Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19272g8.268ON26626613830.0
Kwal_56.237758.268ON2812699361e-127
ZYRO0C01518g8.268ON2772569251e-126
SAKL0H16896g8.268ON2852459031e-122
YDR116C (MRPL1)8.268ON2852428861e-120
KLTH0G13552g8.268ON2812568831e-119
Smik_4.3608.268ON2852638721e-118
Skud_4.3768.268ON2852638541e-115
Suva_2.2758.268ON2852618491e-114
TPHA0J007708.268ON2782448291e-111
Ecym_43028.268ON2752748021e-107
NCAS0B038108.268ON3142418051e-107
Kpol_392.38.268ON2812748011e-107
TDEL0F039508.268ON2762667921e-106
AGR080W8.268ON2752727801e-104
KNAG0H032108.268ON2852437302e-96
NDAI0J013308.268ON3142457315e-96
KAFR0B054808.268ON2802627268e-96
CAGL0B01815g8.268ON2902477018e-92
TBLA0I031908.268ON2412234683e-57
NCAS0B046708.116ON26633711.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19272g
         (266 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   537   0.0  
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   365   e-127
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   360   e-126
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   352   e-122
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   345   e-120
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   344   e-119
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   340   e-118
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   333   e-115
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   331   e-114
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   323   e-111
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   313   e-107
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   314   e-107
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   313   e-107
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   309   e-106
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   305   e-104
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   285   2e-96
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   286   5e-96
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   284   8e-96
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   274   8e-92
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   184   3e-57
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                32   1.3  

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/266 (100%), Positives = 266/266 (100%)

Query: 1   MFPRIFTRQFQITSFRLAEETGTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSR 60
           MFPRIFTRQFQITSFRLAEETGTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSR
Sbjct: 1   MFPRIFTRQFQITSFRLAEETGTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSR 60

Query: 61  ALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAA 120
           ALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAA
Sbjct: 61  ALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAA 120

Query: 121 LMKDKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAK 180
           LMKDKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAK
Sbjct: 121 LMKDKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAK 180

Query: 181 KGTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQ 240
           KGTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQ
Sbjct: 181 KGTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQ 240

Query: 241 QTKKPSILSQTTLTSTHGPGIVIDFA 266
           QTKKPSILSQTTLTSTHGPGIVIDFA
Sbjct: 241 QTKKPSILSQTTLTSTHGPGIVIDFA 266

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  365 bits (936), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 173/269 (64%), Positives = 219/269 (81%), Gaps = 6/269 (2%)

Query: 2   FPRIFTRQFQITSFRLAEETGT----KLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMP 57
           FP  + R     S   AEET +    KL+K+QLRKRE+RK+ Q++  A+ PA+DHPLYMP
Sbjct: 15  FP--YARNLHAFSALRAEETPSPVVSKLSKDQLRKREIRKLAQKKAAARRPATDHPLYMP 72

Query: 58  VSRALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEA 117
           V +ALR+LRA E GQP SQQT+++TT+V++ERG PPL+GN+SF KPLKD+K+AVFTNDE 
Sbjct: 73  VDKALRFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQ 132

Query: 118 QAALMKDKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLP 177
           QA + ++K+  HLVGGSDLV +IK G VS+DFDK+FATP+I   LASQ+GRILGPRGLLP
Sbjct: 133 QAQIAREKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQLGRILGPRGLLP 192

Query: 178 TAKKGTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSI 237
            AKKGTVAE+LEPL+K+SM ++PFRQRGN +S+ V K  FTDK++LEN+LA QK  K+++
Sbjct: 193 AAKKGTVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEAL 252

Query: 238 TNQQTKKPSILSQTTLTSTHGPGIVIDFA 266
             Q+TKKPS+L QTTLTSTHGPGIVIDFA
Sbjct: 253 ATQKTKKPSLLGQTTLTSTHGPGIVIDFA 281

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  360 bits (925), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 168/256 (65%), Positives = 208/256 (81%)

