Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19316g8.270ON67167134760.0
Ecym_43008.270ON7153583501e-33
AGR078C8.270ON7155213472e-33
SAKL0H16852g8.270ON6445632073e-16
Kwal_56.237668.270ON7403511672e-11
YDR118W (APC4)8.270ON6522031387e-08
KLTH0G13508g8.270ON6452011351e-07
CAGL0B01859g8.270ON6223141332e-07
TPHA0J007908.270ON6853201332e-07
KNAG0H031908.270ON6222161271e-06
Smik_4.3628.270ON6483941234e-06
Suva_2.2778.270ON6491961191e-05
TBLA0C045708.270ON6081531047e-04
KAFR0B054608.270ON6102151020.001
Skud_4.3788.270ON6521961010.001
ZYRO0C01474g8.270ON599292990.003
TDEL0F039708.270ON619280970.005
NCAS0B037908.270ON612203900.029
KNAG0G022508.295ON492879870.10
KAFR0J017102.231ON84885850.13
Kpol_392.18.270ON424208840.17
Smik_9.87na 1ON632120751.9
Kwal_55.209437.154ON123055742.7
SAKL0G11110g5.267ON187170743.4
CAGL0L07084g2.368ON438115715.1
NOTE: 1 genes in the same pillar as KLLA0F19316g were not hit in these BLAST results
LIST: NDAI0J01270

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19316g
         (671 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...  1343   0.0  
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...   139   1e-33
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...   138   2e-33
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...    84   3e-16
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...    69   2e-11
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...    58   7e-08
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...    57   1e-07
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...    56   2e-07
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....    56   2e-07
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...    54   1e-06
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...    52   4e-06
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...    50   1e-05
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...    45   7e-04
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...    44   0.001
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...    44   0.001
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...    43   0.003
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...    42   0.005
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...    39   0.029
KNAG0G02250 Chr7 complement(507525..522311) [14787 bp, 4928 aa] ...    38   0.10 
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    37   0.13 
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...    37   0.17 
Smik_9.87 Chr9 (168203..170101) [1899 bp, 632 aa] {ON} YIL092W (...    33   1.9  
Kwal_55.20943 s55 complement(620378..624070) [3693 bp, 1230 aa] ...    33   2.7  
SAKL0G11110g Chr7 complement(942330..947945) [5616 bp, 1871 aa] ...    33   3.4  
CAGL0L07084g Chr12 complement(790871..792187) [1317 bp, 438 aa] ...    32   5.1  

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score = 1343 bits (3476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 655/671 (97%), Positives = 655/671 (97%)

Query: 1   MSFSIDSELLLQKYACGYSATVSDDQSLVCLWNVHNNIEIYRTNGGYLINRLNDEIQNHR 60
           MSFSIDSELLLQKYACGYSATVSDDQSLVCLWNVHNNIEIYRTNGGYLINRLNDEIQNHR
Sbjct: 1   MSFSIDSELLLQKYACGYSATVSDDQSLVCLWNVHNNIEIYRTNGGYLINRLNDEIQNHR 60

Query: 61  LIDVVWHGNDLFCCYNSGTVSIYREGRELVKQLTFIPKGAKTKCILCDNLVPSDDRYSLS 120
           LIDVVWHGNDLFCCYNSGTVSIYREGRELVKQLTFIPKGAKTKCILCDNLVPSDDRYSLS
Sbjct: 61  LIDVVWHGNDLFCCYNSGTVSIYREGRELVKQLTFIPKGAKTKCILCDNLVPSDDRYSLS 120

Query: 121 DGNLLNSMPKLNKWDMIKNELDNELILNSELGKKKPIDIFMAIDSKTNKLILSIEGTLNI 180
           DGNLLNSMPKLNKWDMIKNELDNELILNSELGKKKPIDIFMAIDSKTNKLILSIEGTLNI
Sbjct: 121 DGNLLNSMPKLNKWDMIKNELDNELILNSELGKKKPIDIFMAIDSKTNKLILSIEGTLNI 180

Query: 181 KVGEKLKLPKDIKRIIKVSSGKYMCLGKDWSYQVLDLTFLQDPNIYKLIKTTQEYSALLR 240
           KVGEKLKLPKDIKRIIKVSSGKYMCLGKDWSYQVLDLTFLQDPNIYKLIKTTQEYSALLR
Sbjct: 181 KVGEKLKLPKDIKRIIKVSSGKYMCLGKDWSYQVLDLTFLQDPNIYKLIKTTQEYSALLR 240

Query: 241 YLKQLHRHLRMKLTEPYFEFVETLLKEEHKNALQELFYIGVTKLEVMEELHEVQLQTFRL 300
           YLKQLHRHLRMKLTEPYFEFVETLLKEEHKNALQELFYIGVTKLEVMEELHEVQLQTFRL
Sbjct: 241 YLKQLHRHLRMKLTEPYFEFVETLLKEEHKNALQELFYIGVTKLEVMEELHEVQLQTFRL 300

Query: 301 DKWSALSNDLCSNSIGLMVACTIPLLERMIVLAASIEALCEAITWIKFPNEIWVGSKLRE 360
           DKWSALSNDLCSNSIGLMVACTIPLLERMIVLAASIEALCEAITWIKFPNEIWVGSKLRE
Sbjct: 301 DKWSALSNDLCSNSIGLMVACTIPLLERMIVLAASIEALCEAITWIKFPNEIWVGSKLRE 360

Query: 361 RTVETLKSVRSQTDSIMKNKKTQELGLMWIRSLSDSLSKMERNRDQISPPEPEXXXXXXX 420
           RTVETLKSVRSQTDSIMKNKKTQELGLMWIRSLSDSLSKMERNRDQISPPEPE       
Sbjct: 361 RTVETLKSVRSQTDSIMKNKKTQELGLMWIRSLSDSLSKMERNRDQISPPEPETTNGSNN 420

