Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19382gsingletonON75753933e-51
KLLA0F19371g8.273ON80661105e-08
TPHA0A017408.273ON7952871e-04
Suva_2.2808.273ON6657834e-04
CAGL0B01875g8.273ON7449800.001
TDEL0F040008.273ON6239790.001
Kpol_YGOB_YDR119W-A8.273ON7538790.002
YDR119W-A (COX26)8.273ON6657780.002
Skud_4.3808.273ON6657780.002
Ecym_42978.273ON7448780.003
Smik_4.3648.273ON6564750.006
KLTH0G13442g8.273ON7456730.013
SAKL0H16786g8.273ON7448720.017
TBLA0F030308.273ON7553690.051
TPHA0F007204.129ON128336690.16
KNAG0H031708.273ON7148650.18
NDAI0J012908.273ON7561640.26
ZYRO0D06908g8.273ON7766640.29
Kwal_YGOB_YDR119W-A8.273ON7444591.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19382g
         (75 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some s...   155   3e-51
KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some s...    47   5e-08
TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}...    38   1e-04
Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A ...    37   4e-04
CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar ...    35   0.001
TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273...    35   0.001
Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON} A...    35   0.002
YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}  COX26Putat...    35   0.002
Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A ...    35   0.002
Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON} s...    35   0.003
Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A ...    33   0.006
KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa] {...    33   0.013
SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa] {...    32   0.017
TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}...    31   0.051
TPHA0F00720 Chr6 (162768..166619) [3852 bp, 1283 aa] {ON} Anc_4....    31   0.16 
KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}...    30   0.18 
NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.27...    29   0.26 
ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON...    29   0.29 
Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74 a...    27   1.6  

>KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 75

 Score =  155 bits (393), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 75/75 (100%), Positives = 75/75 (100%)

Query: 1  MFIRLLRAGKEHATTARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPYWV 60
          MFIRLLRAGKEHATTARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPYWV
Sbjct: 1  MFIRLLRAGKEHATTARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPYWV 60

Query: 61 KEYSYVTHGKPNWSP 75
          KEYSYVTHGKPNWSP
Sbjct: 61 KEYSYVTHGKPNWSP 75

>KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 80

 Score = 47.0 bits (110), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 2  FIRLLRA----GKEHAT-TARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTW 56
          F + LR+       HAT T  +    SG  VGE+W  +E RRL P ++ Y  FI +++ W
Sbjct: 3  FTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVLGW 62

Query: 57 PYWVKE 62
          P+ V++
Sbjct: 63 PFLVRK 68

>TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 79

 Score = 38.1 bits (87), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 33/52 (63%), Gaps = 2/52 (3%)

Query: 12 HATTARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPYWVKEY 63
          H++ A +   +S  H+GESW  +E +R+ PNL+ +   + T++ WP ++K +
Sbjct: 21 HSSNAAKTPGSS--HLGESWILTEAKRVGPNLLFWGSAMTTVLLWPSFIKYF 70

>Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 36.6 bits (83), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1  MFIRLLRAGKEHATTARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWP 57
           F ++LR+    A   R     +G  VGE+W  +E+RRL P +  +   I T + WP
Sbjct: 2  FFSQVLRSSARAAPIKRY----TGGRVGEAWMITESRRLIPEVFQWGAVICTCLGWP 54

>CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar
          to uniprot|Q2V2P9 Saccharomyces cerevisiae YDR119wa
          Length = 74

 Score = 35.4 bits (80), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%), Gaps = 3/49 (6%)

Query: 10 KEHATTARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPY 58
          +  ++TAR    A G  +G SWT +E +RL P LI +A F+   + WP+
Sbjct: 20 RSLSSTAR--TQAQGR-IGPSWTIAEIKRLTPTLIGWASFLTVTLGWPF 65

>TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 62

 Score = 35.0 bits (79), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 23/39 (58%)

Query: 25 HHVGESWTKSETRRLAPNLITYALFIGTMVTWPYWVKEY 63
          +H  +SW  SE +RL P ++ +  F+   + WP+ +K +
Sbjct: 20 NHNSQSWAVSEAKRLTPAILGWGGFLAGCLGWPFAIKHF 58

>Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 75

 Score = 35.0 bits (79), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 24/38 (63%)

Query: 26 HVGESWTKSETRRLAPNLITYALFIGTMVTWPYWVKEY 63
          H+GESW  +E +R+ P +I +   +  +++WP+ +  Y
Sbjct: 33 HIGESWAVTEAKRVFPTIIGWGTTLTAILSWPFIIYHY 70

>YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}
          COX26Putative protein of unknown function; copurifies
          with respiratory chain supercomplexes composed of
          Complex III (ubiquinol-cytochrome c reductase) and
          Complex IV (cytochrome c oxidase)
          Length = 66

 Score = 34.7 bits (78), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 4/57 (7%)

Query: 1  MFIRLLRAGKEHATTARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWP 57
           F ++LR+    A   R     +G  +GESW  +E RRL P +  ++  +   + WP
Sbjct: 2  FFSQVLRSSARAAPIKR----YTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWP 54

>Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 34.7 bits (78), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 4/57 (7%)

Query: 1  MFIRLLRAGKEHATTARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWP 57
           F ++LR+    A   R     +G  VGESW  +E RRL P ++ ++  +   + WP
Sbjct: 2  FFSQVLRSSARAAPIKRY----TGGRVGESWVITEGRRLIPEVLQWSAALSICLGWP 54

>Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON}
          similar to Saccharomyces cerevisiae YDR119W-A
          Length = 74

 Score = 34.7 bits (78), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 16 ARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPYWVKEY 63
          ARR   A+  H+GE W  +ET+RL P ++ +   +  ++ WP   + Y
Sbjct: 23 ARRA--ATSKHIGEPWMVTETKRLVPTILIWGGTMTGILLWPIIFRVY 68

>Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A
          (REAL)
          Length = 65

 Score = 33.5 bits (75), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 1  MFIRLLRAGKEHATTARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPYWV 60
           F  +LR+    A   R     +G  VGESW  +E RRL P +  ++  +   + WP  V
Sbjct: 2  FFSEVLRSSARAAPIKR----YTGGRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAV 57

Query: 61 KEYS 64
            +S
Sbjct: 58 YFFS 61

>KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa]
          {ON} conserved hypothetical protein
          Length = 74

 Score = 32.7 bits (73), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 26/56 (46%)

Query: 8  AGKEHATTARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPYWVKEY 63
          A  + + +A RVV          W   E +RL P +  +  F+G ++ WP+ V+  
Sbjct: 17 AASQVSRSASRVVLKGPSSRARKWAVIEAKRLVPAIGMWGAFMGAVLGWPFAVRAL 72

>SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa]
          {ON} similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A Pi
          Length = 74

 Score = 32.3 bits (72), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 16 ARRVVYASGH-HVGESWTKSETRRLAPNLITYALFIGTMVTWPYWVKE 62
          A +V+  + H  +GE W  +E +RL P +  +   +  ++ WP+ VK+
Sbjct: 23 ASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAAVLGWPFAVKK 70

>TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 75

 Score = 31.2 bits (69), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 8  AGKEHATTARRVVYAS--GHHVGESWTKSETRRLAPNLITYALFIGTMVTWPY 58
          A +  A+ AR  +  S    +  ESW  +E +R+ PN+  +A  +   + WP+
Sbjct: 6  AARSSASMARMQLRRSFTRSYTQESWAVTEVKRIVPNIAFWATLLSVSLGWPF 58

>TPHA0F00720 Chr6 (162768..166619) [3852 bp, 1283 aa] {ON} Anc_4.129
           YAL002W
          Length = 1283

 Score = 31.2 bits (69), Expect = 0.16,   Method: Composition-based stats.
 Identities = 15/36 (41%), Positives = 19/36 (52%), Gaps = 7/36 (19%)

Query: 30  SWTKSETRRLAPNLIT-------YALFIGTMVTWPY 58
           S + S    L PN+I+       Y  F GT+VTWPY
Sbjct: 664 SSSPSLVHELEPNIISNAKLKINYVFFNGTLVTWPY 699

>KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 71

 Score = 29.6 bits (65), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 26/48 (54%)

Query: 22 ASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPYWVKEYSYVTHG 69
          +SG  VG  + ++E +R  P +  +   +  ++ WP++ K Y+   HG
Sbjct: 23 SSGGRVGPGFYRTEIKRRIPQVALWGSGLFLVLEWPFFFKWYNQWAHG 70

>NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 75

 Score = 29.3 bits (64), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 30/61 (49%), Gaps = 4/61 (6%)

Query: 1  MFIRLLRAGKEHATTARRVVYASGHHV----GESWTKSETRRLAPNLITYALFIGTMVTW 56
          +F  +L+    +    + V   + H +    G  W  SE +R+AP ++ ++ F+  ++ W
Sbjct: 2  LFNSVLKRSIRNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVVLGW 61

Query: 57 P 57
          P
Sbjct: 62 P 62

>ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON}
          similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A
          Length = 77

 Score = 29.3 bits (64), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 5/66 (7%)

Query: 1  MFIRLLRAGKEHAT--TARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPY 58
           F ++LR     AT   A+++  +S    GE W   E RRL+   + +A+ +  ++ WP 
Sbjct: 2  FFTQVLRNSAVSATKQAAKQISKSSA---GEQWGLLEARRLSRGAVEWAVSLSLILAWPA 58

Query: 59 WVKEYS 64
           + ++S
Sbjct: 59 AIIKFS 64

>Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74
          aa] {ON} ANNOTATED BY YGOB -
          Length = 74

 Score = 27.3 bits (59), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 11/44 (25%), Positives = 22/44 (50%)

Query: 18 RVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPYWVK 61
          RV++ +       W   E +R+ P +  +A  +  M+ WP+ V+
Sbjct: 27 RVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMTIMLGWPFGVR 70

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.133    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,674,650
Number of extensions: 234058
Number of successful extensions: 386
Number of sequences better than 10.0: 23
Number of HSP's gapped: 386
Number of HSP's successfully gapped: 23
Length of query: 75
Length of database: 53,481,399
Length adjustment: 47
Effective length of query: 28
Effective length of database: 48,092,097
Effective search space: 1346578716
Effective search space used: 1346578716
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)