Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19294g8.269ON57057030250.0
KLTH0G13530g8.269ON57456913331e-178
Suva_2.2768.269ON56557113281e-178
Skud_4.3778.269ON56256913031e-174
Kwal_56.237718.269ON56257712771e-170
YDR117C (TMA64)8.269ON56556312761e-170
SAKL0H16874g8.269ON56357012711e-169
Smik_4.3618.269ON56556312481e-166
NCAS0B038008.269ON56556912431e-165
ZYRO0C01496g8.269ON56756412401e-164
TDEL0F039608.269ON55856812381e-164
TPHA0J007808.269ON58357412011e-158
NDAI0J013108.269ON57958311951e-157
KAFR0B054708.269ON56256511931e-157
CAGL0B01837g8.269ON56956911671e-153
AGR079W8.269ON54257111431e-150
Ecym_43018.269ON56457811331e-148
Kpol_392.28.269ON56657111181e-146
TBLA0I032008.269ON56357610381e-134
KNAG0H032008.269ON5615759081e-115
SAKL0F04576g7.152ON180180830.076
Kwal_23.56755.299ON157104721.6
Kwal_33.136181.136ON89175752.0
Suva_5.291.483ON45474723.5
Skud_5.501.483ON46675705.6
KAFR0E005001.483ON43273706.0
Skud_12.4934.275ON93956706.6
SAKL0D02596gna 1ON75063699.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19294g
         (570 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...  1169   0.0  
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   518   e-178
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   516   e-178
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   506   e-174
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   496   e-170
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   496   e-170
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   494   e-169
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   485   e-166
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   483   e-165
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   482   e-164
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   481   e-164
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   467   e-158
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   464   e-157
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   464   e-157
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   454   e-153
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   444   e-150
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   441   e-148
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   435   e-146
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   404   e-134
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   354   e-115
SAKL0F04576g Chr6 (369113..369120,369587..370121) [543 bp, 180 a...    37   0.076
Kwal_23.5675 s23 (1269401..1269874) [474 bp, 157 aa] {ON} YHR041...    32   1.6  
Kwal_33.13618 s33 (321288..323963) [2676 bp, 891 aa] {ON} YJL198...    33   2.0  
Suva_5.29 Chr5 (53604..54968) [1365 bp, 454 aa] {ON} YEL040W (REAL)    32   3.5  
Skud_5.50 Chr5 (76203..77603) [1401 bp, 466 aa] {ON} YEL040W (REAL)    32   5.6  
KAFR0E00500 Chr5 (109532..110830) [1299 bp, 432 aa] {ON} Anc_1.4...    32   6.0  
Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {...    32   6.6  
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    31   9.4  

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score = 1169 bits (3025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/570 (100%), Positives = 570/570 (100%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQINEEYNLPTAVIKQTSFQVANVAGSIYTDES 60
           MFAKEPHIKPLSNLKNSDRKKLQSTIKRQINEEYNLPTAVIKQTSFQVANVAGSIYTDES
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQINEEYNLPTAVIKQTSFQVANVAGSIYTDES 60

Query: 61  NKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFPS 120
           NKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFPS
Sbjct: 61  NKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFPS 120

Query: 121 NVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKLE 180
           NVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKLE
Sbjct: 121 NVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKLE 180

Query: 181 LEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIEDV 240
           LEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIEDV
Sbjct: 181 LEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIEDV 240

Query: 241 DHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLKY 300
           DHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLKY
Sbjct: 241 DHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLKY 300

Query: 301 LEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKITAY 360
           LEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKITAY
Sbjct: 301 LEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKITAY 360

Query: 361 SGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKYDDT 420
           SGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKYDDT
Sbjct: 361 SGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKYDDT 420

Query: 421 LYQMSNRAPQNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPIPTLEI 480
           LYQMSNRAPQNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPIPTLEI
Sbjct: 421 LYQMSNRAPQNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPIPTLEI 480

Query: 481 VTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEVQVQGPHGS 540
           VTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEVQVQGPHGS
Sbjct: 481 VTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEVQVQGPHGS 540

Query: 541 IVISILNDYGIPTKWISFENKVKPKQKKKL 570
           IVISILNDYGIPTKWISFENKVKPKQKKKL
Sbjct: 541 IVISILNDYGIPTKWISFENKVKPKQKKKL 570

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  518 bits (1333), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 269/569 (47%), Positives = 372/569 (65%), Gaps = 17/569 (2%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQI-NEEYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF KEP IK LSNLKNS+RK +QS  K Q  + EY  P+ VIKQT+F+     G+++TD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
            N PIWFK KF D LYPT+F+ W+   +LLPI+L H++V+E+ +L GA LMLPGTVPPF 
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWS-NSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFD 119

Query: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179
               +  +V +AST  P +VKAIGI +++L   S VIG  G+AV +VH   D L K FK+
Sbjct: 120 ERCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKV 179

Query: 180 ELEPP---AVVYNSEPIETTAIETQTSKYGEQLDEESNHLERS--SSQSP---VNEIADE 231
           +L+PP   A + +SE  E   IE  T   G     ES    +S    Q P   V +I+++
Sbjct: 180 KLQPPEGSAAILDSESEEEADIEDDT---GVPSAPESLAAPKSLQDVQEPLVNVEDISEQ 236

Query: 232 LEEMSIEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSW 291
           L E+ +EDVDH   R++ YS+  D K+  PI AS F+SNH+++NLP +D   VN+KK+SW
Sbjct: 237 LTELRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSW 296

Query: 292 KKATKLLKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQ 351
           KK  K LKY E EGFLKLKGK D  T+I +++   +L N   Y+     +    G ++  
Sbjct: 297 KKTAKFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASSVA 356

Query: 352 SNKNKITAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPEN 411
           + K + +     +LY+P+S+ + F++  T   P   +TQQ++K  +D Y++  NL+ P+N
Sbjct: 357 NEKEQASVMKAVSLYRPISSTKAFLSA-TDLPPNQMFTQQDIKSAVDKYISAKNLVSPDN 415

Query: 412 KSLVKYDDTLYQMSNRAPQ-NGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVP 470
           KS V+ DD LY + NR+ +    ++ IAR  I++P  L  NF+ +  I K +G PL K P
Sbjct: 416 KSAVRLDDLLYDLVNRSSKKENAVRTIARAQIMAPV-LKGNFSEHFLILKADGTPLFKHP 474

Query: 471 EKGPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESK-STKT 529
            KG IP ++IVTE KIGRKV+T+V+NFEKF++D++ELA ALRKKCSGSTTIGE+  S KT
Sbjct: 475 VKGSIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKT 534

Query: 530 AEVQVQGPHGSIVISILNDYGIPTKWISF 558
            EV VQGPHG  VI +LN+ GIPTKWI+F
Sbjct: 535 LEVTVQGPHGPAVIELLNESGIPTKWINF 563

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  516 bits (1328), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 274/571 (47%), Positives = 371/571 (64%), Gaps = 25/571 (4%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF KEPHIK LSNLKNS+RKKL  T K+Q N EEY  PT+ IKQT+F      G++YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
           +N PI FK K  +QL+PT++S W     LLPI+LTH FVIE+H+  GA LM+ G++PPF 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWE-NHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 119

Query: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179
              K G++ G+AS + P +V A+GI EMDL   S VIG  G+AV++VH+ +DGL KAFK+
Sbjct: 120 PRCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKV 179

