYPLFTDYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNP 78
           SP FK    F  +Y++++ P   D  +YRWK+ LVP FY  I ++ V+ ++ ++   V  
Sbjct: 20  SPVFKSTWPFSTFYRNVFQPFIADDQKYRWKFHLVPIFYTLIYLYLVYTYHTRVEWLVRS 79

Query: 79  YLYSLEKAFI-PITIAFTSLTGVASVFVKPLGL---QAGPQFQPDYIIFHPSAV--CQTC 132
            L+  E+  + PI        G+  +  K       + G   +  Y       V  C TC
Sbjct: 80  ELFLCERILVVPIITLAPIACGILVMVTKAEDSYHHKPGSTEKYPYDYLLYYPVVKCSTC 139

Query: 133 KTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNCXXXXXXXXXXXX 192
             IK  RSKHC IC RCI + DHHCIW+NNC+G GNY  FY FL+SN             
Sbjct: 140 HIIKPARSKHCSICNRCILVADHHCIWVNNCIGKGNYLQFYLFLISNIFSLLYAFLRLWC 199

Query: 193 XFRITXXXXXXXXXXXXXXXXXXXXIAIVFTYYQLKLVNDGMTNNEQDKWYLVQEYMRNG 252
               +                    I I+FTY QL +V +GMT NEQDKWY +QEYMR G
Sbjct: 200 ISLNSKTALPRAVLTLTILCGCFTIICIIFTYLQLTIVREGMTTNEQDKWYTIQEYMREG 259

Query: 253 NLVKDMDGVL--YYRSMSTD-----AQTAEPIFYSTNLYDHSKYHLINPAKILSHEEIIN 305
            LV+ ++     ++  ++ D      Q     FYSTN YDH +Y+L +   I    EI N
Sbjct: 260 KLVRSLNDNCQSWFLKLTEDDTTKLTQDQHATFYSTNAYDHKQYNLAHYITIKDASEISN 319

Query: 306 LYDRGSFLDNLKERIH 321
           +YD+G+FL N  + I 
Sbjct: 320 IYDKGTFLANFTDLIQ 335

>NCAS0C02920 Chr3 (549815..550939) [1125 bp, 374 aa] {ON} Anc_8.389
          Length = 374

 Score = 81.3 bits (199), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 39/51 (76%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSN 179
           C+TC+  + PRS HC ICE C+ +HDHHC+W+NNCVG  NY YF +FL S+
Sbjct: 184 CKTCRIWRPPRSSHCSICETCVLMHDHHCVWVNNCVGQRNYRYFLTFLTSS 234

>KAFR0H01980 Chr8 (367846..368931) [1086 bp, 361 aa] {ON} Anc_8.389
           YLR246W
          Length = 361

 Score = 80.1 bits (196), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 31/51 (60%), Positives = 38/51 (74%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSN 179
           C+TC+  + PR+ HC ICE C+  HDHHCIWINNCVG  NY YF +FL+S 
Sbjct: 178 CRTCRIWRPPRASHCSICEACVMTHDHHCIWINNCVGQRNYRYFVTFLISG 228

>NDAI0G02250 Chr7 (503564..504733) [1170 bp, 389 aa] {ON} Anc_8.389
          Length = 389

 Score = 79.7 bits (195), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           C TC+  + PRS HC ICE CI  HDHHCIW+NNC+G  NY +F +FLLS
Sbjct: 217 CTTCRIWRPPRSSHCSICEACIITHDHHCIWVNNCIGQRNYRFFLTFLLS 266

>CAGL0G08217g Chr7 complement(778823..779803) [981 bp, 326 aa] {ON}
           similar to uniprot|Q06551 Saccharomyces cerevisiae
           YLR246w ERF2
          Length = 326

 Score = 79.3 bits (194), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 31/51 (60%), Positives = 38/51 (74%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSN 179
           C TCK  + PR+ HC +CE C+  HDHHCIW+NNCVG  NY YF +FLLS+
Sbjct: 160 CHTCKIWRPPRASHCSVCECCVLTHDHHCIWVNNCVGQRNYRYFLAFLLSS 210

>Smik_12.306 Chr12 (568353..569432) [1080 bp, 359 aa] {ON} YLR246W
           (REAL)
          Length = 359

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           CQ+C+  + PRS HC  C  C+ +HDHHCIW+NNC+G  NY +F  FLLS
Sbjct: 175 CQSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLVFLLS 224

>KLTH0F08668g Chr6 (750644..751720) [1077 bp, 358 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 358

 Score = 75.5 bits (184), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 35/52 (67%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNC 180
           C TC+  + PR+ HC  CE C+  HDHHC W+NNC+G  NY YF +FL S C
Sbjct: 178 CATCRIWRPPRASHCSTCEACVLTHDHHCTWVNNCIGQRNYRYFLTFLASCC 229

>SAKL0H13860g Chr8 (1185970..1187028) [1059 bp, 352 aa] {ON} similar
           to uniprot|Q6B217 Saccharomyces cerevisiae YLR246W ERF2
           Subunit of a palmitoyltransferase composed of Erf2p and
           Shr5p that adds a palmitoyl lipid moiety to Ras2p
           through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 352

 Score = 75.1 bits (183), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 36/50 (72%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           C TC+  + PR+ HC  CE CI  HDHHC W+NNC+G  NY YF++FL+S
Sbjct: 172 CTTCRIWRPPRASHCSTCEACIITHDHHCKWVNNCIGQRNYHYFFTFLVS 221

>TBLA0H00920 Chr8 (203681..204763) [1083 bp, 360 aa] {ON} Anc_8.389
           YLR246W
          Length = 360

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 35/50 (70%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           C TC   + PR+ HC IC+ CI +HDHHCIWINNCVG  NY YF  FL+ 
Sbjct: 190 CSTCHIWRPPRASHCSICQACIDVHDHHCIWINNCVGNRNYRYFIIFLVG 239

>KNAG0A02710 Chr1 (294783..295847) [1065 bp, 354 aa] {ON} Anc_8.389
           YLR246W
          Length = 354

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 34/52 (65%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSNC 180
           C  CK  + PR+ HC IC+ C+   DHHC WINNCVG  NY YF +FL + C
Sbjct: 186 CTACKIWRPPRASHCRICQVCVQTQDHHCAWINNCVGQRNYRYFLTFLTATC 237

>Skud_12.321 Chr12 (571368..572438) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 74.3 bits (181), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 36/50 (72%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           CQ+C+  + PR+ HC  C  C+ +HDHHC+W+NNCVG  NY +F  FLLS
Sbjct: 175 CQSCRIWRPPRTSHCSTCNVCVMVHDHHCVWVNNCVGKRNYRFFLIFLLS 224

>ZYRO0C04092g Chr3 complement(320634..321734) [1101 bp, 366 aa] {ON}
           similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 366