Query: 10  FQITSFRLAEETGTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIE 69
           F   +   AEE G+KLTKEQLRKRE+R+  +R+++AK PA  HPLYMP   ALRYLRA+E
Sbjct: 21  FHTAALLRAEEAGSKLTKEQLRKREVRRAARRKVEAKKPAHTHPLYMPTPLALRYLRAVE 80

Query: 70  VGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVH 129
           VG PASQQ IT+TT VVA+RG PP+ GNVS   PLKDV VAVF+NDE Q ++ +DK+  H
Sbjct: 81  VGYPASQQVITVTTSVVADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMARDKFRCH 140

Query: 130 LVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLE 189
           LVGGSD++++IK GE+ +DFDKAFATPDI  +L SQV RILGP+ +LP AK+GTVA DLE
Sbjct: 141 LVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPMAKRGTVASDLE 200

Query: 190 PLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILS 249
           PLIKDS  S+PFRQ+GNSISL VAK  F+D++VLENLLA Q AFK++++NQ+ K+PSIL 
Sbjct: 201 PLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQKAKRPSILG 260

Query: 250 QTTLTSTHGPGIVIDF 265
           +TTLT+THGPGIVID 
Sbjct: 261 RTTLTTTHGPGIVIDL 276

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  352 bits (903), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 168/245 (68%), Positives = 208/245 (84%)

Query: 22  GTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTITL 81
            TKL+K+QL++RELR++VQR+  A+ PA+DHPLYMPV++ALR+LRA EVGQP SQQTI+L
Sbjct: 41  ATKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISL 100

Query: 82  TTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVHLVGGSDLVSQIK 141
           TTLV++ERG P L GN+SF KPLKDVK+AVFTNDE +  + +D+++ HLVGGS+L+ +IK
Sbjct: 101 TTLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIK 160

Query: 142 AGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLEPLIKDSMSSVPF 201
            GEV +DFDKAFATPDI   L SQ+GRILGPRGLLP AKKGTV ED+  LIKDSM ++PF
Sbjct: 161 KGEVPLDFDKAFATPDIAISLTSQLGRILGPRGLLPNAKKGTVTEDISSLIKDSMGTLPF 220

Query: 202 RQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPGI 261
           RQRGN IS+ VAK  FTD +VLEN+LA QK+FK ++ NQ+ KKPSIL QTTLT+THGPG+
Sbjct: 221 RQRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGL 280

Query: 262 VIDFA 266
           VIDFA
Sbjct: 281 VIDFA 285

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  345 bits (886), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 155/242 (64%), Positives = 210/242 (86%)

Query: 25  LTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTITLTTL 84
           LTK+Q +KREL+++VQR+ +AK PA+  PLYMPV++ALRYLRA EVG+P SQQTI LTTL
Sbjct: 44  LTKDQAKKRELKRLVQRKAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTL 103

Query: 85  VVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVHLVGGSDLVSQIKAGE 144
           VV ERG  PL+G+V+F KPL+ +K+A FTNDE++   +++KY  HL+GG+DLV++IK+GE
Sbjct: 104 VVGERGTAPLSGSVTFPKPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGE 163

Query: 145 VSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLEPLIKDSMSSVPFRQR 204
           +S+DFDKAFATPDIVP L SQV RILGPRG+LP+ KKGTV++D+  L+++S+ S+PFRQR
Sbjct: 164 ISVDFDKAFATPDIVPALQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQR 223

Query: 205 GNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPGIVID 264
           GNSIS+GV K +FTD+E+L+N+++ + AFK ++ NQ++KKP+ILS+TTL+STHGPGIVID
Sbjct: 224 GNSISIGVGKCYFTDREILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVID 283

Query: 265 FA 266
           FA
Sbjct: 284 FA 285

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  344 bits (883), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 160/256 (62%), Positives = 212/256 (82%), Gaps = 3/256 (1%)

Query: 14  SFRLAEETG---TKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEV 70
           S R  E  G   +KL+K+QL+KRE+R+  Q++  A+ PAS+HPLYMPV +ALR+LRA EV
Sbjct: 26  SLRAEEPVGNATSKLSKDQLKKREVRRFAQKKAAARRPASEHPLYMPVDKALRFLRAAEV 85

