Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19371g8.273ON80804143e-54
SAKL0H16786g8.273ON74701592e-15
Suva_2.2808.273ON66631252e-10
KLTH0G13442g8.273ON74701252e-10
Ecym_42978.273ON74671158e-09
Kpol_YGOB_YDR119W-A8.273ON75341122e-08
Skud_4.3808.273ON66631104e-08
TPHA0A017408.273ON79681104e-08
KLLA0F19382gsingletonON75661105e-08
YDR119W-A (COX26)8.273ON66631087e-08
TDEL0F040008.273ON62331087e-08
TBLA0F030308.273ON75641062e-07
Smik_4.3648.273ON65631052e-07
Kwal_YGOB_YDR119W-A8.273ON74701052e-07
CAGL0B01875g8.273ON7458992e-06
ZYRO0D06908g8.273ON7763983e-06
NDAI0J012908.273ON7564941e-05
KNAG0H031708.273ON7161780.003
SAKL0G04378g5.511ON26346670.27
KAFR0B054408.273ON6642610.86
NOTE: 2 genes in the same pillar as KLLA0F19371g were not hit in these BLAST results
LIST: NCAS0B03770 KAFR0B02760

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19371g
         (80 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some s...   164   3e-54
SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa] {...    66   2e-15
Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A ...    53   2e-10
KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa] {...    53   2e-10
Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON} s...    49   8e-09
Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON} A...    48   2e-08
Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A ...    47   4e-08
TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}...    47   4e-08
KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some s...    47   5e-08
YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}  COX26Putat...    46   7e-08
TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273...    46   7e-08
TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}...    45   2e-07
Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A ...    45   2e-07
Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74 a...    45   2e-07
CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar ...    43   2e-06
ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON...    42   3e-06
NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.27...    41   1e-05
KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}...    35   0.003
SAKL0G04378g Chr7 complement(360562..361353) [792 bp, 263 aa] {O...    30   0.27 
KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa] {O...    28   0.86 

>KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 80

 Score =  164 bits (414), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%)

Query: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVL 60
          MFFTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVL
Sbjct: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVL 60

Query: 61 GWPFLVRKADMDIGIHGMKQ 80
          GWPFLVRKADMDIGIHGMKQ
Sbjct: 61 GWPFLVRKADMDIGIHGMKQ 80

>SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa]
          {ON} similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A Pi
          Length = 74

 Score = 65.9 bits (159), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 50/70 (71%), Gaps = 2/70 (2%)

Query: 1  MFFTKALRSTATIAMNH-ATQTTTKTAVRSGR-RVGEAWAVTEARRLGPTILMYGTFIVS 58
          MF ++ LRSTA I+ +  A++  +K  +R+   R+GE WA+TEA+RL PTI ++G  + +
Sbjct: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60

Query: 59 VLGWPFLVRK 68
          VLGWPF V+K
Sbjct: 61 VLGWPFAVKK 70

>Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 52.8 bits (125), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 36/63 (57%), Gaps = 9/63 (14%)

Query: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVL 60
          MFF++ LRS+A  A              +G RVGEAW +TE+RRL P +  +G  I + L
Sbjct: 1  MFFSQVLRSSARAA---------PIKRYTGGRVGEAWMITESRRLIPEVFQWGAVICTCL 51

Query: 61 GWP 63
          GWP
Sbjct: 52 GWP 54

>KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa]
          {ON} conserved hypothetical protein
          Length = 74

 Score = 52.8 bits (125), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 3/70 (4%)

Query: 1  MFFTKALRSTAT---IAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIV 57
          M  ++ L+S AT   +A +  +++ ++  ++        WAV EA+RL P I M+G F+ 
Sbjct: 1  MLSSQILKSVATLQGVAASQVSRSASRVVLKGPSSRARKWAVIEAKRLVPAIGMWGAFMG 60