 Score = 73.2 bits (178), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 34/50 (68%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           C +C+  + PR+ HC  CE CI  HDHHCIW+NNC+G  NY YF  FL S
Sbjct: 181 CTSCRIWRPPRASHCSTCEACILTHDHHCIWVNNCIGQRNYRYFILFLAS 230

>KLLA0D18370g Chr4 complement(1549382..1550449) [1068 bp, 355 aa]
           {ON} similar to uniprot|Q6B217 Saccharomyces cerevisiae
           YLR246W ERF2 Subunit of a palmitoyltransferase composed
           of Erf2p and Shr5p that adds a palmitoyl lipid moiety to
           Ras2p through a thioester linkage mutants partially
           mislocalize Ras2p to the vacuole
          Length = 355

 Score = 72.4 bits (176), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 37/51 (72%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSN 179
           CQTC+  + PRS HC +C+ C+  HDHHC W+NNC+G  NY +F  FL+++
Sbjct: 174 CQTCRIWRPPRSAHCSVCDVCVLSHDHHCKWLNNCIGKRNYRFFLEFLMAS 224

>Suva_10.342 Chr10 (593959..595029) [1071 bp, 356 aa] {ON} YLR246W
           (REAL)
          Length = 356

 Score = 72.4 bits (176), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           C +C+  + PRS HC  C  C+ +HDHHCIW+NNC+G  NY +F  FLLS
Sbjct: 175 CTSCRIWRPPRSSHCSTCNICVMVHDHHCIWVNNCIGKRNYRFFLIFLLS 224

>Kwal_23.3302 s23 (234749..235810) [1062 bp, 353 aa] {ON} YLR246W
           (ERF2) - Mutation has an Effect on Ras Function [contig
           251] FULL
          Length = 353

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 36/51 (70%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSN 179
           C TC+  + PR+ HC +C  CI  HDHHC W+NNC+G  NY YF +FL+S+
Sbjct: 173 CPTCRIWRPPRASHCSVCGACILNHDHHCKWVNNCIGQRNYRYFLTFLVSS 223

>YLR246W Chr12 (627118..628197) [1080 bp, 359 aa] {ON}  ERF2Subunit
           of a palmitoyltransferase, composed of Erf2p and Shr5p,
           that adds a palmitoyl lipid moiety to heterolipidated
           substrates such as Ras1p and Ras2p through a thioester
           linkage; mutants partially mislocalize Ras2p to the
           vacuole
          Length = 359

 Score = 70.9 bits (172), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 34/50 (68%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           C +C+  + PRS HC  C  C+ +HDHHCIW+NNC+G  NY +F  FLL 
Sbjct: 175 CPSCRIWRPPRSSHCSTCNVCVMVHDHHCIWVNNCIGKRNYRFFLIFLLG 224

>TDEL0F05130 Chr6 complement(961887..962966) [1080 bp, 359 aa] {ON}
           Anc_8.389 YLR246W
          Length = 359

 Score = 70.5 bits (171), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 33/51 (64%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSN 179
           C +C+  + PR+ HC  C  C+  HDHHCIW+NNCVG  NY YF  FL+  
Sbjct: 181 CTSCRIWRPPRASHCSTCGVCVMTHDHHCIWVNNCVGQRNYRYFIIFLIGT 231

>TPHA0C02360 Chr3 (531446..532660) [1215 bp, 404 aa] {ON} Anc_8.389
           YLR246W
          Length = 404

 Score = 70.1 bits (170), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           C+TC+  + PRS HC IC+ C+   DHHC+W+NNCVG  NY YF  FL S
Sbjct: 196 CRTCRIWRPPRSSHCSICDCCVMSLDHHCLWLNNCVGKRNYRYFLIFLTS 245

>AGL125C Chr7 complement(473496..474599) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR246W
           (ERF2)
          Length = 367

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 52/108 (48%), Gaps = 20/108 (18%)

Query: 91  TIAFTSL--TGVASVFVKPLGLQAGPQFQPDY--------IIFHPSAV---------CQT 131
           T+ F S   TG       P  +    Q Q DY        II  PS V         C T
Sbjct: 131 TLCFASFISTGATDPGTLPRNIHLA-QLQDDYKLPLEYYSIITLPSPVANAPVRLKYCTT 189

Query: 132 CKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSN 179
           C+  + PR+ HC +C+ CI   DHHC W+NNC+G  N+ YF +FL S+
Sbjct: 190 CRIWRPPRASHCAVCDSCILSFDHHCDWLNNCIGQRNHRYFLAFLFSS 237

>TBLA0H00150 Chr8 complement(13169..14206) [1038 bp, 345 aa] {ON}
           Anc_3.12 YNL326C
          Length = 345

 Score = 67.0 bits (162), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 43/79 (54%), Gaps = 8/79 (10%)

Query: 109 GLQAGPQFQPDYIIFHP--------SAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWI 160
             +AG +F P+Y+            + VC+TC   K  R  HC  C+RCI   DHHC W 
Sbjct: 78  AAEAGTEFPPEYLSQKSITLKHDGRARVCRTCLVWKPDRCHHCSSCDRCILKMDHHCPWF 137

Query: 161 NNCVGYGNYEYFYSFLLSN 179
             C+G+ N++YF +FL+ N
Sbjct: 138 AECIGFKNHKYFINFLIYN 156

>Kwal_56.22459 s56 (138563..139714) [1152 bp, 383 aa] {ON} YOL003C -
           Hypothetical ORF [contig 185] FULL
          Length = 383

 Score = 65.9 bits (159), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 53/99 (53%), Gaps = 4/99 (4%)

Query: 79  YLYSLEKAFIPITIAFTSLTGVASVFVKPLGLQAGPQFQPDYIIFHPSAVCQTCKTIKVP 138
           +L   ++ +  I ++   ++   ++F  P     G  FQP  +      +CQ CKT K  
Sbjct: 34  FLSLGQQVWFQICLSMIWISYALAIFTNPGKPPTG--FQP--LPHQWKNICQKCKTYKPE 89

Query: 139 RSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           R+ HC  C++C+ + DHHC W  NCVG+ N+ +F  FL+
Sbjct: 90  RTHHCKTCDQCVLVMDHHCPWTMNCVGHNNFPHFVRFLV 128

>Ecym_4178 Chr4 (375346..376452) [1107 bp, 368 aa] {ON} similar to
           Ashbya gossypii AGL125C
          Length = 368

 Score = 64.7 bits (156), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           C TC+  +  R+ HC  C  CI   DHHCIW+NNCVG  NY YF +F+ S
Sbjct: 189 CTTCRIWRPLRASHCSTCNSCIMTFDHHCIWVNNCVGQRNYRYFLTFIYS 238

>Smik_15.167 Chr15 complement(289180..290316) [1137 bp, 378 aa] {ON}
           YOL003C (REAL)
          Length = 378