Query: 180 ELEPPA---VVYNSEPIETTAIETQ-----TSKYGEQLDEESNHLERSSSQSPVNEIADE 231
           +LEPPA   V    E I+ T IE Q     T K  E + E + ++E         EIA+ 
Sbjct: 180 KLEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRENVQEANINIE---------EIAEV 230

Query: 232 LEEMSIEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSW 291
           L+ +S+ DVD+ + RA+ Y++  D  + LPI AS FISNH+M+NLP +D N VN+K++SW
Sbjct: 231 LDHLSVSDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSW 290

Query: 292 KKATKLLKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQ 351
           KK+ K LK+ E EGFLKLKGK D  T++  N +  +L N   YK     + K  G+ TN 
Sbjct: 291 KKSAKFLKHFEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNS 350

Query: 352 SNKNKITAYSGENLYKPMSACQRFITGITADVP-QSYYTQQELKKLLDLYVANNNLIDPE 410
             K     YS   LYKP +  +  +    A++P Q+YYT Q+++  +  Y++  NL+D +
Sbjct: 351 KEKTSGMMYS-LTLYKPFNLAKDLVK--EANLPFQTYYTSQDIRSAITQYISIKNLVDAK 407

Query: 411 NKSLVKYDDTLYQMSNRAPQNGGIQK-IARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKV 469
           +K  V  DD LY M N+  ++  + + I R  I+ P  L+ NF  ++QIYK +   L + 
Sbjct: 408 DKGKVVMDDLLYNMVNKKKKDPDVARVIPRAQILDP-LLANNFTEFYQIYKNDDTLLSRT 466

Query: 470 PEKGPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKT 529
           P KG  P ++I+TE KIGRKVIT+V+NFE  +ID E LAA LRK CSGSTTIGES++ K+
Sbjct: 467 PMKGSPPRIKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKS 526

Query: 530 AEVQVQGPHGSIVISILNDYGIPTKWISFEN 560
           AEVQVQGPHG ++I  LN  G+P KWI FEN
Sbjct: 527 AEVQVQGPHGQLIIDHLNKSGVPNKWIDFEN 557

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  506 bits (1303), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 264/569 (46%), Positives = 367/569 (64%), Gaps = 10/569 (1%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF KEPHIK LSNLKNS+RKKL  T K+Q N +EY  PT+ IKQT+F      G +YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
           +N PI FK K  +QL+PT++S W     LLPIILTH FVIE+H+  GA LM+ G++PPF 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWE-NPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFD 119

Query: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179
              K G++ G+AS + P +V AIGI EMDL     V+G  G+AV+V+H+ +DGL KA K+
Sbjct: 120 PRSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKV 179

Query: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIED 239
           +L+PP      E I +  +  Q  +  + ++    +++++  Q  V E+A+ L+  S+ D
Sbjct: 180 KLDPPIAKSGDEDINSKQV--QPPEEAKIVENAQENMQKA--QVHVEELAEVLDHFSVSD 235

Query: 240 VDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLK 299
           VD+ + RA+ Y++  D  + LPI  S FISNH+M+NLP +D N VN+KK+SW+K+ K LK
Sbjct: 236 VDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLK 295

Query: 300 YLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKITA 359
           + E EGFLKLKGK D  T++    +  +L N   YK  ++ + + SG+  N   K     
Sbjct: 296 HFEKEGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMM 355

Query: 360 YSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKYDD 419
           YS   LYKP S  + F+        ++YYT Q+++  L  Y++ NNL D ++K  V  DD
Sbjct: 356 YS-MTLYKPFSIAKDFLKEANLGF-RTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDD 413

Query: 420 TLYQMSNRAPQNGGIQKIA-RGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPIPTL 478
            L+ M N+  +N    +I  R  I+ P  L+ NF  ++QI+K +   L K P KG  P +
Sbjct: 414 LLFNMVNKKKKNLNAARIMPRAQILDP-LLANNFTEFYQIFKNDDSLLFKAPIKGSPPRI 472

Query: 479 EIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEVQVQGPH 538
           +I TE KIGRKVITRV+NFE F+ID E LA  LRK CSGSTTIGES++ K+AEVQVQGPH
Sbjct: 473 KITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSAEVQVQGPH 532

Query: 539 GSIVISILNDYGIPTKWISFENKVKPKQK 567
           G ++I  LN+ G+P KWI FENK+K K++
Sbjct: 533 GQLIIDHLNNLGVPNKWIDFENKLKKKKR 561

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  496 bits (1277), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 262/577 (45%), Positives = 363/577 (62%), Gaps = 41/577 (7%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF KEP IK LSNLKNS+RKKLQS  + Q+   +Y+ P+ VIKQT+F+     G++YTD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
            N PIWFK KF D LYPT+FS W+    L+PI+L H++V+E+ +L GA LMLPGTVPPF 
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWS-NKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFD 119

Query: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179
               +  +VG+AST  P +VKAIGI +++L   S VIG  G+AV +VH  DD L KAFK+
Sbjct: 120 ERCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKV 179

Query: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSS-----------QSPV--- 225
           +L+PP                      E   EE++  E S +           Q P+   
Sbjct: 180 KLQPPE---------------GADGIAESDSEENSDAEVSGAIKIEPKPSAPLQEPIVNI 224

Query: 226 NEIADELEEMSIEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVN 285
           ++ A++L ++S+EDVDH   RA+ Y++  D K+ +P  AS F+SNH+++NLP +D   VN
Sbjct: 225 DDAAEQLSQLSVEDVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVN 284

Query: 286 IKKSSWKKATKLLKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSS 345
           +KK+SWKK  K LK+ E EGFLKLKGK D  T++ L+K   +L +   Y+T       + 
Sbjct: 285 MKKTSWKKTAKFLKHFEKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYRTGGNSGGSTG 344

Query: 346 GDTTNQSNKNKITAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNN 405
            ++   S    +       +YKPMS+ + F+   T   P S ++ QELK  +D Y+A+  
Sbjct: 345 SESEQNSMMKALV------IYKPMSSAKPFLCA-TDLSPNSMFSPQELKGAVDAYIASKG 397

Query: 406 LIDPENKSLVKYDDTLYQMSNRAPQ-NGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGE 464
           L+  +NK+ V+ DD L+ + NR+ +    ++ I R  I+ P  L  NF  +  + KP+G 
Sbjct: 398 LVSQDNKAAVRLDDLLFSLVNRSTKKENAVRTILRAQIMPP-ILKGNFAEHFLVLKPDGT 456

Query: 465 PLLKVPEKGPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGE- 523
           PL K P KG IP ++IVTE KIGRKV+T+V+NFEKF++D++ELA ALRKKCSGSTTIGE 
Sbjct: 457 PLFKHPVKGDIPQIQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGET 516

Query: 524 SKSTKTAEVQVQGPHGSIVISILNDYGIPTKWISFEN 560
           + S KT EV VQGPHG  VI +LN   IPTKWI+F N
Sbjct: 517 TTSPKTTEVTVQGPHGPAVIELLNQLAIPTKWINFVN 553

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  496 bits (1276), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 260/563 (46%), Positives = 366/563 (65%), Gaps = 9/563 (1%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF KEPHIK LSNLKNS+RKKL  T ++Q N EEY+  T+ IKQT+F      G++YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
           +N PI FK K ++QL+PT++S W     LLPI+LTH FVIE+H+  GA LM+ G++PPF 
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPA-LLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 119