Query: 71  GQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVHL 130
           GQP SQQT+++TT+V++ERG P L+GNVSF   LK++K+AVFTNDE QA + ++K++ H+
Sbjct: 86  GQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREKFNCHV 145

Query: 131 VGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLEP 190
           VGGS+LV +IK G+V +DFDK+FATP+I   LASQ+GRILGPRGLLP AKKGTV+E+LE 
Sbjct: 146 VGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQLGRILGPRGLLPAAKKGTVSENLES 205

Query: 191 LIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQ 250
           LIKDSM ++PFRQRGN+IS+ V +  FTDK++LEN++A QK+ K+++ NQ+ KKPS+L Q
Sbjct: 206 LIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKPSLLGQ 265

Query: 251 TTLTSTHGPGIVIDFA 266
           TTLTST GPGIVIDFA
Sbjct: 266 TTLTSTRGPGIVIDFA 281

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  340 bits (872), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 154/263 (58%), Positives = 214/263 (81%), Gaps = 3/263 (1%)

Query: 4   RIFTRQFQITSFRLAEETGTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALR 63
           +++  +++ T+          LTK+Q +KREL+++ QR+ +AK PA+ +PLYMPV+ ALR
Sbjct: 26  KLYAEEYKPTAM---SSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALR 82

Query: 64  YLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMK 123
           YLRA EVG+P SQQTI LTTLVV ERG  PL+G+V+F KPL+ +KVA FTNDE +   ++
Sbjct: 83  YLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTNDENKLEELR 142

Query: 124 DKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGT 183
            KY  HL+GG+DLV++IK+GE+ +DFDKAFATPDIVP L SQV RILGPRG+LP+ KKGT
Sbjct: 143 KKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSLKKGT 202

Query: 184 VAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTK 243
           V++D+  L+++S+ S+PFRQRGNSISLGV K +F+D+E+L+N+++ + AFK ++ NQ++K
Sbjct: 203 VSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFKAAVNNQKSK 262

Query: 244 KPSILSQTTLTSTHGPGIVIDFA 266
           KP++LS+TTL+STHGPGIVIDFA
Sbjct: 263 KPNLLSKTTLSSTHGPGIVIDFA 285

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  333 bits (854), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 158/263 (60%), Positives = 215/263 (81%), Gaps = 3/263 (1%)

Query: 4   RIFTRQFQITSFRLAEETGTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALR 63
           +++  +++ T+          LTKEQ +KREL+++ QRR +AK PA+ +PLYMPV+ ALR
Sbjct: 26  KLYAEEYKSTAM---SSNAPSLTKEQAKKRELKRLAQRRAEAKRPAATNPLYMPVTVALR 82

Query: 64  YLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMK 123
           YLRA EVG+P SQQTI LTTLVV ERG  PL+G+V+F KPL+ +KVAVFTNDE +   ++
Sbjct: 83  YLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTNDENKLKELR 142

Query: 124 DKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGT 183
           +KY  HL+GG+DLVS+IK GE+ +DFDKA+AT DIVP L SQV RILGPRG+LP+ KKGT
Sbjct: 143 EKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRGVLPSVKKGT 202

Query: 184 VAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTK 243
           V++D+  L+++S+ S+PFRQRGNSISLG+ K +FTD+EVL+N++A + AFK ++++Q++K
Sbjct: 203 VSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIAARAAFKAAVSDQKSK 262

Query: 244 KPSILSQTTLTSTHGPGIVIDFA 266
           KP+ILS+TTL+STHGPGIVIDFA
Sbjct: 263 KPNILSKTTLSSTHGPGIVIDFA 285

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  331 bits (849), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 155/261 (59%), Positives = 207/261 (79%), Gaps = 2/261 (0%)

Query: 8   RQFQITSFRLA--EETGTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYL 65
           RQ     ++ A        LTK+Q +KREL+++ QRR +AK PA+  PL+MPV+ ALRYL
Sbjct: 25  RQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYL 84