Query: 421 XXXXXXXXXITGEDSKTLQKRADINTVEKFLAKDLLPEKQYEWVKTSFPNLILETQAEFD 480
                    ITGEDSKTLQKRADINTVEKFLAKDLLPEKQYEWVKTSFPNLILETQAEFD
Sbjct: 421 FSFFGSSTGITGEDSKTLQKRADINTVEKFLAKDLLPEKQYEWVKTSFPNLILETQAEFD 480

Query: 481 KIIKDYTLKWLKRQMSVEFDQTRNIQTGDNVDQICDIRILRHEDSSKRALLVTPTELILL 540
           KIIKDYTLKWLKRQMSVEFDQTRNIQTGDNVDQICDIRILRHEDSSKRALLVTPTELILL
Sbjct: 481 KIIKDYTLKWLKRQMSVEFDQTRNIQTGDNVDQICDIRILRHEDSSKRALLVTPTELILL 540

Query: 541 NLQTQKIDVRSPLPLPSHKVAMTLTRHNTDPAALPLKKQQYKNPRLQLVPISAGQPSLST 600
           NLQTQKIDVRSPLPLPSHKVAMTLTRHNTDPAALPLKKQQYKNPRLQLVPISAGQPSLST
Sbjct: 541 NLQTQKIDVRSPLPLPSHKVAMTLTRHNTDPAALPLKKQQYKNPRLQLVPISAGQPSLST 600

Query: 601 APVQNITEEVFFLLPLCQTVTVFIETAVASNTDSILSPDGRSHSLAVDHLPHSADLTGES 660
           APVQNITEEVFFLLPLCQTVTVFIETAVASNTDSILSPDGRSHSLAVDHLPHSADLTGES
Sbjct: 601 APVQNITEEVFFLLPLCQTVTVFIETAVASNTDSILSPDGRSHSLAVDHLPHSADLTGES 660

Query: 661 HDLHRHTIRIV 671
           HDLHRHTIRIV
Sbjct: 661 HDLHRHTIRIV 671

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score =  139 bits (350), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 92/358 (25%), Positives = 173/358 (48%), Gaps = 40/358 (11%)

Query: 158 DIFMAIDSKTNKLILSIEGTLNIKVGEKLKLPKDIKRIIKVSSGKYMCLG-KDWSYQVLD 216
           ++F+  D+ T K+++SI+GT N + GEK K P  +  I+  ++  Y+ L  +DW  Q++ 
Sbjct: 179 NMFLTYDNATRKVMVSIDGTFNFRYGEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIK 238

Query: 217 LTFLQDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEHKN----A 272
           L F +   +++L+K   +   L++YL+  H+ + +KL EP+  F+ +L  +E  +     
Sbjct: 239 LEFTESHQMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKG 298

Query: 273 LQELFYIGVTKLEVMEELHEVQLQTFRLDKWSALSNDLCSNSIGLMVACTIPLLERMIVL 332
           L+++FY+G +  + +E    ++L    +  W   ++   S+S G++V C IP  ER+IV 
Sbjct: 299 LKDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVA 358

Query: 333 AASIEALCEAITWIKFP---NEIWVGSKLRE---RTVETLKSVRSQTDSIMKNKKTQELG 386
              ++ L +++    F    +E  +  ++ E     ++TL  +  Q +     +     G
Sbjct: 359 VKRLQGLIKSLKLNIFGLDDDEELIAPEVDELLQMGLDTLTEIVKQVEKFHIGENMSIDG 418

Query: 387 LMWIRSLSDSLSKMERNRDQISPPEPEXXXXXXXXXXXXXXXXITGEDSKTLQKRADINT 446
           L WI  + DSL + E +    S                       G+D         ++T
Sbjct: 419 LTWIEYMIDSLLRGEEDDGNNS----------------------NGQDCALSNDVDALDT 456

Query: 447 VEK-------FLAKDLLPEKQYEWVKTSFPNLILETQAEFDKIIKDYTLKWLKRQMSV 497
             K       FL   +LP + Y+W+K  FPN +     +FD + K+YT KW+K+ + V
Sbjct: 457 YPKEHYSTQLFLNNFVLPTQTYKWIKNDFPNKLESLIRQFDLVQKNYTAKWIKKMIKV 514

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score =  138 bits (347), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 130/521 (24%), Positives = 229/521 (43%), Gaps = 82/521 (15%)

Query: 29  VCLWNVHNN--IEIYRTNGGYLINRLNDEI-QNHRLIDVVWHGND--LFC-CYNSGTVSI 82
           + LW V     + I+R   G  +  +   + QN  L+   W  +D  LF     SG+V I
Sbjct: 24  LSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELLRCQWEPDDGELFAVALRSGSVKI 83

Query: 83  YR-----------EGRELVKQLTFIPKGAKTKCILCDNLVPSDDRYSLS-------DGNL 124
           YR           EG ELV  +       +      +  V +  ++ +        D  L
Sbjct: 84  YRGRLDPEGTEGSEGAELVGTVVL----GRGDAFQMEQFVWNRIKWRVREPFCGEFDSPL 139

Query: 125 LNSMPKLNKWDMIKNELDNELILNSELGKKKP----------IDIFMAIDSKTNKLILSI 174
           +  +P+L +  +         +L + LG + P           ++F+  D+ T K++LSI
Sbjct: 140 VQWLPRLTEMSISAQGK----LLCTPLGYEGPEWNAGLAADESNMFLTFDNNTRKVVLSI 195

Query: 175 EGTLNIKVGEKLKLPKDIKRIIKVSSGKYMCLG-KDWSYQVLDLTFLQDPNIYKLIKTTQ 233
           +GT N + GEK K P  +  I+  +   Y+ +  +DW  QV+ L F +   +++L+K   
Sbjct: 196 DGTFNFRYGEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRLEFTEYHQVHELMKCCS 255

Query: 234 EYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEH----KNALQELFYIGVTKLEVMEE 289
               LL+Y++  HR +  KL EP+  F  +L  EE        L+++FY+G +  + +E 
Sbjct: 256 HIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQFTKFMKGLKDVFYLGYSDDKTVEN 315

Query: 290 LHEVQLQTFRLDKWSALSNDLCSNSIGLMVACTIPLLERMIVLAASIEALCEAITWIKFP 349
              ++L       W   ++   S+S G++V C IP  ER+IV A  +  L +++    F 
Sbjct: 316 WFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRLLGLVKSLKLNVFG 375

Query: 350 ----NEIWV--GSKLRERTVETLKSVRSQTDSIMKNKKTQELGLMWIRSLSDSLSKMERN 403
               NE+       L + ++  LK +  Q +     +   + GL WI  + DSL     N
Sbjct: 376 LDDDNELTAVEVQDLLQMSLGLLKGLVEQVEQFHVGENVSKDGLAWIEYMMDSLL---HN 432

Query: 404 RDQISPPEPEXXXXXXXXXXXXXXXXITGED---SKTLQKR----ADINTVEKFLAKDLL 456
            D+ +                     + G+D   S  L        +  +V+ FL + ++
Sbjct: 433 EDEDA-------------------HNLNGQDGLFSSDLDPHEVYPKEHYSVQLFLNEYII 473

Query: 457 PEKQYEWVKTSFPNLILETQAEFDKIIKDYTLKWLKRQMSV 497
           P+K Y W+K+ FP+ +     +FD + K+YT KW+K+ + V
Sbjct: 474 PKKPYSWIKSDFPSQLEVLMRQFDLVQKNYTAKWIKKLIKV 514

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 111/563 (19%), Positives = 227/563 (40%), Gaps = 95/563 (16%)

Query: 31  LWNVHNNIEIYRTNGGYLINRLND-------EIQNH-RLIDVVWH---GNDLFCCYNSGT 79
           +WN   ++ +  T  G  +NR  D        +++H  ++D  W    G     C+++G 
Sbjct: 19  VWNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGI 78

Query: 80  VSIYREGRELVKQLTFIPKGAKTKCILCDNL--VPSDDRYSLS-------DGNLLNSMPK 130
           + +Y +     K +  +  G       CD L    S D ++         D  + + MP+
Sbjct: 79  IRLY-DSSLAGKSVGSVILGDSD----CDVLKFCWSQDSWTFGSKFSNVFDHEITSLMPR 133

Query: 131 LNKW-------DMIKNELDNELILNSELGKKKPIDIFMAIDSKTNKLILSIEGTLN---- 179
           L K+        M+  ++ + +   S+L   K   IF+  DSK  K++++I+G       
Sbjct: 134 LVKFVKDSRQLTMLPTDVGDGVPRWSKLDGNKSF-IFLGYDSKRQKILMAIDGAFKLSFS 192

Query: 180 ----IKVGEKL----KLPKDIKRIIKVSSGKYMCLGKDWSYQVLDLTFLQDPNIYKLIKT 231
               +  GE+L     +P +++ I+K  +G+Y+ +  DW  Q +   FL      ++I  
Sbjct: 193 VAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFDFLNCNLTREMISC 252

Query: 232 TQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEHKNA---LQELFYIGVTKLEVME 288
                +L + L +    ++ +L EPY +F+E +L     +    L EL + G    E +E
Sbjct: 253 CNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLGAYEGDLIGDLTELLFTGSVPPE-LE 311

Query: 289 ELHEVQLQTFRLDKWSALSNDLCSNSIGLMVACTIPLLERMIVLAASIEALCEAITWIKF 348
           +     +    L +W  LS+ +  N++ +MV   +P+ ER+I+    +  + + +  I  
Sbjct: 312 DWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHGIIKGLKLIGL 371

Query: 349 PN-----EIWVGSKLRERTVETLKSVRSQTDSIMKNKKTQELGLMWIRSLSDSLSKMERN 403
                  E+    KL   + E L+++      I  +    E  + W   +      ME  
Sbjct: 372 KELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMV-----ME-- 424

Query: 404 RDQISPPEPEXXXXXXXXXXXXXXXXITGEDSKTLQKRADINTVEKFLAKDLLPEKQYEW 463
                                     +  +  +      D   +++F++  L     YEW
Sbjct: 425 -------------------------AVDEDYKRKTSYNCDPLKIQQFMSGSLTGVHTYEW 459

Query: 464 VKTSFPNLILETQAEFDKIIKDYTLKWLKRQMSVEFDQTRNIQTGDNVDQICDIRI---- 519
            + SFP +      +F+ + + Y   W+ ++  V+F +   I+ G    ++ D+ +    
Sbjct: 460 CQYSFPAVTNRLGKQFETVEQLYVANWVVQR--VKFGEPICIKKGLEKTRVKDVGVDTGK 517

Query: 520 ---LRHEDSSKRALLVTPTELIL 539
                ++D+  + L+V+   L L
Sbjct: 518 QLLFLYQDNDSKELVVSKYSLDL 540

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/351 (21%), Positives = 158/351 (45%), Gaps = 42/351 (11%)

Query: 31  LWNVHNNIEIYRTNGGYLINRLNDEIQ--------NHRLIDVVWHGND--LFCCYNS-GT 79
           +WN   ++ +  T+    +NR+ D  Q         H ++ + W  N+  LF  + S G 
Sbjct: 20  VWNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGV 79

Query: 80  VSIY--REGRELVKQLTFIPKGAKTKCILCDNLV-------PSDDRYSLSDGNLLNSMPK 130
           V IY    G  L + +  + +G   + +  D +V          + Y   D ++   MP 
Sbjct: 80  VRIYDCSIGGSLREMVNLVEEGQAAE-VKVDAVVWMTVEWAKFPESYRGLDFDITTLMPG 138