Query: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179
              K G++ GIAS + P  V AIGI E+DL     VIG  G+AV+++H+ +DGL K FK+
Sbjct: 120 PRCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKM 179

Query: 180 ELEPPAVV-YNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIE 238
           +LEPP V+   S+    ++ + ++S+  + +++E   ++ +S    V EIA+ L+  ++ 
Sbjct: 180 KLEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQEDVKEASVD--VEEIAEVLDHFTVS 237

Query: 239 DVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLL 298
           DVD+ + RA+ Y++  D  + LPI AS FISNH+M+NLP +D N VN+KK+SWKK+ K L
Sbjct: 238 DVDYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFL 297

Query: 299 KYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKIT 358
           K+ E EGFLKLKGK D  T++  N +  +L N   YK   + +   S ++T    K    
Sbjct: 298 KHFEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSGM 357

Query: 359 AYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKYD 418
            YS   LYKP +  +  +  +      +YYT Q+++  +  Y++  NL D ++K  V  D
Sbjct: 358 MYS-LTLYKPFNLAKDLLKEVNL-ASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMD 415

Query: 419 DTLYQMSNRAPQNGGIQKI-ARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPIPT 477
           D L+ M N+  +     +I ARG I+ P  L+ NF  ++QI+K +   L K P KG +P 
Sbjct: 416 DLLFDMVNKKKKVLNASRIIARGEILHP-LLTNNFTEFYQIFKSDDTLLFKAPMKGSLPH 474

Query: 478 LEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEVQVQGP 537
           ++I+TE KIGRKVITRV+NFE F++D E LAA LRK CSGSTTI ES++ K AEVQVQGP
Sbjct: 475 IKIITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGP 534

Query: 538 HGSIVISILNDYGIPTKWISFEN 560
           HG  +I  LN  GIP+KWI FEN
Sbjct: 535 HGQSIIDHLNKLGIPSKWIDFEN 557

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  494 bits (1271), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 267/570 (46%), Positives = 377/570 (66%), Gaps = 30/570 (5%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF K+PHIK LSNLKNS+RKKL ++++ Q    +Y  PT V+KQT+F+    AG++YTDE
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
            N PIWFK K    ++PT+F+ W+    +LP++ TH  V+E+ +L GA LMLPG VPPF 
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWS-NPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFS 119

Query: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179
           S   +GS+VG+AST+ P ++KAIGI ++DL   + VIG  G+AV ++H  DDGL KAFK+
Sbjct: 120 SKCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKM 179

Query: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDE------ESNHLERSSSQSPVN--EIADE 231
           +LEPP            AIE  +SK  EQ +E      E+  +  ++    VN  + +++
Sbjct: 180 KLEPPE-----------AIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQ 228

Query: 232 LEEMSIEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSW 291
           L E+S ED+DH L R++ Y++  DD++ LP+ AS F+SNH++ NLP VD N +N+KKSSW
Sbjct: 229 LNELSAEDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSW 288

Query: 292 KKATKLLKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQ 351
           KK+ K LK+ E   FLKLKGK D   V+ +NK+  +L     Y+ + +  + +      Q
Sbjct: 289 KKSAKFLKHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYR-IGSHGEPTQTKAKAQ 347

Query: 352 SNKNKITAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPEN 411
            N N + A S   LYKP+S+ + F   +    P   +T QELK  LD Y+   NL++ ++
Sbjct: 348 ENSNMMQAVS---LYKPISSAKEFSKAVDLP-PNKIFTAQELKAALDSYILKKNLVNKDD 403

Query: 412 KSLVKYDDTLYQMSNRAP-QNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVP 470
           K +V  DDTL+ M NR+  +   ++ I+R  I+ P FL+ NF  + QI K +  PL K  
Sbjct: 404 KKMVLLDDTLFPMINRSTKKENALRTISRAQIMPP-FLANNFTEHFQILKGD-VPLFKTA 461

Query: 471 EKGPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKST-KT 529
            KG IP ++IVTE KIGRKV+T+V+NFEKF++D+E LAA LRK+CSGSTTIGE+ S+ KT
Sbjct: 462 LKGAIPEIQIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKT 521

Query: 530 AEVQVQGPHGSIVISILNDYGIPTKWISFE 559
            EV VQGPHG+IVI +LN+YGIPTKWI+F+
Sbjct: 522 LEVTVQGPHGAIVIGMLNEYGIPTKWINFQ 551

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  485 bits (1248), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 268/563 (47%), Positives = 365/563 (64%), Gaps = 9/563 (1%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKL-QSTIKRQINEEYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF KEPHIK LSNLKNS+RKKL Q+ IK+  NEEY  PT++IKQT+F      G++YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
           +N PI FK K  +QLYPT++S W     LLPI+LTH FVIE+H+  GA LM+ G++PPF 
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWK-NPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 119

Query: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179
           S    G++ G+A  + P +V AIG+ E+DL     VIG  G+AV+V+H+ +DGLFKAFK+
Sbjct: 120 SRCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKV 179

Query: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSP-VNEIADELEEMSIE 238
           +LEPP VV N+E  E   I ++ ++  EQ+       E     +P + E+A+ L+ +++ 
Sbjct: 180 KLEPP-VVLNTES-EDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVS 237

Query: 239 DVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLL 298
           DVD+ + RA+ YS+  D  + LPI AS FISNH+M+NLP +D N VN+KKSSWKK+ K L
Sbjct: 238 DVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFL 297

Query: 299 KYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKIT 358
           K+ E EG LKLKGK D  T++  N +  +L N   YK   +   K SG+     ++    
Sbjct: 298 KHFEKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGM 357

Query: 359 AYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKYD 418
            +S   LYKP S  +  +         +YYT Q+++  +  Y++  NL D ++K  V  D
Sbjct: 358 MHS-LTLYKPFSLAKDLLREAKLGC-DTYYTSQDVRNAVSEYISVKNLADKKDKRKVVMD 415

Query: 419 DTLYQMSNRAPQNGGIQKI-ARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPIPT 477
           D L+ M N+  +     +I AR  I+ P  LS NF  ++QI++ +   L +VP KG  P 
Sbjct: 416 DLLFNMVNKKKKTPDTTRIIARSEILQP-LLSNNFTEFYQIFRNDDTLLFRVPMKGCPPR 474

Query: 478 LEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEVQVQGP 537
           ++IVTE KIGRKVIT+V+NFE F ID E LAA LRK CSGSTTIGES++ K+AEVQVQGP
Sbjct: 475 IKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGP 534

Query: 538 HGSIVISILNDYGIPTKWISFEN 560
           HG  +I  LN  GIP+KWI FEN
Sbjct: 535 HGQFIIDYLNKSGIPSKWIDFEN 557

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  483 bits (1243), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 265/569 (46%), Positives = 367/569 (64%), Gaps = 22/569 (3%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQI-NEEYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF KEPHIK LSNLKNSDRKKL  TI  Q  N++Y  P +++KQT+FQ     G+IYTDE
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCP-SIVKQTNFQTPTTIGTIYTDE 59

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
            N PIWFK K + +LY T+++ WN +  LLPI L+HDFVI++ +  GA LM+ GT+PPF 
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCE-DLLPICLSHDFVIQEKLFNGANLMISGTIPPFD 118