Query: 66  RAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDK 125
           RA EVG+P SQQTI LTTLVV ERG  P++GNV+F KPL+ VKVAVFTNDE +   +++K
Sbjct: 85  RAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFSKPLRYVKVAVFTNDEVKLKELREK 144

Query: 126 YSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVA 185
           Y   +VGG+DLV++IK  E  +DFDKAFATPDIVP L SQV RILGPRG+LP+ KKGTV+
Sbjct: 145 YPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSVKKGTVS 204

Query: 186 EDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKP 245
           +D+  L+++S+ S+PFRQRGN+ISLG+ K +FTD+E+L+N+++ + AF+ ++ NQ+ KKP
Sbjct: 205 DDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRELLQNIISARTAFRAAVDNQKAKKP 264

Query: 246 SILSQTTLTSTHGPGIVIDFA 266
           S+LS+TTL+STHGPGIVIDFA
Sbjct: 265 SLLSKTTLSSTHGPGIVIDFA 285

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  323 bits (829), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 147/244 (60%), Positives = 202/244 (82%), Gaps = 1/244 (0%)

Query: 23  TKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTITLT 82
           +KL+K+QL+KRELR+   R+ +AK PA+ HPLYM V +ALR+LRA EVGQP SQQTI LT
Sbjct: 36  SKLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLT 95

Query: 83  TLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVHLVGGSDLVSQIKA 142
           TLVV+E+G P L G+++F  PLK+VK+A+FTNDE Q  + K+K++ ++VGGS+L+S+IK 
Sbjct: 96  TLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKN 155

Query: 143 GEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLEPLIKDSMSSVPFR 202
           GE+ +DFDKAFATPDIV +L S V RILGPRG+ P+ KKGTV+E++E LIK ++ S+PFR
Sbjct: 156 GEIEVDFDKAFATPDIVQELGS-VARILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFR 214

Query: 203 QRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPGIV 262
           Q GN IS+ + K +F+D+++LENL++ +KAFK S++ Q+TKKPSIL +T L++THGPGIV
Sbjct: 215 QLGNCISVAIGKCNFSDRQILENLISVRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIV 274

Query: 263 IDFA 266
           IDF+
Sbjct: 275 IDFS 278

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  313 bits (802), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 151/274 (55%), Positives = 203/274 (74%), Gaps = 9/274 (3%)

Query: 1   MFPRIFT-----RQFQITSFRLAEETG----TKLTKEQLRKRELRKMVQRRLQAKTPASD 51
           MFPR        R    TS R A        TKL+KEQ++K+ELR ++Q+R  AK    +
Sbjct: 1   MFPRCLKLVTVRRGLNFTSVRCAANNSPSSTTKLSKEQMKKKELRALLQKRAAAKKSPFE 60

Query: 52  HPLYMPVSRALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAV 111
           HPLYMPV +A R+LRA EVGQP SQQTI+LTT+VV+++G P L+GN+ F  PL+DVKVAV
Sbjct: 61  HPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNPLRDVKVAV 120

Query: 112 FTNDEAQAALMKDKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILG 171
           FTN++ Q  + ++++  HLVGG++L+  IK G+  IDFDKA ATPD+V QL SQ+  +LG
Sbjct: 121 FTNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLTSQLASVLG 180

Query: 172 PRGLLPTAKKGTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQK 231
           PR LLP  KKGTV+E++  LI+++M +VPFRQRG  +S+ V K  F+DK++L+N++A QK
Sbjct: 181 PRRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLLQNIVAVQK 240

Query: 232 AFKQSITNQQTKKPSILSQTTLTSTHGPGIVIDF 265
           AFKQ++ +QQ KK SIL +TT+TSTHGPGIVIDF
Sbjct: 241 AFKQALADQQGKKSSILGKTTVTSTHGPGIVIDF 274

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  314 bits (805), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 144/241 (59%), Positives = 193/241 (80%)