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 114 PQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFY 173
           P +QP   I+     C+ C+  K  RS HC  C +C+ + DHHC W  NCVG+GNY +F 
Sbjct: 67  PNYQPTPGIW--PNFCKKCQNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFGNYPHFL 124

Query: 174 SFL 176
            FL
Sbjct: 125 RFL 127

>KNAG0K02570 Chr11 (511867..512853) [987 bp, 328 aa] {ON} Anc_3.12
           YNL326C
          Length = 328

 Score = 63.9 bits (154), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 111 QAGPQFQPDYIIFHPSAV--------CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINN 162
           +AG +  P+Y+      V        CQ+C+  K  R  HC  C+RCI   DHHC WI  
Sbjct: 77  EAGTELPPEYLTKRSLTVKKDGRFRVCQSCRYWKPDRCHHCSSCDRCILKMDHHCPWIAG 136

Query: 163 CVGYGNYEYFYSFLL 177
           CVG+ N + F  FLL
Sbjct: 137 CVGFRNQKLFIQFLL 151

>KAFR0A05130 Chr1 complement(1019919..1021109) [1191 bp, 396 aa]
           {ON} Anc_6.28 YOL003C
          Length = 396

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (62%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176
           C+ C   K PR+ HC  C +CI + DHHC W  NCVG+ NY +F  FL
Sbjct: 81  CKKCDAYKPPRAHHCKTCNKCILMMDHHCPWTMNCVGFKNYPHFLRFL 128

>Kpol_1014.29 s1014 (48992..49972) [981 bp, 326 aa] {ON}
           (48992..49972) [981 nt, 327 aa]
          Length = 326

 Score = 62.8 bits (151), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 39/73 (53%), Gaps = 4/73 (5%)

Query: 109 GLQAGPQF--QPDYIIFHPSA--VCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCV 164
           G++  P F  Q  + + H     VC+TC   K  R  HC  C++CI   DHHC W   CV
Sbjct: 82  GIELPPDFLAQRSFTLKHDGRFRVCRTCNVWKPDRCHHCSACDKCILKMDHHCPWFAECV 141

Query: 165 GYGNYEYFYSFLL 177
           G+ N +YF  FL+
Sbjct: 142 GFKNQKYFVQFLI 154

>TPHA0P01560 Chr16 (318550..319545) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 32/52 (61%)

Query: 128 VCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLSN 179
           VC+TC   K  RS HC  C RC+   DHHC W + C+G+ N ++F  FL+ N
Sbjct: 109 VCRTCNVWKPDRSHHCSTCNRCVLKMDHHCPWFSECIGFKNQKFFIQFLIYN 160

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 2/63 (3%)

Query: 114 PQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFY 173
           P ++P  +I+     C+ C++ K  RS HC  C +C+ + DHHC W  NCVG+ NY +F 
Sbjct: 67  PNYRPSPLIW--PNFCKKCQSYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFRNYPHFL 124

Query: 174 SFL 176
            FL
Sbjct: 125 RFL 127

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score = 61.6 bits (148), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 114 PQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFY 173
           P ++P   I+     C+ C++ K  RS HC  C +C+ + DHHC W  NCVG+ NY +F 
Sbjct: 67  PNYKPPPDIWR--NFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFL 124

Query: 174 SFLL 177
            FL 
Sbjct: 125 RFLF 128

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 61.2 bits (147), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 39/76 (51%), Gaps = 8/76 (10%)

Query: 110 LQAGPQFQPDYIIFHPSAV--------CQTCKTIKVPRSKHCPICERCIPLHDHHCIWIN 161
           ++ G +F PD++      +        C  CK  K  R  HC  C++C    DHHC+W  
Sbjct: 144 VETGMEFPPDFLAAKTVTLDSTGRHRYCVKCKVWKPDRCHHCSACDKCYLRRDHHCVWFP 203

Query: 162 NCVGYGNYEYFYSFLL 177
            C+GY N+++F  FLL
Sbjct: 204 GCIGYNNHKFFLHFLL 219

>ZYRO0C07546g Chr3 complement(574411..575544) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 61.2 bits (147), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 111 QAGPQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYE 170
           Q  P FQP    +   + C+ C+  K  R+ HC  C +C+   DHHC W  NCVGY N+ 
Sbjct: 64  QPLPNFQPSKNSW--KSYCKKCRNYKPERAHHCKTCNQCVLAMDHHCPWTKNCVGYYNFP 121

Query: 171 YFYSFL 176
           +F  FL
Sbjct: 122 HFMRFL 127

>CAGL0E02497g Chr5 complement(241355..242485) [1131 bp, 376 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003c
          Length = 376

 Score = 60.8 bits (146), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 30/48 (62%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176
           C+ CK  K  RS HC  C +C+ + DHHC W  NCVGY N+ +F  FL
Sbjct: 80  CKKCKCYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYNNFPHFIRFL 127

>KNAG0F02930 Chr6 complement(557052..558212) [1161 bp, 386 aa] {ON}
           Anc_6.28 YOL003C
          Length = 386

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           C  C   K  RS HC  C++C+ + DHHC W  NC+G+GN+  F  FL+
Sbjct: 82  CAKCNGFKPERSHHCKTCQQCVLMMDHHCPWTMNCLGFGNFPQFMRFLI 130

>NDAI0C02650 Chr3 (614101..615270) [1170 bp, 389 aa] {ON} Anc_6.28
          Length = 389

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 30/49 (61%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           C+ C   K  RS HC  C +C+ + DHHC W  NCVGY N+ +F  FL+
Sbjct: 84  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGYKNFPHFIRFLM 132

>NCAS0E01300 Chr5 complement(250120..251103) [984 bp, 327 aa] {ON}
           Anc_3.12
          Length = 327

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 38/75 (50%), Gaps = 8/75 (10%)

Query: 111 QAGPQFQPDYIIFHPSAV--------CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINN 162
           + G +  P+YI      +        CQTC+  K  R  HC  C++CI   DHHC W   
Sbjct: 75  KRGIELPPEYIAKRSFTLKKDGRYRLCQTCQVWKPDRCHHCSTCDKCILKMDHHCPWFAE 134

Query: 163 CVGYGNYEYFYSFLL 177
           C+G+ N +YF  FL+
Sbjct: 135 CIGFENQKYFVQFLI 149

>SAKL0E01518g Chr5 (113669..114808) [1140 bp, 379 aa] {ON} similar
           to uniprot|Q12006 Saccharomyces cerevisiae YOL003C
           DHHC-CRD protein
          Length = 379

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 60/132 (45%), Gaps = 10/132 (7%)

Query: 45  RYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNPYLYSLEKAFIPITIAFTSLTGVASVF 104
           ++ W    +P F    + +C H F       ++ +L + ++ +   ++    ++   +++
Sbjct: 6   KWPWLGIAIPLFLISFIGYCAHYF------ILSNFLPTKKQLWFEFSLGMIWISYYLAIY 59