Query: 120 SNVKRGSIVGIASTKDP-LLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFK 178
             +K G++ G+AS +DP  +V AIGI  MDL     V+G  G+AV+++H+ +D LFK+FK
Sbjct: 119 EKLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFK 178

Query: 179 LELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIE 238
           ++L+PP V      +     E +  +  +  +E+    E S++ + V ++A+ L+ +S++
Sbjct: 179 IDLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTATN-VEDLAEVLDHLSVQ 237

Query: 239 DVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLL 298
           DVD+ + RA+ Y+I  D K++LPI AS FIS H+ KNLPDVD N VNIKKSSWKK  K L
Sbjct: 238 DVDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFL 297

Query: 299 KYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKIT 358
           K+ E EGFLKLKGK D  TV+ +NK   +L N   YK         S +  N+  K +  
Sbjct: 298 KHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKL-------GSSNGENKGAKKEGD 350

Query: 359 AYSGE----NLYKPMSACQRFITGITADVP-QSYYTQQELKKLLDLYVANNNLIDPENKS 413
           + SG       YKP++  +  I    + +P ++ Y   E++  ++ Y+   NL+D +NK 
Sbjct: 351 SQSGMMYSITFYKPINLAKDLIK--ESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKK 408

Query: 414 LVKYDDTLYQMSNRAPQNGGIQK-IARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEK 472
           +V  DD L+ M N+   +  + + I+R  I+ PT L  NF  + QIY   G PL K P +
Sbjct: 409 MVLLDDLLFGMVNKKRTDPTVSRSISRAQILEPT-LKNNFTEHFQIYDSQGTPLFKSPMR 467

Query: 473 GPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGES-KSTKTAE 531
           G  P ++I+TE KIGRKVIT+V+NFE+F I+ E LAA LRK CSGSTTIGE+  S KTAE
Sbjct: 468 GSPPRIKILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAE 527

Query: 532 VQVQGPHGSIVISILNDYGIPTKWISFEN 560
           VQVQGPHG I+I  LN  G+PTKWI +EN
Sbjct: 528 VQVQGPHGQIIIDHLNKLGVPTKWIDYEN 556

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  482 bits (1240), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 265/564 (46%), Positives = 360/564 (63%), Gaps = 12/564 (2%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQI-NEEYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF K+PH+K LSNLKNS+ KKL +T + Q  N+EY+ PT VIKQT+FQ  +  G++YTD 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
            NKPIWFK K  + LYPT+F+ W+    LLP++LTH FV+E+ +  GA LML GTV PF 
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWS-HPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFD 119

Query: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179
           S +K G++ GIAS   P +V A+G+ ++DL     V+G  G+AV++VHYL DGL K FK+
Sbjct: 120 SRLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKV 179

Query: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIED 239
             EPP  + +S+  E    E       +   +E    E++     +++IA+ L+E  +ED
Sbjct: 180 NAEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEIPSQEKAVD---IDDIAEVLDEFRLED 236

Query: 240 VDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLK 299
           VD  L RA+ Y++  D K+ LPI AS FISNH+  NLP VD   VN+KKSSWKK  K LK
Sbjct: 237 VDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLK 296

Query: 300 YLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKITA 359
             E EGFLKLKGK D  T+I +NK   +L N + Y+ ++  +      ++N + K+    
Sbjct: 297 NFEKEGFLKLKGKGDDLTIIGINKQKPELQNFQPYQ-ISGGSGGGGNSSSNNNKKDGSPQ 355

Query: 360 YSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKYDD 419
              E LYKP++  + FI     +     YT QELK  L+ Y+A+NNL D +NK +V  DD
Sbjct: 356 LRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDD 415

Query: 420 TLYQMSNRAPQNGGIQK-IARGLIVSPTFLSKNFNTYHQIYKPNGE-PLLKVPEKGPIPT 477
            LY + N+  ++    + ++R  I+ P  L+ +F  + QIYK  G+ PL K P +G +P 
Sbjct: 416 LLYHLVNKKQKDTTAPRLVSRATIIEP-LLANSFTPHFQIYK--GDIPLFKNPSRGNLPN 472

Query: 478 LEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGES-KSTKTAEVQVQG 536
           +EIVTE KIGRKVITRV+ FE F ID +ELAA LR+ CSGSTTIGE+  S K  EV VQG
Sbjct: 473 IEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQG 532

Query: 537 PHGSIVISILNDYGIPTKWISFEN 560
           PHG ++I  LN  GIPTKWI F+N
Sbjct: 533 PHGPLIIDHLNSLGIPTKWIKFDN 556

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  481 bits (1238), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 266/568 (46%), Positives = 367/568 (64%), Gaps = 28/568 (4%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF KEPHIK LSNLKNS+RKKL  + K Q    +YN  T+++KQT+++  +  G++YTD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
           +N PIWFK K  + L+PT++S W     LLPI+LTHDFVIE+ +  GA LML GT+PPF 
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAP-NLLPIVLTHDFVIEERLFNGANLMLAGTLPPFD 119

Query: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179
                  + GIAS  DP ++ AIG+ +++L   S VIG  GIAV+V+HY  DGL +AFK+
Sbjct: 120 ERCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKI 179

Query: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIED 239
           ++EP   V +SEP+E    E    K  E    E+ H E S     + ++A  L+E+S+ED
Sbjct: 180 DIEP--AVLSSEPVEEEEEEEGKEKLTESPKRETFHTEIS-----IEDVAQVLDELSVED 232

Query: 240 VDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLK 299
           VDH   RA+ Y+   D  + +PI AS FISNH++ NLP VD + VN+KK+SWKK  K LK
Sbjct: 233 VDHFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLK 292

Query: 300 YLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKITA 359
           + E  GFL+LKGK D   ++ +NKN  +L N   YKT        SG T ++ N NK ++
Sbjct: 293 HFEKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKT--------SGQTASKKNSNKDSS 344

Query: 360 ----YSGENLYKPMSACQRFITGITADV-PQSYYTQQELKKLLDLYVANNNLIDPENKSL 414
               YS E LYKP++  + FI    +D+ P++ YT  ELK  ++ Y+    L+D +NK +
Sbjct: 345 PGMMYS-EKLYKPINLGKDFIQ--CSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKM 401

Query: 415 VKYDDTLYQMSNRAPQNGGIQK-IARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKG 473
           V  DD L+ M  R  +     + ++R  I+ P F++ NF  ++Q++K    PL K P +G
Sbjct: 402 VLLDDLLFDMFYRKKKTQETPRCVSRAQIMDP-FIANNFTEFYQLFKDEDTPLFKNPIRG 460

Query: 474 PIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGES-KSTKTAEV 532
           P+P ++IVTE KIGRKV+TRV++FE FK+D E+LAA LRK CSGSTTIGE+  S K AEV
Sbjct: 461 PLPRVKIVTEMKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEV 520

Query: 533 QVQGPHGSIVISILNDYGIPTKWISFEN 560
           QVQG HG ++I  LN  GIPTKWI FE+
Sbjct: 521 QVQGAHGPLIIDYLNKQGIPTKWIDFES 548

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  467 bits (1201), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 255/574 (44%), Positives = 359/574 (62%), Gaps = 12/574 (2%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQINE-EYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF K P++K  SNLKNS+RKKL  + K Q N  +YN P+++IKQ +++    AG++YTDE
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
            N PIWFK K  D L+P++++ W    +LLPII+T+ +VIE+ IL GA LM+ GT+ PF 
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWK-NPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFD 119