Query: 25  LTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTITLTTL 84
           L+KEQL+KRELR++ QR+ +AK PAS HPLYMPV  ALRY+RA EVG+P+ QQTITLT+L
Sbjct: 73  LSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSL 132

Query: 85  VVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVHLVGGSDLVSQIKAGE 144
           VV E+GV PL G++S  +PLK +KVAVF+ +E     MK+KY  HLVGG +L+++IK GE
Sbjct: 133 VVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGE 192

Query: 145 VSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLEPLIKDSMSSVPFRQR 204
           V  DFDKAFA+ D+   L++Q+G+ LG RGLLP AKKGTV++DLE L+ D + S+PFRQ 
Sbjct: 193 VKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQT 252

Query: 205 GNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPGIVID 264
           GN IS+G+ K HF+D+E+L N++A + A  ++++ Q++KKPSIL +TTL+STHGPGIVID
Sbjct: 253 GNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVID 312

Query: 265 F 265
           F
Sbjct: 313 F 313

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  313 bits (801), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 148/274 (54%), Positives = 209/274 (76%), Gaps = 12/274 (4%)

Query: 5   IFTRQFQITSFRL-------AEETGT-----KLTKEQLRKRELRKMVQRRLQAKTPASDH 52
           I +R+ +  S R+       A ET +     K  K++L++RELR+  +R+  A+ PAS +
Sbjct: 8   ILSRRCEYHSGRVLLAEAVAASETASAKPVSKSVKDKLKRRELRRHSKRKADARKPASSY 67

Query: 53  PLYMPVSRALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVF 112
           PLYMP+S+ALRYLRA EVGQP SQQ IT+TT VV+ERG   L GN+S+  P+KDVK+AVF
Sbjct: 68  PLYMPISQALRYLRAAEVGQPISQQIITITTDVVSERGNLNLNGNISYNTPIKDVKIAVF 127

Query: 113 TNDEAQAALMKDKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGP 172
           +ND  + A +K++++ HL+GG+DLV +IK+G+  +DFDKAFATPDI P L SQ+ R+LGP
Sbjct: 128 SNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQLARVLGP 187

Query: 173 RGLLPTAKKGTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKA 232
           RG+LPT KKGTV+ED+  LIK S+  +PFRQ GNSIS+ V + +F+DK++LEN++A + A
Sbjct: 188 RGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILENIIAVRSA 247

Query: 233 FKQSITNQQTKKPSILSQTTLTSTHGPGIVIDFA 266
           +  ++++Q++KKPS+L +TT+TSTHGPGI IDFA
Sbjct: 248 YNTTLSSQKSKKPSLLGKTTITSTHGPGITIDFA 281

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  309 bits (792), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 159/266 (59%), Positives = 209/266 (78%), Gaps = 4/266 (1%)

Query: 5   IFTRQFQITSFRL-AEETG---TKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSR 60
           +  R F  T   L AEE     +KL+K+QL+KRE+R++ QR+  AK   SDHPLYM +  
Sbjct: 11  VLRRSFLHTGNVLRAEEAAANVSKLSKDQLKKREIRRLAQRKAAAKKSPSDHPLYMSIPM 70

Query: 61  ALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAA 120
           ALR+LRA EVGQP +QQTITLTT VVAERGVP L G+VSF KPLK+VK+AVF+ DE Q  
Sbjct: 71  ALRFLRAAEVGQPQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIAVFSGDEDQLK 130

Query: 121 LMKDKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAK 180
           + ++K++ HLVGG++++ +IK+GE+ +DFDKAFATPDI P L SQ+ RILGPRG+LPT K
Sbjct: 131 VAREKFNCHLVGGTEIIEKIKSGEIPVDFDKAFATPDIAPALTSQLARILGPRGVLPTVK 190

Query: 181 KGTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQ 240
           KGTVA D+  L++DSM S+PFRQRGN+IS+ V K+ F+D+++LEN +AT  A K+++ NQ
Sbjct: 191 KGTVATDVSRLVQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATHDAVKEALANQ 250