Query: 131 LNKWDMIKNELDNELILNSEL----GKKKPIDIFMAIDSKTNKLILSIEGTLNIKVGEKL 186
           + +      +L    +   +L    GK     IF+A D ++ + +++I+G L+      L
Sbjct: 139 MVRLVRDSKQLSLAPLDLGKLSWLDGKYGDAAIFLAHDCESTEYMVAIDGQLS------L 192

Query: 187 KLPKDIKRIIKV----SSGKYMCLGKDWSYQVLDLTFLQDPNIYKLIKTTQEYSALLRYL 242
           + P  I+ + K+     SG ++ +GKD + Q + L FL+   + +L+K++ +   L RYL
Sbjct: 193 RFPSGIRNVHKILPQGGSGSFLAVGKDGTLQWVTLKFLECALMRELVKSSGQIRFLCRYL 252

Query: 243 KQLHRHLRMKLTEPYFEFVETLL----KEEHKNALQELFYIGVTKLEVMEEL-HEVQLQT 297
            +       +L EPY  F+  L+     ++    L+++   G    ++ E L + V  + 
Sbjct: 253 AENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLRDILLTGYIPDDLEEWLCNSVGDKN 312

Query: 298 FRLDKWSALSNDLCSNSIGLMVACTIPLLERMIVLAASIEALCEAITWIKF 348
           ++  +W  LS  +  +   ++    +P  ER+I+ A  ++ + +++   +F
Sbjct: 313 YK--RWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRF 361

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score = 57.8 bits (138), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/203 (21%), Positives = 93/203 (45%), Gaps = 10/203 (4%)

Query: 150 ELGKKKPIDIFMAIDSKTNKLILSIEGTLNIKVG-EKLKLPKDIKRIIKVSSGKYMCLGK 208
           +L   + +D+ +  +   +K+ +   G   + +  + ++    +K IIKV  G Y C  +
Sbjct: 152 DLDSNEKLDVHVVFNEGNDKITVFFNGDYAVFLSVDNIENENSLKSIIKVQDGFYQCFYE 211

Query: 209 DWSYQVLDLT-FLQDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKE 267
           D + Q L+L   LQ  +   L+        L+ Y+      +  +L  PY +FV+ L  E
Sbjct: 212 DGTVQTLNLGPLLQSKSSVNLLNYIMVIKELIGYMLTHLEFINRELATPYLDFVKRLCDE 271

Query: 268 EH-----KNALQELFYIGVTKLEVMEEL-HEVQLQTFRLDKWSALSNDLCSNSIGLMVAC 321
            +     K+ L+ LF +G    ++ + L + V  + F+  +W  L  +    ++ ++   
Sbjct: 272 AYGYGKLKSELEALFLLGEISCDLEDWLCNSVGEKNFK--RWKYLGCEAYQKTVQILTLI 329

Query: 322 TIPLLERMIVLAASIEALCEAIT 344
            +P  ER+I+    + A+ +A +
Sbjct: 330 FVPACERIIIYVEKLRAILQAFS 352

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 89/201 (44%), Gaps = 13/201 (6%)

Query: 155 KPIDIFMAIDSKTNKLILSIEGTLNIKVGEKLKLPKDIKRIIKV----SSGKYMCLGKDW 210
           K   IF+  D K+   +++++G L+++V      P  IK++ K+      G ++ +G D 
Sbjct: 167 KDAAIFLGHDEKSGDYLMTVDGLLSVRV------PSGIKKMHKILRQGEDGTFVGVGADG 220

Query: 211 SYQVLDLTFLQDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEHK 270
           + Q + L FL    + +LI+ + +   L  YL +     +  L EPY +F+  +      
Sbjct: 221 TVQWVVLRFLNSALMRELIRYSGQIRFLCSYLTENINMCKTDLIEPYRQFLTRIADAYEG 280

Query: 271 NALQELFYIGVTKLEVMEELHEVQLQTF---RLDKWSALSNDLCSNSIGLMVACTIPLLE 327
             L   F   +    + E+L +    +       +W  LS  +  +   ++    IP  E
Sbjct: 281 GELASRFRDIILSGYIPEDLEDWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACE 340

Query: 328 RMIVLAASIEALCEAITWIKF 348
           R+I+ A  ++ + + +   +F
Sbjct: 341 RLILAAEQLQGIHKGLKLQEF 361

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 130/314 (41%), Gaps = 37/314 (11%)

Query: 61  LIDVVWH---GNDLFCCYNSGTVSIYR--EGRELVKQLTFIP-----KGAKTKCILCDNL 110
           L+D  W    G  L      G+V IY    G +L+  L  +P           C L D +
Sbjct: 51  LLDYFWDPIDGKYLALFLKDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRI 110

Query: 111 V---PSDDRYSLSDGNLLNSMPKLNKW-------DMIKNELDNELILNSELGKKKPIDIF 160
           +          + + +L  SMP L K+       D+I N    +L  +    +KK +D+ 
Sbjct: 111 IIPKSGSSELRIPNNDLTESMPTLVKFVQDAKQIDIIPNRSITKLWRSIGNNEKKVVDVH 170

Query: 161 MAIDSKTNKLILSIEGTLNIKVGEKLKLPKDIKRI---IKVSSGK-------YMCLGKDW 210
           +     + ++ + I G   I+     K   DI +I   I +S  K       Y     D+
Sbjct: 171 LGYSCSSAQVTILINGEYLIE-----KSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDY 225

Query: 211 SYQVLDLT-FLQDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEH 269
           S   +DLT  L + +   LI+T  + +     +K     +   +  PY+EF+E++     
Sbjct: 226 SRLQIDLTGILLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIGGIND 285