Query: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179
             +  G++ GIAS K P +V AIGI ++DL   + V+G  G+AV V+HYL DGL  +FK+
Sbjct: 120 ERLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKM 179

Query: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIED 239
            LEPP     +E  ET  +     K     +  +++ + +    P +++A+ LE + ++ 
Sbjct: 180 NLEPPET--GAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVLETLPVDI 237

Query: 240 VDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLK 299
           +D  + +++ YS+  D K+  PI AS FISN++M NLP VD +MVN+KKSSWKK  K L+
Sbjct: 238 IDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLR 297

Query: 300 YLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKITA 359
           + E EGF+KLKGKND   +   NK   +L +   Y+T    + KS  D TN ++ N    
Sbjct: 298 HFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGNSTKSKKDKTNDTSDNGDMM 357

Query: 360 YSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKYDD 419
            S  + YKP+S  +  I    A   +S YT  EL+  +  Y+   NL+D +NK ++  DD
Sbjct: 358 QS-VSYYKPISLGKDLIRESVAP-EKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDD 415

Query: 420 TLYQMSNRAPQNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGE----PLLKVPEKGPI 475
            +Y +  +   +   + I+R  ++ P     NFN + QIYK        PL K P +G I
Sbjct: 416 LMYSLVYKKKNSAEPRLISRADVIEP-ITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSI 474

Query: 476 PTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGES-KSTKTAEVQV 534
           P +EIVTE KIGRKVITRV+NFE F ID+E LAA LRK C+G+TTIGE+  S KTAEVQV
Sbjct: 475 PKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQV 534

Query: 535 QGPHGSIVISILNDYGIPTKWISFENKVKPKQKK 568
           QGPH  ++I  LN   IPTKWI F+N VKPK+KK
Sbjct: 535 QGPHSQVIIKHLNSLSIPTKWIDFKNSVKPKRKK 568

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  464 bits (1195), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 268/583 (45%), Positives = 364/583 (62%), Gaps = 40/583 (6%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTA-VIKQTSFQVAN--VAGSIY 56
           MF KEPHIK LSNLKNSDRKKL  TIK Q N E YN   + +IKQT+FQ  N    G+I+
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 57  TDESNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVP 116
           T++SN PIWFK+K  D LYPT+F+ WN    +LP +L+HDFVI++ +  GA LM+ GT+P
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWN-NHDILPTLLSHDFVIQEKLFNGANLMISGTIP 119

Query: 117 PFPSNVKRGSIVGIASTKDP-LLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFK 175
           PF S +  G++ GIAS +DP  +V AIG+ +M++     V+G  G+AV V+H+ +D LFK
Sbjct: 120 PFDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFK 179

Query: 176 AFKL-ELEPPAVV---YNSE-PIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIAD 230
            FK  +L+P   V    N+E P +    +  T++  E         E   S  P  E+ D
Sbjct: 180 IFKCNDLKPDEFVKEQLNTEHPQDNDVADEDTTRKKE---------ENRESNEPDFEVLD 230

Query: 231 ELEEMSIEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSS 290
             +    EDVD+ + R++ Y+I  D K+ LPI AS FIS H+ KNLPD+  N VNIKK+S
Sbjct: 231 HFK---TEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTS 287

Query: 291 WKKATKLLKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKT--LATIAKKSSGDT 348
           WKK  K LK+ E EGFLKLKGK D  TV+ +NK   +L N   YK     T +   S   
Sbjct: 288 WKKTAKFLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPN 347

Query: 349 TNQSNKNKITAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLID 408
           TN  +  K   YS E  YKP++  +  +  +     +  YTQQE++ ++  Y+ + NLID
Sbjct: 348 TNDKSDTKGMMYS-ETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLID 406

Query: 409 PENKSLVKYDDTLYQMSNR--APQNGGIQKIARGLIVSPTFLSKNFNTYHQIY-KPNG-- 463
            +NK ++  DD L+ M ++  +  N   + + RG I+ P  L+ NF  ++QIY K NG  
Sbjct: 407 MKNKKMILLDDLLFNMVHKRQSEANAAPRTMMRGTILEP-ILANNFTEHYQIYRKRNGKG 465

Query: 464 ------EPLLKVPEKGPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSG 517
                 EPL K P++G +P ++I+TE KIGRKVIT+V+NFE F I S+ LAA LRK CSG
Sbjct: 466 ELMEDVEPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSG 525

Query: 518 STTIGES-KSTKTAEVQVQGPHGSIVISILN-DYGIPTKWISF 558
           STTIGE+  S KT EVQVQGPHG I+I  LN  +G+PTKWI++
Sbjct: 526 STTIGETMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  464 bits (1193), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 255/565 (45%), Positives = 357/565 (63%), Gaps = 17/565 (3%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQINEEYNLPTA--VIKQTSFQVANVAGSIYTD 58
           MF KEP IK LS LKNSDRKKL  ++K Q+  + ++  A   I QT+F     AG+IYTD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 59  ESNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPF 118
            ++ PI FKTK  D LYPT F LW+    LL  + TH  V+E +I  GA LM+ GTVPPF
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWS-NNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPF 119

Query: 119 PSNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFK 178
            S +  G+I  +A+ + P +  A+GI +++L     V+G  G+AV ++H+ +D LF  FK
Sbjct: 120 DSTLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFK 179

Query: 179 LELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIE 238
            +LE PA V +    ETTA     +K  +   E  +  E  S     ++IA+ L+E+++E
Sbjct: 180 AKLEIPASVKSILQEETTA---DVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELTVE 236

Query: 239 DVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLL 298
           DVD+ + RA+ +++  D+ +TLP+VAS F+SNH+M+NLPDVD   VNIK++SWKK  K L
Sbjct: 237 DVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTAKFL 296

Query: 299 KYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKIT 358
           KY E EGFLKLKGK D   ++ +NK+  +L N   YK +   AKK++  + + S + +  
Sbjct: 297 KYFEKEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYK-IGNTAKKAA--SKSDSTQTQGV 353

Query: 359 AYSGENLYKPMSACQRFI--TGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVK 416
           + S  NLYKP++  Q+FI  + I+       YT  E++  ++ Y+   NL+D ++K +V 
Sbjct: 354 SVSSVNLYKPINLGQKFIKESNISGG---PMYTSLEIRNCINDYIIKKNLVDEKDKKMVM 410

Query: 417 YDDTLYQMSNRAPQNGGIQK-IARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPI 475
            DD L+ M NR  QN    + I R  I+ P  ++ NFN Y Q+YK +  PL K P KG  
Sbjct: 411 LDDLLFAMVNRKIQNPIFPRIIPRANILEP-LIANNFNEYFQLYKGDNTPLFKNPIKGQT 469

Query: 476 PTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEVQVQ 535
           P ++IVTE KIGRKV+TRV+NFE F+I  EELAA LRK CSGSTTI E+   K +EVQVQ
Sbjct: 470 PKIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPK-KVSEVQVQ 528