Query: 241 QTKKPSILSQTTLTSTHGPGIVIDFA 266
            +KK S+L +TTL+STHGPGIVIDFA
Sbjct: 251 VSKKTSLLGKTTLSSTHGPGIVIDFA 276

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  305 bits (780), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 150/272 (55%), Positives = 209/272 (76%), Gaps = 7/272 (2%)

Query: 1   MFPRI----FTRQFQITSFRLAEE---TGTKLTKEQLRKRELRKMVQRRLQAKTPASDHP 53
           +F R+    F R   +T+ +L++E   T +KL+K+QL+KRELR++ QR+  A+ PAS  P
Sbjct: 2   LFSRVGLLSFRRGLHLTAVQLSQEAAATSSKLSKDQLKKRELRRLAQRKAAARRPASASP 61

Query: 54  LYMPVSRALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFT 113
           LYMPV +ALR+LRA EVGQPA+QQTI++ T+V+ ++G   L+G V+   P+++ KVAVFT
Sbjct: 62  LYMPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFT 121

Query: 114 NDEAQAALMKDKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPR 173
           ND  QA   + KY  +LVGG++LV Q+K+GEV +DFDKAFATPDI P +A+++GR+LGP+
Sbjct: 122 NDPEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPK 181

Query: 174 GLLPTAKKGTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAF 233
           GLLP+ KKGTVA DL  L+ D ++S PF+QR N ISL + K HF+D++++ENLLA Q AF
Sbjct: 182 GLLPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAF 241

Query: 234 KQSITNQQTKKPSILSQTTLTSTHGPGIVIDF 265
           + ++T+Q+TKK S+   TTLTSTHGPGIVIDF
Sbjct: 242 RAAMTSQKTKKTSLFGTTTLTSTHGPGIVIDF 273

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  285 bits (730), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 135/243 (55%), Positives = 188/243 (77%)

Query: 24  KLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTITLTT 83
           KLTKEQLR+RELRKM++ ++ AK PAS   +Y+ V  A+R LRA+EVGQP SQQTITLTT
Sbjct: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102

Query: 84  LVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVHLVGGSDLVSQIKAG 143
           +VV+E+GVPPL G+V    PLK V++A F+ D      ++++  + +VGG++L+ Q+K+G
Sbjct: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162

Query: 144 EVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLEPLIKDSMSSVPFRQ 203
           EV + FDKAFATPDI PQL S++G +LG RGLLP  KKGTV  DL  +I+  + ++PFRQ
Sbjct: 163 EVPVQFDKAFATPDIAPQLNSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222

Query: 204 RGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPGIVI 263
           R  +++ G+AK HF+D++VL NL+A ++AF+ +I NQ++KK SIL ++TL+STHGPGIVI
Sbjct: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282

Query: 264 DFA 266
           D A
Sbjct: 283 DLA 285

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  286 bits (731), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 188/245 (76%)

Query: 21  TGTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTIT 80
             TKL+KEQL+KRE+R++ QR+ QA+ PA+ HPLYM V  ALR++RA EVG+P  QQTIT
Sbjct: 69  NATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTIT 128

Query: 81  LTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVHLVGGSDLVSQI 140
           LTTL+V+E+G   L GN+   +PLK++K+AVF+ D+     +K +++  LVGG++ V  I
Sbjct: 129 LTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGI 188

Query: 141 KAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLEPLIKDSMSSVP 200
           K G +  +FD AFATP+IVP + SQ+G+ LG RG+LP  KKGTV++DL  L+   M ++P
Sbjct: 189 KDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIP 248

Query: 201 FRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPG 260
           F+Q GN+IS+ + K +F+DK++L N++A + AFK+++ NQ+ K+PSILS+TTL+STHGPG
Sbjct: 249 FKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPG 308

Query: 261 IVIDF 265
           IVIDF
Sbjct: 309 IVIDF 313

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  284 bits (726), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 138/262 (52%), Positives = 192/262 (73%), Gaps = 3/262 (1%)