Query: 58 SVLGWPFLVR 67
          +VLGWPF VR
Sbjct: 61 AVLGWPFAVR 70

>Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON}
          similar to Saccharomyces cerevisiae YDR119W-A
          Length = 74

 Score = 48.9 bits (115), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVL 60
          M +++ L++ +TI  +  +    + A  S + +GE W VTE +RL PTIL++G  +  +L
Sbjct: 1  MLYSRILKAVSTIPKSPMSNIGARRAATS-KHIGEPWMVTETKRLVPTILIWGGTMTGIL 59

Query: 61 GWPFLVR 67
           WP + R
Sbjct: 60 LWPIIFR 66

>Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 75

 Score = 47.8 bits (112), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 18/34 (52%), Positives = 29/34 (85%)

Query: 33 VGEAWAVTEARRLGPTILMYGTFIVSVLGWPFLV 66
          +GE+WAVTEA+R+ PTI+ +GT + ++L WPF++
Sbjct: 34 IGESWAVTEAKRVFPTIIGWGTTLTAILSWPFII 67

>Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score = 47.0 bits (110), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 34/63 (53%), Gaps = 9/63 (14%)

Query: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVL 60
          MFF++ LRS+A  A              +G RVGE+W +TE RRL P +L +   +   L
Sbjct: 1  MFFSQVLRSSARAA---------PIKRYTGGRVGESWVITEGRRLIPEVLQWSAALSICL 51

Query: 61 GWP 63
          GWP
Sbjct: 52 GWP 54

>TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 79

 Score = 47.0 bits (110), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGR-RVGEAWAVTEARRLGPTILMYGTFIVSV 59
          MF     +STA IA     + ++  A   G   +GE+W +TEA+R+GP +L +G+ + +V
Sbjct: 1  MFSKIISQSTARIANRQIIRHSSNAAKTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTV 60

Query: 60 LGWPFLVR 67
          L WP  ++
Sbjct: 61 LLWPSFIK 68

>KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 75

 Score = 47.0 bits (110), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 5/66 (7%)

Query: 3  FTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVLGW 62
          F + LR+       HAT T  +    SG  VGE+W  +E RRL P ++ Y  FI +++ W
Sbjct: 2  FIRLLRA----GKEHAT-TARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTW 56

Query: 63 PFLVRK 68
          P+ V++
Sbjct: 57 PYWVKE 62

>YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}
          COX26Putative protein of unknown function; copurifies
          with respiratory chain supercomplexes composed of
          Complex III (ubiquinol-cytochrome c reductase) and
          Complex IV (cytochrome c oxidase)
          Length = 66

 Score = 46.2 bits (108), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 9/63 (14%)

Query: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVL 60
          MFF++ LRS+A  A              +G R+GE+W +TE RRL P I  +   +   L
Sbjct: 1  MFFSQVLRSSARAA---------PIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCL 51

Query: 61 GWP 63
          GWP
Sbjct: 52 GWP 54

>TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 62

 Score = 46.2 bits (108), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 25/33 (75%)

Query: 35 EAWAVTEARRLGPTILMYGTFIVSVLGWPFLVR 67
          ++WAV+EA+RL P IL +G F+   LGWPF ++
Sbjct: 24 QSWAVSEAKRLTPAILGWGGFLAGCLGWPFAIK 56

>TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 75

 Score = 45.4 bits (106), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 36/64 (56%), Gaps = 6/64 (9%)

Query: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVL 60
          M F  A RS+A++A     ++ T++  +      E+WAVTE +R+ P I  + T +   L
Sbjct: 1  MLFQHAARSSASMARMQLRRSFTRSYTQ------ESWAVTEVKRIVPNIAFWATLLSVSL 54

Query: 61 GWPF 64
          GWPF
Sbjct: 55 GWPF 58

>Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A
          (REAL)
          Length = 65

 Score = 45.1 bits (105), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 9/63 (14%)