Query: 536 GPHGSIVISILNDYGIPTKWISFEN 560
           GPHG ++I   N  GIP+K+I FEN
Sbjct: 529 GPHGQLIIDHFNKSGIPSKFIQFEN 553

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  454 bits (1167), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 252/569 (44%), Positives = 357/569 (62%), Gaps = 20/569 (3%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQI-NEEYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF KEPHIK LSNLKNS+RKKLQ   + Q  NEEY+  +  IKQT+F+     G+IYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
            N PIWFK K +++LYPT+ + W     L+P++LTH  V+E HI  GA LM+ GT+PPF 
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCP-NLIPVVLTHSIVLEDHIFNGANLMISGTIPPFD 119

Query: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179
             +  G++ GIA  + P L+ A+GI +M+L   + VIG  G+AV++VH+L+D LFK FK+
Sbjct: 120 ERLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKV 179

Query: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIED 239
           + EPPA +  ++   +  +E +   + ++   ESN  +    +S ++++A+ L+E+ +ED
Sbjct: 180 KEEPPAELLQTQSSSSEELELEADIHEDETKVESNS-DTEKEKSNLDDMAEVLDELRLED 238

Query: 240 VDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNM--VNIKKSSWKKATKL 297
           +D+ + RA+ Y+I  D K+  P  AS F+SNH+  NLP   TN+  VNIKKSSWKK  K 
Sbjct: 239 IDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPK-GTNLAEVNIKKSSWKKTAKF 297

Query: 298 LKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKI 357
           LK+ E EGFLKLKG  D  T++ +NK+  ++     Y  +      + G  T     N  
Sbjct: 298 LKHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIG-----NQGSNTGSEGGNAK 352

Query: 358 TAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKY 417
           T      LYKP++  + FI+     + Q  Y + E+K+L++ Y+   +L+D ++K  V  
Sbjct: 353 TTIKIVTLYKPINLAKDFISSNKVPLKQ-LYMEPEIKELINKYITMKDLVDKKDKKCVLV 411

Query: 418 DDTLYQMSNRAPQNGGIQK--IARGLIVSPTFLSKNFNTYHQIYKPNGE---PLLKVPEK 472
           DD L  M  +  ++   +   I R  I+ P  L  NFN  + +++  G    PL K P K
Sbjct: 412 DDMLMTMIYKKKEDQATKSRVIPRANILQPV-LQNNFNKNYHLFRITGNEQTPLTKTPLK 470

Query: 473 GPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKST--KTA 530
           G  P + IVTE KIGRKVIT+V+NFE F+ID EE AA +RKKCSGSTTIGE+ S+  KTA
Sbjct: 471 GEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTA 530

Query: 531 EVQVQGPHGSIVISILNDYGIPTKWISFE 559
           EVQVQGPHG +++S LND GIP KWI FE
Sbjct: 531 EVQVQGPHGQLIMSYLNDLGIPNKWIDFE 559

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  444 bits (1143), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 234/571 (40%), Positives = 354/571 (61%), Gaps = 32/571 (5%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF KEP++ P SN KNS+RK+LQ++I+ Q   E Y   +  IK  +F+  +  G++YTD 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
           +N P+WF+ K +    PT++S W+    LLP++ TH+ V+E  + GGA LMLPGTVPPF 
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWD-HPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFS 119

Query: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179
           S  +RG +VGIAST+ P +VKA+GI EMDL G++ V  T G+AVRV+H   DGL + FK+
Sbjct: 120 SGTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKV 179

Query: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIED 239
           + E P                + S+      E           +P   +A+ELE +++ED
Sbjct: 180 QREAP----------------EASEAKGASPEAREPEAEPPKTAPGEGLAEELERLTMED 223

Query: 240 VDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLK 299
           VDH+L RAV Y+IK D ++ LP+ AS FI+ HV+KNLP +D + V +K+SSW KA KLLK
Sbjct: 224 VDHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLK 283

Query: 300 YLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKITA 359
           + E +G L LKGK +S TV+S+N  H+ L + E Y+T++        D  +  +KN  T 
Sbjct: 284 HFEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVS--------DKASTGSKNSSTT 335

Query: 360 YSGENLYK--PMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKY 417
            S E +Y   P       + G+      +  + ++++  L+ YVA    +DP +KS+++ 
Sbjct: 336 QSLEIVYHYVPNRTLLPQLNGLGISGGDA-LSAKDIRDRLEQYVAARKCVDPYDKSMLRL 394

Query: 418 DDTLYQMSNRAPQNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPIPT 477
           DDTL Q+ ++       + + R   ++   LS++F+ Y  + +  G+  L  P+KG  P 
Sbjct: 395 DDTLAQLLHKNVNADTPRSLPRPEALA-ALLSRSFSEYFVVMR--GDAPLSKPQKGRAPP 451

Query: 478 LEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEVQVQGP 537
           +++  E+KI +KV+T+V+NFE + +D EELAA LR +CSGSTTI +  +TK  EVQVQGP
Sbjct: 452 IKVTNERKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAVEVQVQGP 511

Query: 538 HGSIVISILNDYGIPTKWISFENKVKPKQKK 568
           H + ++SILN +GIP+K+I+ + KV+PK+KK
Sbjct: 512 HEATIVSILNKHGIPSKYITLDCKVQPKKKK 542

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  441 bits (1133), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 232/578 (40%), Positives = 367/578 (63%), Gaps = 25/578 (4%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQI-NEEYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF K+P IK  SNLKNS+RKKL   ++ Q  N+E+   T ++KQ +F+     G+I+TDE
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
            NKPI+FK K  + L PTI + W     LL ++LTH  V++  +  GA LMLPGT+PPF 
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYP-GLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFS 119

Query: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179
            N  RG +VG+AS++ P +V+AIG+ +++L GI  V+G  G+AV+V+H ++DGL++ FK+
Sbjct: 120 DNCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKM 179

Query: 180 ELEPPA--VVYNSEPIETTAIETQTSKYGEQLDEE-------SNHLERSSSQSPVNEIAD 230
            +EPP+  +V     +E  A+       G Q DE+       S  LE  +S S   E+A+
Sbjct: 180 SVEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLS---EVAE 236

Query: 231 ELEEMSIEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSS 290
           +LEE+SIE VDH L +AV Y++  D+ + LPI AS FI+NHVMKNLP +    V++K+SS
Sbjct: 237 QLEELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSS 296

Query: 291 WKKATKLLKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTN 350
           W +A+K LKY E++GFLKLKGK ++ TV+S+NK+  ++ + + Y+T+      SS +  N
Sbjct: 297 WARASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVSTSSKN--N 354

Query: 351 QSNKNKITAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPE 410
             +  ++  Y     Y+P++  +  +  +  + P +    +++K +L+ YV    L++  
Sbjct: 355 DKHDVEVVVY-----YQPLNTAKATLHAL-GNNPNAMLKAKDIKAILNKYVTEKKLVNAT 408

Query: 411 NKSLVKYDDTLYQMSNRAPQNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVP 470
           ++ ++  DDTL+ ++ +   +   +K+ R  +     LS +F     I+K +G+PL   P
Sbjct: 409 DERIILLDDTLFSLAYKKSASDSTRKVLRAKMFD-LILSTSFTEVFFIFK-DGKPLSSKP 466

Query: 471 EKGPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTK-T 529
            K     + ++TE KI RK++TR++NFE + +D EEL+  LRK+CSGS+T+ E  + + T
Sbjct: 467 LKSKNRNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQST 526

Query: 530 AEVQVQGPHGSIVISILNDYGIPTKWISFENKVKPKQK 567
            EVQVQGPHG+  I+ILN++GIP+K+I F+NK+  K+K
Sbjct: 527 TEVQVQGPHGNTAINILNEHGIPSKYIDFDNKLNKKKK 564