Query: 7   TRQFQITSFRLAEET--GTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRY 64
           TR  Q +   L E +   +K  K+Q +K+ LR  ++ R QA+ PAS+HPLYM V  ALR+
Sbjct: 18  TRSLQTSRLWLEEASVAPSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRF 77

Query: 65  LRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKD 124
           LRA+EVGQP SQQTITLTTLV++E+GVPP+ GNV    PL++ KV V ++D  +   ++D
Sbjct: 78  LRAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQD 137

Query: 125 KY-SVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGT 183
            + +VHLVGG +LV + K  ++ IDFDK  ATPDI+      +G++ GP+GLLP  KKGT
Sbjct: 138 NFKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGT 197

Query: 184 VAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTK 243
           V+E+L  L+ +++SS+PFRQR   ISLG+ K  F+DK++LEN++AT++AF  +++NQ+TK
Sbjct: 198 VSENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTK 257

Query: 244 KPSILSQTTLTSTHGPGIVIDF 265
           K S L +TTLTSTHGPGIVIDF
Sbjct: 258 KQSTLGKTTLTSTHGPGIVIDF 279

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  274 bits (701), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 127/247 (51%), Positives = 190/247 (76%), Gaps = 6/247 (2%)

Query: 25  LTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTITLTTL 84
           LTKEQ +KRE++++  ++ +AK PA+ HPLYMP+  ALRYLR+ EVG+P   QTIT+TTL
Sbjct: 43  LTKEQAKKREMKRLALKKAEAKKPANIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTL 102

Query: 85  VVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYS--VHLVGGSDLVSQIKA 142
           VVA++G   L GN+ F  PLK +K+A+F++++ +   +K KYS  V + GG D+++ IK+
Sbjct: 103 VVADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKS 162

Query: 143 GEVSID-FDKAFATPDIVPQLASQVGRILGPRGLLPTAKK---GTVAEDLEPLIKDSMSS 198
           G++ +D  +K FATP+I P +ASQ+GR+LGP+GL+P  KK    TV EDL+ LI++++  
Sbjct: 163 GKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQ 222

Query: 199 VPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHG 258
           V FRQRGNS+S+ V + +F+D+++LEN++A + AFKQS+++Q  KKPSIL +TT+++T G
Sbjct: 223 VSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAG 282

Query: 259 PGIVIDF 265
           PGIVIDF
Sbjct: 283 PGIVIDF 289

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  184 bits (468), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 144/223 (64%), Gaps = 2/223 (0%)

Query: 43  LQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGK 102
            +A+  + +HPL M V  ALRYLRAIE G+ +S+QT+TL T+V A RG  PL G ++F  
Sbjct: 20  FKARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHM 79

Query: 103 PLKDVKVAVFTNDEAQAALMKDKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQL 162
            ++   +AVFT D  Q  + K+   + ++GGS+L+ +I +GE  I F  AFAT D+V  L
Sbjct: 80  LIRKPVIAVFTEDPEQHKIAKE-MGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL 138

Query: 163 ASQVGRILGPRGLLPTAKKGTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEV 222
           A +V + LG + +LP  KK TV +++  L++D +  VPF ++ + IS  V K  FTD+E+
Sbjct: 139 A-RVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEI 197

Query: 223 LENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPGIVIDF 265
           L NL+  ++  ++++  Q  KKPS + + TLTSTHGPGI ID 
Sbjct: 198 LRNLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

>NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON} 
          Length = 266

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 22/33 (66%)

Query: 174 GLLPTAKKGTVAEDLEPLIKDSMSSVPFRQRGN 206
            LLPT+ + +  +D++P+I  + S VP ++R N
Sbjct: 159 SLLPTSSRSSSLQDVKPIINKNSSKVPSKKRAN 191

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,613,008
Number of extensions: 955791
Number of successful extensions: 3155
Number of sequences better than 10.0: 32
Number of HSP's gapped: 3234
Number of HSP's successfully gapped: 32
Length of query: 266
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 158
Effective length of database: 41,097,471
Effective search space: 6493400418
Effective search space used: 6493400418
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)