Query: 270 KNALQELFYIGVTKLEVMEELHEVQLQTFRLDKWSALSNDLCSNSIGLMVACTIPLLERM 329
            + L+ LF IG    ++     E  +    L KWS L N+  SN   +++   +P+ ER+
Sbjct: 286 LDVLERLFLIGELDTKLGNWFKET-INEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERL 344

Query: 330 IVLAASIEALCEAI 343
           +VL   I  + + I
Sbjct: 345 MVLTNRINGMIKGI 358

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/320 (21%), Positives = 144/320 (45%), Gaps = 40/320 (12%)

Query: 61  LIDVVWH---GNDLFCCYNSGTVSIYREGRELVKQLTFIPKGAK-TKCILCDNLVPS--- 113
           ++D  W    G  L   +N G++ +Y +  +L + ++F     K  KC+  D ++ +   
Sbjct: 51  VVDFFWDSITGKFLLFAFNDGSIRVY-DIFKLGRLVSFFRSPLKQIKCVYWDRIIITETL 109

Query: 114 DDRYSLSDGNLLNSMPKLNKW----------DMIKN-----ELDNELILN-----SELGK 153
           D +  + D +L NSMP L K+           ++KN     ++D +L L      +E+  
Sbjct: 110 DQQLKIFDYDLTNSMPTLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVST 169

Query: 154 KKPIDI-FMAIDSKTNKLILSIEGTLNIK-VGEKLKLPKDIKRIIKVSSGKYMCLGKDWS 211
              +DI  +  +S  +   + + G  ++  +    + P  + +++K S GKY+   ++ S
Sbjct: 170 DDVLDIHLLYTESGMDNFAVLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENAS 229

Query: 212 YQVLDLTFLQDPNI-YKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEHK 270
           Y+++D+T     +I   L+  + +    +  LK+    ++ +L  P+  F+  +  + ++
Sbjct: 230 YRLIDVTPFSSNDIRVNLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYE 289

Query: 271 NALQELFYIGVTKL----EVMEELHEVQLQTF---RLDKWSALSNDLCSNSIGLMVACTI 323
               +  Y  +T L    E+ EE  +  + T     L KW  L  +L    + ++    I
Sbjct: 290 GY--DNLYRSMTNLLLTGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFI 347

Query: 324 PLLERMIVLAASIEALCEAI 343
           P+ E+ I+ A  I+    A+
Sbjct: 348 PITEKFIITAERIQNYITAM 367

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 101/216 (46%), Gaps = 14/216 (6%)

Query: 191 DIKRIIKVSSGK---YMCLGKDWSYQVLDLT-FLQDPNIYKLIKTTQEYSALLRYLKQLH 246
           ++++II  +  K   Y C  K    + +DLT F++D +  KL++    +   L Y     
Sbjct: 196 ELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLGYFLAHL 255

Query: 247 RHLRMKLTEPYFEFVETLL-----KEEHKNALQELFYIGVTKLEVMEELHEVQLQTFRLD 301
             ++ +  EPY EF+E L      KE+ + +L + F +G    E+ + L    L    L+
Sbjct: 256 EPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWL-VYSLGERNLE 314

Query: 302 KWSALSNDLCSNSIGLMVACTIPLLERMIVLAASIEALCEAI----TWIKFPNEIWVGSK 357
           +W +L N     +  +++ C +P+ ER+I+L   ++AL          +    EI   + 
Sbjct: 315 EWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLEISEFTD 374

Query: 358 LRERTVETLKSVRSQTDSIMKNKKTQELGLMWIRSL 393
           L E   E L+ V      + K+ K  ++ L+W+ ++
Sbjct: 375 LLENCQELLQLVLQTVKQLAKDIKDIKVFLLWLENV 410

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 92/394 (23%), Positives = 168/394 (42%), Gaps = 69/394 (17%)

Query: 42  RTNGGYLINRLNDE-------IQNHRLI-DVVWH---GNDLFCCYNSGTV---SIYREGR 87
           RT  G  INR++D        I+N  L+ +  W    G  L   +  GT+    I+++GR
Sbjct: 22  RTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKDGTIRIHDIFKDGR 81

Query: 88  ELVKQL----TFIPKGAKTKCILCDNLVPSDDRYSLSDGNLLNSMPKLNKW-------DM 136
            LV  L    T I KG   +  L       +  Y     N+++ +PKL ++       ++
Sbjct: 82  -LVSFLRIPSTKISKGTWDRIPLESESGNGNLAY-----NIIDYLPKLIRYVKDSKRINI 135

Query: 137 IKNELDNELILN---SELGKKKPIDIFMAIDSKTNKLILSIEG--TLNIKVGEKLKLPKD 191
           +     N L       E    + +DI +  +   +K+ +   G   + + VG   +  + 
Sbjct: 136 VPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDYAIFVPVGAD-ENERF 194

Query: 192 IKRIIKVSSGKYMCLGKDWSYQVLDLTFL--QDP--NIYKLIKTTQEYSALLRYLKQLHR 247
           +K I+K+  G Y C   D + + L+L  L   +P  NI K I   +E   L+ YL     
Sbjct: 195 VKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIKE---LIGYLLNHIE 251

Query: 248 HLRMKLTEPYFEFVETLLKEEHK-----NALQELFYIGVTKLEVMEEL-HEVQLQTFRLD 301
            +  +L  PY EFV  L  E +      + L+ LF +G    ++ + L + V  + F+  
Sbjct: 252 FINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLCNSVGEKNFK-- 309

Query: 302 KWSALSNDLCSNSIGLMVACTIPLLERMIVLAASIEALCEAITWIKFPNEIWVGSKLRER 361
           +W  L  +    +  ++    +P  ER+I+    +  + EA +         + +K  + 
Sbjct: 310 RWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFS---------IQNKFND- 359