Query: 105 VKPLGLQAGPQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCV 164
             P   +  P F+P    F     C  C   K  R+ HC  C +C+   DHHC W  NCV
Sbjct: 60  TNPG--KPTPGFRPSK--FEWENFCNKCNNYKPERAHHCKACNQCVLSMDHHCPWTMNCV 115

Query: 165 GYGNYEYFYSFL 176
           G+ N+ +F  FL
Sbjct: 116 GHRNFAHFIRFL 127

>TDEL0A00310 Chr1 complement(54006..54995) [990 bp, 329 aa] {ON}
           Anc_3.12 YNL326C
          Length = 329

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 31/50 (62%)

Query: 128 VCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           +C+TC   K  R  HC  C RCI   DHHC W+ +CVG+ N +YF  FL+
Sbjct: 107 LCRTCHVWKPDRCHHCSACNRCILRMDHHCPWLPDCVGFRNQKYFIQFLM 156

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 111 QAGPQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYE 170
           Q  P   P+Y        C+ C+  K  RS HC  C +C+ + DHHC W  NCVG+ NY 
Sbjct: 90  QPNPNTWPNY--------CKKCQNYKPERSHHCKACNQCVLMMDHHCPWTMNCVGFKNYP 141

Query: 171 YFYSFL 176
           +F  F+
Sbjct: 142 HFLRFI 147

>KAFR0A08590 Chr1 (1722408..1723403) [996 bp, 331 aa] {ON} Anc_3.12
           YNL326C
          Length = 331

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 36/75 (48%), Gaps = 8/75 (10%)

Query: 110 LQAGPQFQPDYIIFHPSA--------VCQTCKTIKVPRSKHCPICERCIPLHDHHCIWIN 161
           ++ G +  P+Y+              +CQTC   K  R  HC  C RCI   DHHC W  
Sbjct: 79  VEMGAELPPEYLTSRSLTMKHDGRFRICQTCMFWKPDRCHHCSSCNRCILKMDHHCPWFA 138

Query: 162 NCVGYGNYEYFYSFL 176
            C+G+ N +YF  FL
Sbjct: 139 ECIGFKNQKYFIQFL 153

>Kpol_1037.23 s1037 complement(51397..52533) [1137 bp, 378 aa] {ON}
           complement(51397..52533) [1137 nt, 379 aa]
          Length = 378

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 30/48 (62%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176
           C+ C   K  R+ HC  C++C+ + DHHC W  NCVGY N+ +F  FL
Sbjct: 80  CKKCNAYKPERTHHCKTCQQCVLMMDHHCPWTMNCVGYKNFPHFLRFL 127

>TPHA0J00390 Chr10 (88587..89729) [1143 bp, 380 aa] {ON} Anc_6.28
           YOL003C
          Length = 380

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           C+ C   K  RS HC  C +C+ + DHHC W  NC+G+ N+ +F  FLL
Sbjct: 80  CKKCNNYKPERSHHCKTCNQCVLMMDHHCPWTMNCIGFNNFPHFMRFLL 128

>NCAS0D02140 Chr4 complement(398924..400054) [1131 bp, 376 aa] {ON}
           Anc_6.28
          Length = 376

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 30/48 (62%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176
           C+ C+  K  R+ HC  C +C+ + DHHC W  NCVG+ N+ +F  FL
Sbjct: 80  CKKCQLFKPERAHHCKTCNQCVLMMDHHCPWTMNCVGFKNFPHFLRFL 127

>NDAI0G01340 Chr7 (301254..302261) [1008 bp, 335 aa] {ON} Anc_3.12
          Length = 335

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%)

Query: 128 VCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           +CQTC+  K  R  HC  C +CI   DHHC W   C+G+ N ++F  FL+
Sbjct: 108 LCQTCQVWKPDRCHHCSTCNKCILKMDHHCPWFAECIGFKNQKFFIQFLI 157

>TDEL0G04410 Chr7 complement(800085..801230) [1146 bp, 381 aa] {ON}
           Anc_6.28 YOL003C
          Length = 381

 Score = 58.2 bits (139), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 31/49 (63%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           C+ C+  K  R+ HC  C +C+ + DHHC W  NCVG+ N+ +F  FL+
Sbjct: 80  CKKCQNYKPERAHHCKTCNQCVLMMDHHCPWTMNCVGHNNFPHFLRFLV 128

>KLTH0C10978g Chr3 complement(905760..906893) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC-CRD protein
          Length = 377

 Score = 58.2 bits (139), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 56/133 (42%), Gaps = 12/133 (9%)

Query: 45  RYRWKYWLVPGFYACILIFCVHLF-YNKLNDTVNPYLYSLEKAFIPITIAFTSLTGVASV 103
           ++ W    VP F    + +  H F       T     +      I ++ AF       ++
Sbjct: 6   KWPWLGIAVPSFLIAYIGYSSHYFILQNFASTYQQLWFEFSLTLIWVSYAF-------AI 58

Query: 104 FVKPLGLQAGPQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNC 163
           F  P   +  P F+P   I      C+ C   K  R+ HC  C++C+   DHHC W  NC
Sbjct: 59  FKNPG--RPPPNFEPP--IHQWKNYCKKCDNYKPERTHHCKTCKQCVLSMDHHCPWTMNC 114

Query: 164 VGYGNYEYFYSFL 176
           VG+ N+ +F  FL
Sbjct: 115 VGHNNFPHFVRFL 127

>KLLA0C06204g Chr3 complement(548912..550045) [1134 bp, 377 aa] {ON}
           similar to uniprot|Q12006 Saccharomyces cerevisiae
           YOL003C DHHC- CRD protein
          Length = 377

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 5/59 (8%)

Query: 123 FHPSAV-----CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176
           F PSA      C+ C+  K  R+ HC  C +C+   DHHC W  NCVG+ N+ +F  FL
Sbjct: 69  FKPSAEEWHNYCKKCRVYKPERAHHCKTCNQCVLAMDHHCPWTLNCVGHSNFPHFMRFL 127

>KLTH0F19580g Chr6 (1586776..1587804) [1029 bp, 342 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 342

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 28/49 (57%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           C+ C   K  R  HC  C++C    DHHC W  +CVGY N +YF  FL+
Sbjct: 106 CRVCAVWKPDRCHHCSACKKCFLKMDHHCPWFASCVGYANQKYFVQFLI 154

>SAKL0C13596g Chr3 (1198957..1199958) [1002 bp, 333 aa] {ON} similar
           to uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 333

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%)

Query: 128 VCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           +C+ CK  K  RS HC  C +C    DHHC W  +C+G+ N + F  FLL
Sbjct: 104 ICRNCKVWKPDRSHHCSSCNKCFLKMDHHCPWFASCIGFKNQKLFIQFLL 153

>ZYRO0C03410g Chr3 (265684..266667) [984 bp, 327 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326C PFA3
           Palmitoyltransferase for Vac8p one of three yeast
           DHHC-cysteine rich domain proteins (Pfa3p Erf2p Akr1p)
           with palmitoyltransferase activity required for vacuolar
           integrity under stress conditions
          Length = 327