Query: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVL 60
          MFF++ LRS+A  A              +G RVGE+W +TE RRL P +  +   +   L
Sbjct: 1  MFFSEVLRSSARAA---------PIKRYTGGRVGESWVITEGRRLIPEVFQWSATLSICL 51

Query: 61 GWP 63
          GWP
Sbjct: 52 GWP 54

>Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74
          aa] {ON} ANNOTATED BY YGOB -
          Length = 74

 Score = 45.1 bits (105), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 1  MFFTKALRSTAT---IAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIV 57
          M  ++ LRS A    +A   A++  ++   ++       WAV EA+R+ PT+ M+ T + 
Sbjct: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60

Query: 58 SVLGWPFLVR 67
           +LGWPF VR
Sbjct: 61 IMLGWPFGVR 70

>CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar
          to uniprot|Q2V2P9 Saccharomyces cerevisiae YDR119wa
          Length = 74

 Score = 42.7 bits (99), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 7  LRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVLGWPF 64
          +R     +M  +  +T +T  +   R+G +W + E +RL PT++ + +F+   LGWPF
Sbjct: 10 MRYVMNSSMTRSLSSTARTQAQG--RIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPF 65

>ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON}
          similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A
          Length = 77

 Score = 42.4 bits (98), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 6/63 (9%)

Query: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVL 60
          MFFT+ LR++A  A   A +  +K++       GE W + EARRL    + +   +  +L
Sbjct: 1  MFFTQVLRNSAVSATKQAAKQISKSSA------GEQWGLLEARRLSRGAVEWAVSLSLIL 54

Query: 61 GWP 63
           WP
Sbjct: 55 AWP 57

>NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 75

 Score = 40.8 bits (94), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGRRV-GEAWAVTEARRLGPTILMYGTFIVSV 59
          M F   L+ +  I      Q  T  A  + R V G  W  +E +R+ PTIL + TF+V V
Sbjct: 1  MLFNSVLKRS--IRNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVV 58

Query: 60 LGWP 63
          LGWP
Sbjct: 59 LGWP 62

>KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 71

 Score = 34.7 bits (78), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 30/61 (49%)

Query: 7  LRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVLGWPFLV 66
           RS  + ++   ++        SG RVG  +  TE +R  P + ++G+ +  VL WPF  
Sbjct: 2  FRSQVSKSLQRMSKPIGLRYASSGGRVGPGFYRTEIKRRIPQVALWGSGLFLVLEWPFFF 61

Query: 67 R 67
          +
Sbjct: 62 K 62

>SAKL0G04378g Chr7 complement(360562..361353) [792 bp, 263 aa]
          {ON} similar to uniprot|Q03433 Saccharomyces cerevisiae
          YML041C VPS71 Protein of unknown function component of
          the Swr1p complex that incorporates Htz1p into
          chromatin required for vacuolar protein sorting
          Length = 263

 Score = 30.4 bits (67), Expect = 0.27,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 25/46 (54%)

Query: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLG 46
          ++FT    +  + + N  T+TTT +  R+ RRV  + A  EA+  G
Sbjct: 16 VYFTSVNAAAPSSSKNRITKTTTSSGSRNNRRVNYSLADLEAKMYG 61

>KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa]
          {ON} Anc_8.273 YDR119W-A
          Length = 66

 Score = 28.1 bits (61), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 24/42 (57%)

Query: 25 TAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVLGWPFLV 66
          T+    + +G  +   +A++   TI  +GTF++  LGWP ++
Sbjct: 19 TSKTHAQHIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVI 60

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.133    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,138,758
Number of extensions: 163226
Number of successful extensions: 522
Number of sequences better than 10.0: 20
Number of HSP's gapped: 521
Number of HSP's successfully gapped: 20
Length of query: 80
Length of database: 53,481,399
Length adjustment: 52
Effective length of query: 28
Effective length of database: 47,518,767
Effective search space: 1330525476
Effective search space used: 1330525476
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)