Query: 362 TVETLKSVRSQTDSIMKNKKTQELGLMWIRSLSD 395
                 S  +  D+++KN  +QEL  + ++S+ D
Sbjct: 360 -----SSDLTAVDTLLKN--SQELLTITLKSIVD 386

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/196 (21%), Positives = 88/196 (44%), Gaps = 10/196 (5%)

Query: 157 IDIFMAIDSKTNKLILSIEGTLNIKVG-EKLKLPKDIKRIIKVSSGKYMCLGKDWSYQVL 215
           +DI +  +   +K+ +   G   I +    ++  K +K ++KV +G Y C   D +    
Sbjct: 155 LDIHVIFNEGNDKITVFFNGDYAILLPVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTF 214

Query: 216 DLT-FLQDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEH----- 269
           +L   LQ      L++       L+ YL      +  +LT PY +FV+ +  E +     
Sbjct: 215 NLERLLQSEPSVDLLRYMMVIKELIGYLLAHIEFINRELTTPYMDFVKRICDEAYGYSKL 274

Query: 270 KNALQELFYIGVTKLEVMEEL-HEVQLQTFRLDKWSALSNDLCSNSIGLMVACTIPLLER 328
           K+ L+ LF +G    ++ + L + V  + F+  +W  L  +    ++ +     +P  ER
Sbjct: 275 KSELKCLFLLGEVPSDLDDWLCNAVGEKNFK--RWKVLGCEAYQKTVQVFTLAFVPTCER 332

Query: 329 MIVLAASIEALCEAIT 344
           +I+    ++ + EA +
Sbjct: 333 IIIFVQKLKGILEAFS 348

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 68/153 (44%), Gaps = 4/153 (2%)

Query: 195 IIKVSSGKYMCLGKDWSYQVLDL-TFLQDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKL 253
           IIK  +  ++C  +D + +++D    LQ      L+      + LL+YLK+    ++  +
Sbjct: 195 IIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMFIKDNM 254

Query: 254 TEPYFEFVETLLKEEHKNALQELFYIGVTKLEVMEELHEVQLQTF---RLDKWSALSNDL 310
           + P+ EF+ ++  E  +  + E     +    +  EL E    T     L +W+ L    
Sbjct: 255 STPFNEFLTSVKGEATQEMMMENLITMLVSGYISTELEEWIRNTIGIKNLTRWATLGGIF 314

Query: 311 CSNSIGLMVACTIPLLERMIVLAASIEALCEAI 343
               + ++    IP  ER ++L A ++ L E +
Sbjct: 315 YEKGVDIITLMVIPACERFMILVARLQGLIEYV 347

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/215 (24%), Positives = 96/215 (44%), Gaps = 24/215 (11%)

Query: 147 LNSELGKKKPIDIFMAIDSKTNKLILSIEGT--LNIKVGE---KLKLPKDIKRIIKVSSG 201
           L+++  K + ID+     S+T+  ++ + G   L +K  E     K+P     +IK ++ 
Sbjct: 150 LDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYLTLKTPETDLSEKVPA--CSLIKSANS 207

Query: 202 KYMCLGKDWSYQVLDL-TFLQDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEF 260
            Y C+ KD S + +D  +FL   +   L++       + +Y +     L   + +PY +F
Sbjct: 208 LYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLKDMSKYTRNHLDLLERVIIKPYLDF 267

Query: 261 VETLL-----KEEHKNALQELFYIGVTKLEVMEELHEVQLQTFRLDKWSALSNDLCSN-- 313
           +E +      +E+  N L+  F +G    E+ + LH   +    + +W  L +D      
Sbjct: 268 LEKICDGAFGREKLINELKITFLLGTISDELQDWLH-YSVGDKNVTQWRTLCHDAYQQTT 326

Query: 314 ---SIGLMVACTIPLLERMIVLAASIEALCEAITW 345
              +I LM AC     ERMI+L+     L  A  +
Sbjct: 327 ELFTIALMCAC-----ERMILLSERCFGLIMAFQF 356

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/196 (20%), Positives = 85/196 (43%), Gaps = 10/196 (5%)

Query: 157 IDIFMAIDSKTNKLILSIEGTLNIKVG-EKLKLPKDIKRIIKVSSGKYMCLGKDWSYQVL 215
           +D+ +  +   +K+ +   G   I +  + ++  + ++ ++KV  G Y C   D S + L
Sbjct: 159 LDVHVIFNEGNDKITIFFNGDYTILLPMDDIENERILESVVKVQDGFYHCFYNDGSVRTL 218

Query: 216 DLTFL--QDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEH---- 269
           +L  L    P++  L+        L+ YL      +  +L  PY +FV+ +  E +    
Sbjct: 219 NLQPLLRSKPSV-DLLHYIMVIKELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNK 277

Query: 270 -KNALQELFYIGVTKLEVMEELHEVQLQTFRLDKWSALSNDLCSNSIGLMVACTIPLLER 328
            K+ L+ LF +G    ++ + L    +    L KW  L  +    +  ++    +P  ER
Sbjct: 278 LKSELECLFLLGEVSCDLEDWLCN-SVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCER 336

Query: 329 MIVLAASIEALCEAIT 344
           +I+    +    EA +
Sbjct: 337 IIIFVEKLRGTLEAFS 352

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 126/292 (43%), Gaps = 38/292 (13%)

Query: 68  GNDLFCCYNSGTVSIY---REGRELVKQLTFIPKGAKTKCILCDNLVPSDDR---YSLSD 121
           G  L   Y  GTV IY   R GR LV  L     GA +       L+ S++    +S+ D
Sbjct: 55  GKFLSIFYKDGTVRIYDGFRSGR-LVSLLRASSNGAVSGIWDRIELLHSEENIKDWSI-D 112