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 8/77 (10%)

Query: 109 GLQAGPQFQPDYIIFHPSA--------VCQTCKTIKVPRSKHCPICERCIPLHDHHCIWI 160
            +++G +  P+++              VC+TC   K  R  HC  C++CI   DHHC W 
Sbjct: 79  AVESGAELPPEFLSRRSITTKRDGRFRVCRTCHVWKPDRCHHCSRCDKCILKMDHHCPWF 138

Query: 161 NNCVGYGNYEYFYSFLL 177
             C+G+ N  +F  +LL
Sbjct: 139 PGCIGFNNQRFFIQYLL 155

>Ecym_2014 Chr2 complement(19723..20742) [1020 bp, 339 aa] {ON}
           similar to Ashbya gossypii ADL197C
          Length = 339

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 8/75 (10%)

Query: 111 QAGPQFQPDYIIFHPSAV--------CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINN 162
           + G +F P+++      +        C TC   K  RS HC  C +C    DHHC W ++
Sbjct: 84  EVGLEFPPEFLSKKSVTLRQNGRYRYCATCGVWKPDRSHHCSSCNKCYLKRDHHCPWFSS 143

Query: 163 CVGYGNYEYFYSFLL 177
           C+G+ N ++F  FL+
Sbjct: 144 CIGFNNQKFFVQFLM 158

>Ecym_3032 Chr3 (63354..64487) [1134 bp, 377 aa] {ON} similar to
           Ashbya gossypii ACL003C
          Length = 377

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 59/132 (44%), Gaps = 10/132 (7%)

Query: 45  RYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNPYLYSLEKAFIPITIAFTSLTGVASVF 104
           ++ W    +P F    + +   LF       +  +L   ++ +   ++    L+   +++
Sbjct: 6   KWPWLGIAIPCFLIAFIGYSAQLF------VLQGFLSVKQQIWFQFSLTMIWLSYYKAIY 59

Query: 105 VKPLGLQAGPQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCV 164
             P      P FQP  +       C+ C+  K  R+ HC  C +C+ + DHHC +  NCV
Sbjct: 60  TNPGS--PVPGFQP--LKHEWKNYCKKCQNFKPERTHHCKTCAQCVLVMDHHCPFTMNCV 115

Query: 165 GYGNYEYFYSFL 176
           GY N+ +F  FL
Sbjct: 116 GYNNFPHFMRFL 127

>TBLA0B00480 Chr2 (93291..94424) [1134 bp, 377 aa] {ON} Anc_6.28
           YOL003C
          Length = 377

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 26/40 (65%)

Query: 137 VPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176
           +PR+ HC  C  C+ + DHHC W  NCVGY NY +F  FL
Sbjct: 98  LPRAHHCKTCNTCVVMMDHHCPWTMNCVGYTNYPHFIRFL 137

>CAGL0D02508g Chr4 (256760..257758) [999 bp, 332 aa] {ON} similar to
           uniprot|P42836 Saccharomyces cerevisiae YNL326c
          Length = 332

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 29/50 (58%)

Query: 128 VCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           VC++C + K  R  HC  C  C+   DHHC W   CVGY N ++F  FL+
Sbjct: 105 VCKSCSSWKPDRCHHCSTCNVCVLKMDHHCPWFAGCVGYRNQKFFIQFLI 154

>Kwal_55.22126 s55 (1121936..1123018) [1083 bp, 360 aa] {ON} YNL326C
           - Hypothetical ORF [contig 124] FULL
          Length = 360

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 28/49 (57%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           C+TC   K  R  HC  C +C    DHHC W  +CVGY N +YF  FLL
Sbjct: 133 CRTCVVWKPDRCHHCSGCNKCYLKMDHHCPWFASCVGYRNQKYFIHFLL 181

>KLLA0E02069g Chr5 complement(195185..196162) [978 bp, 325 aa] {ON}
           weakly similar to uniprot|P42836 Saccharomyces
           cerevisiae YNL326C PFA3 Palmitoyltransferase for Vac8p
           one of three yeast DHHC-cysteine rich domain proteins
           (Pfa3p Erf2p Akr1p) with palmitoyltransferase activity
           required for vacuolar integrity under stress conditions
          Length = 325

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 28/48 (58%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176
           CQTC+  K  R  HC  C +C    DHHC W  +CVG+ N ++F  FL
Sbjct: 105 CQTCEIWKPDRCHHCSKCNKCFLKMDHHCPWFASCVGFRNQKFFVQFL 152

>Ecym_4114 Chr4 complement(238112..239230) [1119 bp, 372 aa] {ON}
           similar to Ashbya gossypii ABR203W
          Length = 372

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 9/80 (11%)

Query: 98  TGVASVFVKPLGLQAGPQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHC 157
           T V SV + P   Q  PQ  P +        C TC+++K+ RS H  + + C+P  DH+C
Sbjct: 105 TVVVSV-IPPDIYQCDPQGYPMW--------CSTCQSLKIERSHHSELLKYCVPRFDHYC 155

Query: 158 IWINNCVGYGNYEYFYSFLL 177
           +W+   +G  NY+ F  +++
Sbjct: 156 VWLGTVIGRKNYKLFMQYVM 175

>Skud_14.15 Chr14 complement(20841..21851) [1011 bp, 336 aa] {ON}
           YNL326C (REAL)
          Length = 336

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 27/50 (54%)

Query: 128 VCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           VCQ C   K  R  HC  C+ CI   DHHC W   C G+ N ++F  FL+
Sbjct: 105 VCQICHVWKPDRCHHCSSCDICILKMDHHCPWFAECTGFKNQKFFIQFLM 154

>YNL326C Chr14 complement(27337..28347) [1011 bp, 336 aa] {ON}
           PFA3Palmitoyltransferase for Vac8p, required for
           vacuolar membrane fusion; contains an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain;
           autoacylates; required for vacuolar integrity under
           stress conditions
          Length = 336

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 27/50 (54%)

Query: 128 VCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           VCQ C   K  R  HC  C+ CI   DHHC W   C G+ N ++F  FL+
Sbjct: 105 VCQVCHVWKPDRCHHCSSCDVCILKMDHHCPWFAECTGFRNQKFFIQFLM 154

>Suva_14.15 Chr14 complement(23560..24552) [993 bp, 330 aa] {ON}
           YNL326C (REAL)
          Length = 330

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 26/50 (52%)

Query: 128 VCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           VCQ C   K  R  HC  C+ CI   DHHC W   C G+ N + F  FL+
Sbjct: 105 VCQICHVWKPDRCHHCSSCDMCILKMDHHCPWFAECTGFKNQKLFIQFLM 154

>Smik_14.6 Chr14 complement(11864..12868) [1005 bp, 334 aa] {ON}
           YNL326C (REAL)
          Length = 334