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  435 bits (1118), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 245/571 (42%), Positives = 355/571 (62%), Gaps = 13/571 (2%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQINE-EYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF K PHIK LSNLKNS+RKKL  + K Q    +YN PT+VIKQT+F      G IYTDE
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
              P+WFK K  + L+PT+++ W     LLPI+LTHD VI +HI  GA LM+ GT+PPF 
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWE-DPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFD 119

Query: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179
           S +   +I GIA+  +P  + A+G+ ++D+   S VIG  G+AV V+HY  DG+  AFK+
Sbjct: 120 SRLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKM 179

Query: 180 ELEPPAVVYNSE-PIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIE 238
           + + P +V   +  ++ T  +       E+   E + +   SS   V+E+A E   +++E
Sbjct: 180 KRDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSND-VSELAQEESALTVE 238

Query: 239 DVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLL 298
           D+DH + R++ Y++  D K+  PI +S+FISNH+M+NLP VD N+VNIKK+SWKK++K L
Sbjct: 239 DIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFL 298

Query: 299 KYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTN-QSNKNKI 357
           K+ E EGF+KLKGK +  T++  NK  ++L   E Y+   + +       +N Q ++N +
Sbjct: 299 KHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSSSNSGKKINSNRQESENMM 358

Query: 358 TAYSGENLYKPMSACQRFITGITADVP-QSYYTQQELKKLLDLYVANNNLIDPENKSLVK 416
            +      Y P  + ++F+T    ++P +++YT  ELK  +  Y+    L+D +N  +  
Sbjct: 359 YSLV---FYSPKGSAKQFMT--LTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMAN 413

Query: 417 YDDTLYQMSNRAPQNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPIP 476
            DD LY M          + I R  ++  +F + NF   +Q++K +  PL K P +G  P
Sbjct: 414 LDDRLYDMCYTKKSTNPPRHITRAAVIE-SFTTNNFTELYQLFKNDDTPLTKNPVRGSPP 472

Query: 477 TLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGE-SKSTKTAEVQVQ 535
            ++IVTE KIGRK++TRV+NFE F ID++ LA  LR+ CSGSTTIGE + S KT EVQVQ
Sbjct: 473 RIKIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQ 532

Query: 536 GPHGSIVISILNDYGIPTKWISFENKVKPKQ 566
           GPH  I+I  LN   IPTKWI FENK+KPK+
Sbjct: 533 GPHSKIIIDHLNSLSIPTKWIDFENKLKPKK 563

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  404 bits (1038), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 231/576 (40%), Positives = 342/576 (59%), Gaps = 22/576 (3%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQI-NEEYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF K   I  LSNLKNS+ + ++ T +  + N EY  P + +KQT+F+     G IYTD 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119
           +N PIWFK K+ + + PT+++ W     + PII THDF+IE  I  GA LM+PGTV P  
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNI-PIIRTHDFIIETKIFNGANLMIPGTVGPHD 119

Query: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179
             +K G I GIASTK P  + AIG+   D+  +   +G  G+AV V+H+  D L   FK+
Sbjct: 120 ERLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKI 179

Query: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEES----NHLERSSSQSPVNEIADELEEM 235
           +L PP ++ N+  ++T    TQ S   E  + ES    +     +  S  +++A+ LE++
Sbjct: 180 KLNPPTIM-NTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQL 238

Query: 236 SIEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKAT 295
            +ED+D+ L +++ Y+I  +  + LPI++STF+S ++MKNLP+VD N VNIKKSSWKK  
Sbjct: 239 RVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTA 298

Query: 296 KLLKYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKN 355
           K LK+ E EGFLKLKGK D  T+   NK    L     Y+         S D   Q NKN
Sbjct: 299 KFLKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRIGKPAGALPSKD--KQDNKN 356

Query: 356 KITAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLV 415
            +   +  +  K   +C   + G+T+   +SY+T  E+   +  Y+A  NL +P++K+ +
Sbjct: 357 FLKVVTLYSPKKKNDSCWTAL-GLTS---KSYFTSAEITSAIQGYIAKKNLANPKDKAKI 412

Query: 416 KYDDTLYQM---SNRAPQNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEK 472
             DD L+ +   +N+A  N   + I R  +V P  ++ NF  YHQ++  +   L K P+K
Sbjct: 413 SMDDVLFDLVITNNKANAN---RNIMRSQVVEPVLVN-NFLLYHQLFTHDNISLSKHPKK 468

Query: 473 GPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEV 532
           G  PT+++VTEK    KVITRV+NFE F ID+++++  L+  CSGST+I E  +   +EV
Sbjct: 469 GSPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELPN--GSEV 526

Query: 533 QVQGPHGSIVISILNDYGIPTKWISFENKVKPKQKK 568
           QVQGPHG IV+     +GIP KW  + NKVKPK+++
Sbjct: 527 QVQGPHGDIVMEYFEKHGIPRKWFDYTNKVKPKKRR 562

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  354 bits (908), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 220/575 (38%), Positives = 337/575 (58%), Gaps = 38/575 (6%)

Query: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59
           MF K PHIKPLSNLKNS+++KLQ  +++Q   +E+      +KQT+FQ     G+IY ++
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 60  SNKPI--WFKTKF-EDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVP 116
              P+  +FK K     L+P++++ W+    LLPIILTH  VIE H+  GA LM+ GT+P
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWS-HPGLLPIILTHSVVIEDHLFNGANLMISGTMP 119

Query: 117 PFP-SNVKRGSIVGIASTKDPLLVKAIGIAEMDL--CGISHVIGTKGIAVRVVHYLDDGL 173
           PF  +++ +G   GIA+ K P ++ A+G  +MDL     + V+G  G+ V V H+  DGL
Sbjct: 120 PFDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGL 179

Query: 174 FKAFKLELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELE 233
             AF+L+L+ P      + +E+      T +  E+   E+      ++   V+++A+ LE
Sbjct: 180 ADAFRLKLDIP------DKLESAT----TQEVAEEPPVEAKPTSPVTNPVAVDDLAEVLE 229

Query: 234 EMSIEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLP-DVDTNMVNIKKSSWK 292
            +S+EDVD+ + RA+ Y++  + K+ LPI AS F+S H+MK LP  +D   VN+KKSSWK
Sbjct: 230 TLSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWK 289

Query: 293 KATKLLKYLEDEGFLKLKGKNDSCTVI--SLNKNHKDLTNMEAYKTLATIAKKSSGDTTN 350
           K  K LK+ E EG LKLKGK D   V+  + +K H  L +   Y    +IA+  SG  + 
Sbjct: 290 KTAKYLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVGNSIAE--SGPKSQ 347

Query: 351 QSNKNKITAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPE 410
            +N   + A +    ++P S  Q   T +     Q Y++  E++++L+ Y+  N L  P 
Sbjct: 348 TTNGPVMFAVTS---FQPDSTAQ---TALPLG-GQRYFSGPEIREVLNEYITANKLAQPN 400

Query: 411 NKSLVKYDDTLYQMSNRAPQNGGIQKIARGLIVSPTFLSK----NFNTYHQIYKPNGEPL 466
           N  +V  +DTL+ M  +  +    ++  + ++  P  L +    +F T +Q++K    PL
Sbjct: 401 NPKMVLLNDTLFGMVTKGNEE---KQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPL 457