Query: 122 GNLLNSMPKLNKWDMIKNEL-DNELILNSELGKKKPIDIFMAI-DSKT----NKLILSIE 175
            ++   MPK+ K+     +L      L S++ + +  D   A+ D+      + L +  +
Sbjct: 113 HDVTEMMPKMVKFARDSRQLCVVPYTLPSDVWRPQAADDTNALLDAHVIRCHDSLSVMFD 172

Query: 176 GTLNIKVGEKLKLPKDIKRIIKVSSGKYMCLGKDWSYQVLDLT-FLQDPNIYKLIKTTQE 234
           G   I + +   +P  + + +  +  +Y+   +D S +  DL   ++DP   +L+K    
Sbjct: 173 GEFTISI-QLAAIPSPLVKFVS-AQHQYLAFYQDGSVERFDLANLVKDPFSLRLLKNVIT 230

Query: 235 YSALLRYLKQLHRHLRMKLTEPYFEFVE----------TLLKEEHKNALQELFYIGVTKL 284
              L RYL+     ++  L +PY EF+E           LL+E+    L +L  +G    
Sbjct: 231 MRQLHRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQ----LIDLMLVG---- 282

Query: 285 EVMEELHEVQLQTF---RLDKWSALSNDLCSNSIGLMVACTIPLLERMIVLA 333
           +V  EL +  + +     L +W  L  D    ++ ++    +P  ER+I L 
Sbjct: 283 DVTPELEDWLVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLG 334

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 61/280 (21%), Positives = 112/280 (40%), Gaps = 31/280 (11%)

Query: 121 DGNLLNSMPKLNKWD-------MIKNELDNE---LILNSELGKKKPIDIF--MAIDSKTN 168
           D  +LNSMPK+ ++        ++  E  N+   L    E G K+  +I     +  + N
Sbjct: 112 DHFVLNSMPKMIRFARDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQEDN 171

Query: 169 KLILSIEGTLNIKVGEKLKLPKDIKRIIKVSSGKYMCLGKDWSYQVLDL-TFLQDPNIYK 227
            L+L ++G   +++      P  +K I+    G Y C  +D + + L L   +Q     +
Sbjct: 172 GLVLMLDGDFILRLAAGPSGPA-LKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQ 230

Query: 228 LIKTTQEYSALLRYLKQLHRHLRMKLTEPYFEFVETLLKEEHKNALQELFYIGVTKLEVM 287
           LI+       L  YL+     ++  L  PY EF+  +        +       +     +
Sbjct: 231 LIQHFIAIKQLNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYEILHEELESLLLGGGL 290

Query: 288 EELHE------VQLQTFRLDKWSALSNDLCSNSIGLMVACTIPLLERMIVLAASIEALCE 341
               E      V  + F+  KW  +  ++   +I ++    IP  ER+I+L+    A  +
Sbjct: 291 SVELENWFCYTVGEKNFK--KWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLK 348

Query: 342 AITWI---------KFPNEIWVGSKLRERTVETLKSVRSQ 372
           A+  I         +F N   +       TVET++ V +Q
Sbjct: 349 ALQLIESSTTTDSSEFANLTSLSQTYLRSTVETIQGVSAQ 388

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 88/203 (43%), Gaps = 25/203 (12%)

Query: 157 IDIFMAIDSKTNKLILSIEGTLNIKV---GEKLKLPKDIKRIIKVS-SGKYMCLGKDWSY 212
           IDI MA +S T++ +L I G   + +            + +II +  +  + C  KD   
Sbjct: 160 IDIHMAHNSNTDEYLLMINGVYKLTIQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKT 219

Query: 213 QVLDLTFLQDPNIYKLIKTTQEYSAL--LRYLKQLHR----HLRM---KLTEPYFEFVET 263
             +DLT         L+++T   S L  L  +KQLHR    HL +    L +P  +F+E 
Sbjct: 220 STIDLT--------TLMESTPHVSLLNVLTEMKQLHRYIVDHLDIIDNDLKKPLDDFLEV 271

Query: 264 ---LLKEEHKNALQELFYIGVTKLEVMEELHEVQLQTFRLDKWSALSNDLCSNSIGLMVA 320
              L  ++   +L+     G+    +   L  V  +   L KW  LS       I ++  
Sbjct: 272 TNILNIKDLSKSLKSFILYGLMAKSLNHWLCNVVGEK-NLKKWKRLSETKYQKIIQIISL 330

Query: 321 CTIPLLERMIVLAASIEALCEAI 343
             +P LE++ +L+   EAL  AI
Sbjct: 331 AVLPALEKLSLLSIRCEALVVAI 353

>KNAG0G02250 Chr7 complement(507525..522311) [14787 bp, 4928 aa] {ON}
            Anc_8.295 YLR106C
          Length = 4928

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 43/79 (54%), Gaps = 10/79 (12%)

Query: 2    SFSIDSELLLQKYACGYSATVSDDQSL-----VCLWN--VHNNIEIYRTNGGYLINRLND 54
            + S+D+  L+ ++   YS+TVS +Q+      VC W+       E+++ N    INRLN+
Sbjct: 2985 AVSVDN--LIDEWNVFYSSTVSAEQASSLFNSVCEWDDIAEGRFEMFQQNSSSFINRLNN 3042

Query: 55   EIQNHRLIDVVWHGNDLFC 73
              QN   ++ ++ G  +FC
Sbjct: 3043 GYQNFADLNEIFAGY-VFC 3060

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {ON}
           Anc_2.231 YIL130W
          Length = 848

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 4/85 (4%)

Query: 476 QAEFDKIIKDYTLKWLKRQMSVEFDQTRNIQTGDNVDQICDIRILRHEDSSKRALLVTPT 535
           Q   D  I D  +  L +  ++ +D  +N    DN   I ++  L  ED  K ALL + +
Sbjct: 757 QNSRDDNINDRKIYGLDQASNLPYDAFKNNGENDNTGAIKNVEALSKEDREKFALLNSNS 816