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 8/77 (10%)

Query: 109 GLQAGPQFQPDYI------IFHPSA--VCQTCKTIKVPRSKHCPICERCIPLHDHHCIWI 160
             + G +  P+YI      + H     VCQ C   K  R  HC  C+ C+   DHHC W 
Sbjct: 78  AAENGLELPPEYISKRCMTLKHDGRFRVCQVCHVWKPDRCHHCSSCDICVLKMDHHCPWF 137

Query: 161 NNCVGYGNYEYFYSFLL 177
             C G+ N ++F  FL+
Sbjct: 138 AECTGFKNQKFFIQFLM 154

>Kpol_1004.57 s1004 complement(123368..124456) [1089 bp, 362 aa]
           {ON} complement(123368..124456) [1089 nt, 363 aa]
          Length = 362

 Score = 52.8 bits (125), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           C TCK++K+ R+ H      CIP  DHHC+W+   +G  NY  F  F+ 
Sbjct: 124 CDTCKSLKIGRTHHSKRLGYCIPRFDHHCMWVGTVIGKSNYLLFTQFVF 172

>TDEL0A04440 Chr1 complement(795121..796218) [1098 bp, 365 aa] {ON}
           Anc_5.579 YDR459C
          Length = 365

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 8/77 (10%)

Query: 101 ASVFVKPLGLQAGPQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWI 160
           A   V P+  Q+ P+  P +        C  C ++K  R+ H    E C+P  DH C W+
Sbjct: 107 AHSLVPPVCYQSCPRGNPIW--------CSACDSVKTERAHHSSDMEYCVPRFDHKCAWL 158

Query: 161 NNCVGYGNYEYFYSFLL 177
              +G  NY +F  F++
Sbjct: 159 GAVIGRDNYRFFIQFVM 175

>KAFR0I01110 Chr9 (214426..215538) [1113 bp, 370 aa] {ON} Anc_5.579
           YDR459C
          Length = 370

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 64/162 (39%), Gaps = 28/162 (17%)

Query: 42  DYTRYRWKYWLVPGFYACILIFCVHLFYNKLNDTVNPYLYSLEKAFIPITIAFTSLTGVA 101
           D  +Y     +VP  + C++++    F +KL        ++   A I + +  + L  V 
Sbjct: 6   DLNKYPQLRCVVPTVFFCLMVYGTWAFIHKLCVKQLLGRHNHHAAGIALIVVQSVLFAVI 65

Query: 102 SVFVKPLGLQAGPQFQPDYIIF-----------HPSAV----------------CQTCKT 134
           S F+    L  GP  QP    F            P++                 C  C+ 
Sbjct: 66  S-FIWAQILVVGPGRQPHIAPFELVSTNTTSETQPTSTVPAKLYQCDSNGYPRWCSNCEG 124

Query: 135 IKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176
           +K  RS H  +   CIP  DH+CIW+   +G  NY+ F  FL
Sbjct: 125 LKSLRSHHSSVANYCIPRFDHYCIWLGTTIGKDNYKQFVIFL 166

>CAGL0K06347g Chr11 complement(624046..625104) [1059 bp, 352 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459c
          Length = 352

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176
           C  C+++KV R+KH      C+P  DH+C+W+   +G+ NY  F  F+
Sbjct: 116 CSNCQSLKVGRTKHSSHQGHCVPRFDHYCVWLGAVIGFKNYRLFVQFV 163

>KLTH0G04972g Chr7 complement(404787..405890) [1104 bp, 367 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 367

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 25/47 (53%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSF 175
           C  C++IK  R+ H      CIP  DH+C+WI   VG  NY  F  F
Sbjct: 132 CTACQSIKANRTHHSSTLGYCIPRFDHYCVWIGTVVGRKNYRLFVQF 178

>TBLA0E02830 Chr5 (700364..701524) [1161 bp, 386 aa] {ON} Anc_5.579
           YDR459C
          Length = 386

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 44/98 (44%), Gaps = 13/98 (13%)

Query: 84  EKAFIPITIAFTSLTGV-----ASVFVKPLGLQAGPQFQPDYIIFHPSAVCQTCKTIKVP 138
           ++ F+P    FT+ T        +  + P+  Q  P   P +        C  C+++K+ 
Sbjct: 81  KQPFVPPFQLFTNDTESDDDDNETAVLPPITYQCDPHGYPFW--------CSECQSLKLE 132

Query: 139 RSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176
           R+ H      C+P  DH+C+W+   +G  NY  F  F+
Sbjct: 133 RTHHSSAMGHCVPRFDHYCVWVGTVIGKDNYLLFLQFV 170

>YDR459C Chr4 complement(1382319..1383443) [1125 bp, 374 aa] {ON}
           PFA5Palmitoyltransferase with autoacylation activity;
           likely functions in pathway(s) outside Ras; member of a
           family of putative palmitoyltransferases containing an
           Asp-His-His-Cys-cysteine rich (DHHC-CRD) domain
          Length = 374

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSF 175
           C  C+++K+ R+ H      CIP  DH+C+WI   +G  NY  F  F
Sbjct: 131 CSECQSLKMERTHHSSELGHCIPRFDHYCMWIGTVIGRDNYRLFVQF 177

>Smik_4.737 Chr4 complement(1303557..1304693) [1137 bp, 378 aa] {ON}
           YDR459C (REAL)
          Length = 378

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 26/47 (55%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSF 175
           C  C+++K+ RS H      CIP  DH+C+WI   +G  NY  F  F
Sbjct: 131 CSPCQSLKMERSHHSSELGHCIPRFDHYCVWIGTIIGRDNYRPFVQF 177

>SAKL0G06160g Chr7 complement(514850..515944) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 364

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 26/47 (55%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSF 175
           C  C+++K+ R+ H      C+P  DH+C+WI   VG  NY  F  F
Sbjct: 127 CSMCQSLKMERTHHSATLGYCVPRFDHYCVWIGTVVGRKNYRLFIQF 173

>Kwal_47.18366 s47 (796220..797290) [1071 bp, 356 aa] {ON} YDR459C -
           Hypothetical ORF [contig 196] FULL
          Length = 356

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 36/77 (46%), Gaps = 9/77 (11%)

Query: 100 VASVFVKPLGL-QAGPQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCI 158
            A+  +KP  + Q  PQ  P +        C  C+++K  R+ H      CIP  DH+C+
Sbjct: 103 AATRSIKPPRIYQCDPQGYPIW--------CTACQSLKSNRTHHSSTLGYCIPRFDHYCV 154

Query: 159 WINNCVGYGNYEYFYSF 175
           WI   VG  NY  F  F
Sbjct: 155 WIGTIVGRKNYRLFVQF 171

>ACL003C Chr3 complement(352024..353151) [1128 bp, 375 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL003C
          Length = 375