Query: 467 LKVPEKGPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKS 526
            K P+KG  P + I+TE KIGRKV+TRV NF+   I   E AA LRK CS STTIG++ S
Sbjct: 458 TKHPQKGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVS 517

Query: 527 TK-TAEVQVQGPHGSIVISILNDYGIPTKWISFEN 560
           T   +E+QVQG HG ++I  L + G+P+ W+ FEN
Sbjct: 518 TPVVSEIQVQGAHGPLIIDHLRELGVPSSWVVFEN 552

>SAKL0F04576g Chr6 (369113..369120,369587..370121) [543 bp, 180 aa]
           {ON} similar to uniprot|P89886 Saccharomyces cerevisiae
           YER007C-A TMA20 Protein of unknown function that
           associates with ribosomes
          Length = 180

 Score = 36.6 bits (83), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 50/180 (27%), Positives = 79/180 (43%), Gaps = 15/180 (8%)

Query: 2   FAKEPHIKPLSNLKNSDRKKLQSTIKRQINE-EYNLPTAVIKQTSFQVANVAGSIYTDES 60
           F++E  +   SN+K+S ++ L+S + +Q  + E  +   V K++  ++      I     
Sbjct: 4   FSRE-DVHSRSNVKSSVQRTLKSKLVKQFPKLEEVIDELVPKKSQVELIKCEDKIQLYAV 62

Query: 61  NKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGT------ 114
           +  I F  KF D L PT+  +        P +      I K +L GA +M PG       
Sbjct: 63  DGEILFFQKFND-LIPTLKFVHRFP-GAFPTVQVDRGAI-KFVLSGANIMCPGLTSPGAK 119

Query: 115 VPPFPSNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLF 174
           +P  P   K   ++  A  K+  L  AIG   M    I  +   KG  V +VHYL D L+
Sbjct: 120 LPDAPGLEKDAIVIVNAENKEHAL--AIGTLLMSTEDIRSI--NKGHGVEMVHYLGDCLW 175

>Kwal_23.5675 s23 (1269401..1269874) [474 bp, 157 aa] {ON} YHR041C
           (SRB2) - RNA polymerase II holoenzyme/mediator subunit
           [contig 11] FULL
          Length = 157

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 43/104 (41%), Gaps = 12/104 (11%)

Query: 112 PGTVPPFPSNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIG----TKGIAVRVVH 167
           PG VP   + +  G   G  S+ D LL   +         I    G    T G+ +R  +
Sbjct: 28  PGGVPQ--TLLHNGCSTGTPSSFDHLLSSKLSNLWTQRQNIKGDFGSTYTTSGLVIRATN 85

Query: 168 YLDDGLFKAFKLELEPPAVVYNSEPIETTAIETQTSKYGEQLDE 211
               G FK   +E+E       +EP+ +   +T+  K GE+L E
Sbjct: 86  VFSYGGFKGLLIEVEC------AEPVSSDEFQTRVKKVGERLKE 123

>Kwal_33.13618 s33 (321288..323963) [2676 bp, 891 aa] {ON} YJL198W
           (PHO90) - Low-affinity phosphate transporter [contig
           114] FULL
          Length = 891

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 5/75 (6%)

Query: 322 NKNHKDLTNMEAYKTLATIAKK--SSGDTTNQSNKNKITAYSGENLYKPMSACQRFITGI 379
           N   KDL  +E++    + A +  ++GD +   N N +  Y   NL  P+    R+ + I
Sbjct: 359 NTVWKDLLGLESHNNTISSAGRPNANGDISELEN-NTLLEYRTWNLPWPIRC--RYFSWI 415

Query: 380 TADVPQSYYTQQELK 394
           T  +PQ ++T + LK
Sbjct: 416 TVKIPQLFFTLKALK 430

>Suva_5.29 Chr5 (53604..54968) [1365 bp, 454 aa] {ON} YEL040W (REAL)
          Length = 454

 Score = 32.3 bits (72), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 36/74 (48%), Gaps = 1/74 (1%)

Query: 248 VKYSIKFDDKITLPIVASTFIS-NHVMKNLPDVDTNMVNIKKSSWKKATKLLKYLEDEGF 306
           V+YS   D  + +PI  S+    N     + + D  + N+ ++ W  + ++L Y ++E  
Sbjct: 58  VRYSFSHDSCMPVPICKSSSTKFNDYSSKMGNADVFLGNVSEAEWLYSGEVLDYDDEESL 117

Query: 307 LKLKGKNDSCTVIS 320
           +    KN   T+IS
Sbjct: 118 ILAMPKNSGGTIIS 131

>Skud_5.50 Chr5 (76203..77603) [1401 bp, 466 aa] {ON} YEL040W (REAL)
          Length = 466

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 3/75 (4%)

Query: 248 VKYSIKFDDKITLPIV--ASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLKYLEDEG 305
           V++S   D  + +PI   +ST   ++  K L D +T + N+ ++ W     +L Y ++E 
Sbjct: 58  VRFSFSHDSCMPVPICKSSSTKFKDYSSK-LGDANTFLGNVSEADWLYTGNVLDYDDEES 116

Query: 306 FLKLKGKNDSCTVIS 320
            +    KN   TV+S
Sbjct: 117 LILAMPKNSGGTVLS 131

>KAFR0E00500 Chr5 (109532..110830) [1299 bp, 432 aa] {ON} Anc_1.483
           YEL040W
          Length = 432

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 3/73 (4%)

Query: 250 YSIKFDDKITLPIV--ASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLLKYLEDEGFL 307
           +S  FD  + LP+   ++T  SN+  K + D +T + ++ +  W     +L Y +++  +
Sbjct: 56  FSYSFDACMPLPVCKNSTTTFSNYTSK-VVDANTFLGDVSEGDWAYTGYILDYEDEDSMI 114

Query: 308 KLKGKNDSCTVIS 320
               KN   TV+S
Sbjct: 115 LAMPKNSGGTVLS 127

>Skud_12.493 Chr12 complement(874622..877441) [2820 bp, 939 aa] {ON}
           YLR409C (REAL)
          Length = 939

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%)

Query: 320 SLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKITAYSGENLYKPMSACQRF 375
           +L +  K   N+E Y+T  ++  K+ GD  + +NKN+  A + +N       C R 
Sbjct: 867 ALTQGLKSSKNLELYETFMSLLFKAHGDVIHANNKNQDIAGALQNWENAHEKCDRL 922

>SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conserved
           hypothetical protein
          Length = 750

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 3/63 (4%)

Query: 177 FKLELEPPAVVYNSEPIETTAIETQT---SKYGEQLDEESNHLERSSSQSPVNEIADELE 233
           F L+LEP  ++  S P  +  + + T    K G   D  S  + R+SS +P N ++ +LE
Sbjct: 209 FDLQLEPYNILKESSPALSYLMRSDTLVLGKNGNDWDSASPKILRNSSLTPANNLSLQLE 268

Query: 234 EMS 236
             S
Sbjct: 269 MTS 271

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,357,673
Number of extensions: 3002941
Number of successful extensions: 9907
Number of sequences better than 10.0: 106
Number of HSP's gapped: 10222
Number of HSP's successfully gapped: 106
Length of query: 570
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 455
Effective length of database: 40,294,809
Effective search space: 18334138095
Effective search space used: 18334138095
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)