Query: 536 EL--ILLNLQTQKID--VRSPLPLP 556
           ++  +   L TQ     VR+PLPLP
Sbjct: 817 DILNVFDELDTQLFGKYVRNPLPLP 841

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 40/208 (19%), Positives = 86/208 (41%), Gaps = 11/208 (5%)

Query: 191 DIKRIIKVSSGKYMCLGKDWSYQVLDLTFLQDPNIYK-LIKTTQEYSALLRYLKQLHRHL 249
           ++ +++K+ +G+YM   K+  Y+ ++   L   N+   L+    E   L RY+      +
Sbjct: 203 EVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILEIRNLNRYVNDHLDLI 262

Query: 250 RMKLTEPYFEFVETLLKEEHKNA-------LQELFYIGVTKLEVMEELHEVQLQTFRLDK 302
           + +L  PY +FV+ +  + +          L+ L   G    E  + L  + +      K
Sbjct: 263 KRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFKDWLVNI-IGDRNGKK 321

Query: 303 WSALSNDLCSNSIGLMVACTIPLLERMIVLAASIEALCEAITWIKFPNEIWVGSKLRERT 362
           W  L  D+    + ++    IP  ER ++     +       ++K   + +    LRE  
Sbjct: 322 WRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNG--YMKTDTDFYDIISLREYF 379

Query: 363 VETLKSVRSQTDSIMKNKKTQELGLMWI 390
            + +++  +  +S+    K  E+   WI
Sbjct: 380 SKLIRNSITIINSLNNQLKYFEIFSEWI 407

>Smik_9.87 Chr9 (168203..170101) [1899 bp, 632 aa] {ON} YIL092W
           (REAL)
          Length = 632

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 59/120 (49%), Gaps = 13/120 (10%)

Query: 450 FLAKDLLPEKQYEWVKTSFPN----LILETQAEFDKIIKDYTLKWLKRQMSVEFDQTRNI 505
           FL K L P+ Q E   + FP      +L T  EF K    +  +  +++ + +FD   + 
Sbjct: 196 FLTK-LEPQFQKELENSVFPMTLDMALLMTACEFAKRASSH--RKDRKKNTSDFDIGTSK 252

Query: 506 QTGDNVDQICDIRILRHEDS---SKRALLVTPTELILLNLQTQK---IDVRSPLPLPSHK 559
           +   N+++ C  +I+R  ++   S R    +  EL++ +L+ +K     ++ PL +P HK
Sbjct: 253 KRATNLNKKCKTKIIRENNTNRKSNRKKCFSEKELLIPDLKRRKQSECGIQFPLVVPEHK 312

>Kwal_55.20943 s55 complement(620378..624070) [3693 bp, 1230 aa] {ON}
            YER008C (SEC3) - SEC3 encodes the 144 kD and 91 kD
            components of the Exocyst complex; the 91 kD component is
            a C-terminal proteolytic breakdown product of full length
            Sec3p [contig 136] FULL
          Length = 1230

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%)

Query: 278  YIGVTKLEVMEELHEVQLQTFRLDKWSALSNDLCSNSIGLMVACTIPLLERMIVL 332
            Y   T + +++ELH      F+ +KWS  SN LC      M   T+ L  ++  L
Sbjct: 1148 YNSSTMMALIDELHGFVEADFQNEKWSEFSNSLCDKLWSYMQGQTVSLYLKLYTL 1202

>SAKL0G11110g Chr7 complement(942330..947945) [5616 bp, 1871 aa]
           {ON} similar to uniprot|P08964 Saccharomyces cerevisiae
           YHR023W MYO1 Type II myosin heavy chain required for
           wild- type cytokinesis and cell separation localizes to
           the actomyosin ring binds to myosin light chains Mlc1p
           and Mlc2p through its IQ1 and IQ2 motifs respectively
          Length = 1871

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 39/70 (55%), Gaps = 15/70 (21%)

Query: 343 ITWIKFPNEIWVGSKLRERTVETLKSVRSQTDSIMKNKKTQELGLMWIRSLSDSLSKMER 402
           + WI  P E++V ++L ER  +T+K  R+  D        QE+G++ I++      ++E 
Sbjct: 7   LVWIPDPTEVFVQAQLIER--KTVKDSRTNRD--------QEIGIVRIKN-----GEVEV 51

Query: 403 NRDQISPPEP 412
           + D+ISP  P
Sbjct: 52  SADEISPVNP 61

>CAGL0L07084g Chr12 complement(790871..792187) [1317 bp, 438 aa]
           {ON} some similarities with uniprot|Q12066 Saccharomyces
           cerevisiae YDL089w
          Length = 438

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 57/115 (49%), Gaps = 16/115 (13%)

Query: 193 KRIIKVSSGKYMCLGKDWSYQVLDLTFLQDPNIYKLIKTTQEYSALLRYLKQLH--RHLR 250
           KR+ KV+S  Y      WS   L L  L     Y+L  T + Y   + YLK L+  +H  
Sbjct: 104 KRVRKVTSTVY------WSTYFLLL--LSCYTCYRLFNTYKVYR--IYYLKDLNLDKHPS 153

Query: 251 MKLTEPYFEFVETLLKEEHKNALQELFYIGVTKL--EVMEELHEVQLQTFRLDKW 303
           +K  EP +E  E LLK   K+ L   F I + +L  EV  EL +V  + + L+KW
Sbjct: 154 LKKIEPDYEVDEKLLKTSLKSKLLSRF-IRLLQLQDEVETELPKVT-EHYTLNKW 206

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,532,737
Number of extensions: 3125967
Number of successful extensions: 10151
Number of sequences better than 10.0: 49
Number of HSP's gapped: 10497
Number of HSP's successfully gapped: 52
Length of query: 671
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 555
Effective length of database: 40,180,143
Effective search space: 22299979365
Effective search space used: 22299979365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)