 Score = 47.0 bits (110), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 23/37 (62%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVG 165
           C  C+T K  R+ HC  C +C+ + DHHC W  NC+G
Sbjct: 80  CTKCETYKPERTHHCKRCNQCVLVMDHHCPWTMNCLG 116

>Suva_2.634 Chr2 complement(1134492..1135658) [1167 bp, 388 aa] {ON}
           YDR459C (REAL)
          Length = 388

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176
           C  C+++K+ R+ H      C+P  DH+C+W+   +G  NY  F  F+
Sbjct: 137 CSPCQSLKMERTHHSSELGHCVPRFDHYCLWVGTVIGRDNYRLFVQFV 184

>Skud_4.734 Chr4 complement(1302386..1303528) [1143 bp, 380 aa] {ON}
           YDR459C (REAL)
          Length = 380

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176
           C  C+++K  R+ H      C+P  DH+C+W    +G  NY  F  F+
Sbjct: 132 CSPCQSLKTERTHHSSELGHCVPRFDHYCMWAGTVIGRDNYRLFVQFV 179

>KLLA0D06149g Chr4 (527705..528754) [1050 bp, 349 aa] {ON} similar
           to uniprot|Q03289 Saccharomyces cerevisiae YDR459C
           likely functions in pathway(s) outside Ras
          Length = 349

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSF 175
           C  C+++K+ R+ H      C+P  DH+C+WI   +G  NY+ F  F
Sbjct: 128 CSNCQSLKMSRTHHSTKVGYCVPRFDHYCVWIGTVLGRLNYKLFVQF 174

>ABR203W Chr2 (782704..783783) [1080 bp, 359 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR459C
          Length = 359

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           C  C+++K  R+ H      C+P  DH+C+W+   +G  NY  F  FL+
Sbjct: 122 CSVCQSLKGLRTHHSVHLGFCVPRLDHYCVWLGTVIGRRNYRLFNQFLM 170

>NCAS0F01390 Chr6 complement(275879..277003) [1125 bp, 374 aa] {ON}
           Anc_5.579 YDR459C
          Length = 374

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176
           C  C+++K+ RS H     RCI   DH+C WI   +   NY  F  ++
Sbjct: 118 CTHCQSLKLSRSHHSKQVGRCILRFDHYCAWIGCVIARNNYRLFLQYV 165

>KNAG0C02830 Chr3 complement(563740..564804) [1065 bp, 354 aa] {ON}
           Anc_5.579 YDR459C
          Length = 354

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           C  C+++K  R+ H      C+   DH+C W+   +G GNY  F  FL+
Sbjct: 126 CAHCQSVKSLRTHHSGRTGSCVFKFDHYCGWLGTLIGAGNYLLFIQFLV 174

>ZYRO0D13860g Chr4 complement(1171732..1172829) [1098 bp, 365 aa]
           {ON} similar to uniprot|Q03289 Saccharomyces cerevisiae
           YDR459C likely functions in pathway(s) outside Ras
          Length = 365

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSF 175
           C  C+++K  R+ H      C+P  DH C ++ + +G  NY  F  +
Sbjct: 127 CTNCQSLKTERAHHSRELGHCVPKFDHKCTYLGSIIGKDNYRLFVQY 173

>NDAI0H01890 Chr8 complement(458111..459331) [1221 bp, 406 aa] {ON}
           Anc_5.579 YDR459C
          Length = 406

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 24/49 (48%)

Query: 129 CQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           C  C+++K+ R  H      CI   DH+C WI   +G  NY  F  ++ 
Sbjct: 117 CTYCQSLKLERVHHSRQLGYCIFRFDHYCAWIGTVIGRNNYRLFIQYVF 165

>SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {ON}
           similar to uniprot|Q75BN0 Ashbya gossypii ACR241C
           ACR241Cp and weakly similar to YKR064W uniprot|P36023
           Saccharomyces cerevisiae YKR064W Hypothetical ORF
          Length = 875

 Score = 37.4 bits (85), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%), Gaps = 1/45 (2%)

Query: 124 HPSAVCQTCKTIKVPRSKHCPICERCIPLHDHH-CIWINNCVGYG 167
            P+ VC  CK  K    K  P C  C+ L D   C ++N  VG G
Sbjct: 8   RPTVVCSNCKRRKSKCDKQKPACSNCVRLGDEATCTYLNEPVGKG 52

>Smik_4.515 Chr4 complement(928882..931176) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%)

Query: 123 FHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           F   + C    T K  RSK+  +    +   DH+C WI N VG  N++ F  F+ S
Sbjct: 466 FDTKSFCIETWTRKPLRSKYSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFITS 521

>KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {ON} 
          Length = 847

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 117 QPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIW 159
           + D+    PS VC TC+T K+   K  P C RC+  +   C++
Sbjct: 3   EKDFRKIRPSYVCVTCRTQKLKCDKQRPSCGRCLK-NKRKCVY 44

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
           {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
           lactis KLLA0A03421g and weakly similar to YAL051W
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate- activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta- oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 946

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 126 SAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIW 159
           S VCQ+C+  K    K  P C RC+ L  H CI+
Sbjct: 26  SFVCQSCRKSKTKCDKQKPSCSRCLRL-GHQCIY 58

>YDR264C Chr4 complement(996029..998323) [2295 bp, 764 aa] {ON}
           AKR1Palmitoyl transferase involved in protein
           palmitoylation; acts as a negative regulator of
           pheromone response pathway; required for endocytosis of
           pheromone receptors; involved in cell shape control;
           contains ankyrin repeats
          Length = 764

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 135 IKVP-RSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176
           I+ P RSK  P+    +   DH+C WI N VG  N++ F  F+
Sbjct: 477 IRKPLRSKFSPLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>NDAI0H00850 Chr8 (190934..193294) [2361 bp, 786 aa] {ON} Anc_5.626
           YDR264C
          Length = 786

 Score = 33.5 bits (75), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 25/55 (45%)

Query: 123 FHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           F     C    T K  RSK+  +    +   DH C WI N VG  N++ F  F+L
Sbjct: 468 FDSKNFCLESWTRKPLRSKYSHLNNALVARFDHFCPWIYNDVGLKNHKNFIGFIL 522

>KLTH0E02420g Chr5 complement(211548..213752) [2205 bp, 734 aa] {ON}
           similar to uniprot|P39010 Saccharomyces cerevisiae
           YDR264C AKR1 Palmitoyl transferase involved in protein
           palmitoylation acts as a negative regulator of pheromone
           response pathway required for endocytosis of pheromone
           receptors involved in cell shape control contains
           ankyrin repeats
          Length = 734

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 21/40 (52%)

Query: 139 RSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           RSK     E  I   DH C WI N VG  N++ F  FLLS
Sbjct: 464 RSKFSRFNEALIVRFDHFCPWIYNDVGLLNHKQFIYFLLS 503

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
           Anc_7.17 YAL051W
          Length = 944

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 126 SAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIW 159
           S VCQ C+  KV   +  P+C RC   HD  C++
Sbjct: 37  SFVCQGCRRSKVKCDQEKPVCSRCSK-HDLECVY 69

>Smik_15.213 Chr15 complement(360836..363070) [2235 bp, 744 aa] {ON}
           YOR034C (REAL)
          Length = 744

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 21/40 (52%)

Query: 139 RSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           RSK  P     +  +DH C W+ N +G  N++ F  F L+
Sbjct: 455 RSKFSPFSGALVARYDHFCPWVYNDIGLKNHKLFLFFALT 494

>TPHA0C00370 Chr3 (62796..65075) [2280 bp, 759 aa] {ON} Anc_5.626
           YOR034C
          Length = 759

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%)

Query: 123 FHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           +  S  C    T K  RS++  +    +   DH+C W+ N VG  N++ F  F+LS
Sbjct: 458 YDTSNFCIETLTRKPLRSRYSYMNNALVSRFDHYCPWVYNDVGLKNHKTFLFFILS 513

>CAGL0M08712g Chr13 (866454..868745) [2292 bp, 763 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264c
           ankyrin repeat-containing protein
          Length = 763

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 123 FHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           F   + C      K  RSK+  + +  I   DH+C WI N VG  N++ F  F+L+
Sbjct: 450 FDTRSFCLETWVRKPLRSKYSYLNDALILRFDHYCPWIYNDVGLKNHKLFIFFILA 505

>Skud_4.527 Chr4 complement(938779..941073) [2295 bp, 764 aa] {ON}
           YDR264C (REAL)
          Length = 764

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 24/54 (44%)

Query: 123 FHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFL 176
           F     C    T K  RSK   +    +   DH+C WI N VG  N++ F  F+
Sbjct: 466 FDTKNFCIETWTRKPLRSKFSSLNNAVVARFDHYCPWIFNDVGLKNHKAFIFFI 519

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
           weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 934

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 15/27 (55%)

Query: 124 HPSAVCQTCKTIKVPRSKHCPICERCI 150
            PS VCQ C+  K+   K  P C RC+
Sbjct: 14  RPSFVCQECRRRKIKCDKKRPRCSRCV 40

>Ecym_1330 Chr1 (684758..686977) [2220 bp, 739 aa] {ON} similar to
           Ashbya gossypii AER388C
          Length = 739

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 135 IKVP-RSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           +++P RSK+       I  +DH+C W+ N +G+ N++ F  F++
Sbjct: 461 VRIPLRSKYKTARNVLIARYDHYCPWVYNQIGFCNHKIFLFFIM 504

>TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {ON}
           Anc_3.339 YBR097W
          Length = 1425

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 44/111 (39%), Gaps = 10/111 (9%)

Query: 60  ILIFCVHLFYNKLNDTVNPYLY--------SLEKAFIPITIAFTSLTGVASV--FVKPLG 109
           IL  C      K ND +  +L         SL   FI +  A + L G  S+  ++ PL 
Sbjct: 596 ILSLCNFFGREKTNDIILSHLITYFNDKDSSLRIEFIELIPAISVLLGPMSIQQYILPLL 655

Query: 110 LQAGPQFQPDYIIFHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWI 160
           +Q     +   I++   ++   C T  V +  +  IC    PL  H   WI
Sbjct: 656 IQTITDPEELVIVYVLQSLKDICTTGLVEKKSYFDICRTVAPLLLHPNTWI 706

>KLLA0E16721g Chr5 (1484752..1487010) [2259 bp, 752 aa] {ON} similar
           to uniprot|P39010 Saccharomyces cerevisiae YDR264C AKR1
           Palmitoyl transferase involved in protein palmitoylation
          Length = 752

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 135 IKVP-RSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           I++P RSK+       I   DH C W+ N +G  N++ FY F++
Sbjct: 473 IRIPLRSKYDRDSACLISAFDHFCPWVYNQIGLLNHKLFYMFVV 516

>TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa]
           {ON} Anc_7.17 YOR363C
          Length = 892

 Score = 31.2 bits (69), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%)

Query: 124 HPSAVCQTCKTIKVPRSKHCPICERCI 150
            PS VC TC+  KV   +  P C RCI
Sbjct: 10  RPSKVCLTCRRRKVKCDQQHPSCMRCI 36

>KAFR0H00570 Chr8 (100639..102912) [2274 bp, 757 aa] {ON} Anc_5.626
           YOR034C
          Length = 757

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 135 IKVP-RSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           I+ P RSK        +   DH+C W+ N +G  N++ F  F++S
Sbjct: 468 IRKPLRSKFSTFYNSTVSRFDHYCPWVYNDIGLKNHKIFIFFIIS 512

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
           274] FULL
          Length = 628

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 1/34 (2%)

Query: 126 SAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIW 159
           S VC  C+  K+  +K  P C RC+  HD  C++
Sbjct: 12  SHVCDACRIRKLKCNKQKPSCSRCVK-HDLQCVY 44

>Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to
           Ashbya gossypii ADR405C
          Length = 827

 Score = 30.8 bits (68), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/25 (52%), Positives = 15/25 (60%)

Query: 126 SAVCQTCKTIKVPRSKHCPICERCI 150
           S VCQTC+  K    K  P+C RCI
Sbjct: 33  SFVCQTCRKSKTKCDKLKPLCTRCI 57

>YOR034C Chr15 complement(394837..397086) [2250 bp, 749 aa] {ON}
           AKR2Ankyrin repeat-containing protein similar to Akr1p;
           member of a family of putative palmitoyltransferases
           containing an Asp-His-His-Cys-cysteine rich (DHHC-CRD)
           domain; possibly involved in constitutive endocytosis of
           Ste3p
          Length = 749

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 25/56 (44%)

Query: 123 FHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLLS 178
           F     C      K  RSK+       +  +DH+C WI N VG  N++ F  F ++
Sbjct: 442 FDRENFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVT 497

>Kpol_526.32 s526 complement(77926..80259) [2334 bp, 777 aa] {ON}
           complement(77926..80259) [2334 nt, 778 aa]
          Length = 777

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 25/55 (45%)

Query: 123 FHPSAVCQTCKTIKVPRSKHCPICERCIPLHDHHCIWINNCVGYGNYEYFYSFLL 177
           F  +  C      K  RS++  +    +   DH C WI N +G  N++ F  F++
Sbjct: 473 FDTNNFCIESSVRKPLRSRYSYLNSAIVTRFDHFCPWIYNDIGLKNHKLFVLFII 527

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.143    0.476 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,605,731
Number of extensions: 1352419
Number of successful extensions: 5195
Number of sequences better than 10.0: 136
Number of HSP's gapped: 5205
Number of HSP's successfully gapped: 151
Length of query: 324
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 214
Effective length of database: 40,868,139
Effective search space: 8745781746
Effective search space used: 8745781746
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 66 (30.0 bits)