Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19250g8.267ON1161165898e-80
SAKL0H16918g8.267ON1111163084e-37
TDEL0F039408.267ON1101173007e-36
Ecym_43038.267ON1091192991e-35
Kwal_56.237768.267ON1301162973e-35
AGR081C8.267ON1301112931e-34
KLTH0G13574g8.267ON1121162608e-30
Kpol_543.428.267ON112902563e-29
TPHA0A017708.267ON1041172407e-27
ZYRO0C01540g8.267ON971132345e-26
Suva_2.2748.267ON1051162078e-22
NCAS0B038208.267ON115772043e-21
Smik_4.3598.267ON105602033e-21
Skud_4.3758.267ON105521991e-20
KAFR0B054908.267ON85611962e-20
CAGL0B01793g8.267ON98961962e-20
YDR115W8.267ON105581973e-20
NDAI0J013408.267ON141541932e-19
TBLA0E044708.267ON94521867e-19
KNAG0H032208.267ON86491832e-18
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19250g
         (116 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...   231   8e-80
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...   123   4e-37
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...   120   7e-36
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...   119   1e-35
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...   119   3e-35
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...   117   1e-34
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...   104   8e-30
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...   103   3e-29
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    97   7e-27
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...    95   5e-26
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...    84   8e-22
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    83   3e-21
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...    83   3e-21
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...    81   1e-20
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    80   2e-20
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    80   2e-20
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...    80   3e-20
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    79   2e-19
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    76   7e-19
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    75   2e-18

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score =  231 bits (589), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 116/116 (100%), Positives = 116/116 (100%)

Query: 1   MSFITRNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFG 60
           MSFITRNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFG
Sbjct: 1   MSFITRNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFG 60

Query: 61  MLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
           MLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY
Sbjct: 61  MLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score =  123 bits (308), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 66/116 (56%), Positives = 85/116 (73%), Gaps = 5/116 (4%)

Query: 1   MSFITRNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFG 60
           MSF++++L  ++++RT T+FSSFSPLR+L+S+     A VN     L        SSI  
Sbjct: 1   MSFLSKHLFHFSARRTFTTFSSFSPLRSLNSQ-----ALVNHNNPLLSQSQSQQPSSIMN 55

Query: 61  MLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
           +L  LTQRRWKSRGNT+QPSTLKRKRRVGFLARA+++   +ILK RK KGRWYLT+
Sbjct: 56  ILLGLTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score =  120 bits (300), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 83/117 (70%), Gaps = 8/117 (6%)

Query: 1   MSFITRNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFG 60
           MSF+ R  LQ  ++RTLTS SSFSPLR+L        AQ     +    +T +  SSI  
Sbjct: 1   MSFLARKPLQLNARRTLTSLSSFSPLRSL-------FAQNKSQGLLGVPETHSPLSSISL 53

Query: 61  ML-FDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
           +  F + QRRWKSRGNTFQPSTLKRKRR+GFLARARS++G ++L+RRK KGRWYLTY
Sbjct: 54  LFPFGIMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score =  119 bits (299), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 69/119 (57%), Positives = 85/119 (71%), Gaps = 13/119 (10%)

Query: 1   MSFITRNLLQWTSKRTLTSF-SSFSPLRTLDSRLHRPLA--QVNPMEITLQSQTQANGSS 57
           M + +R+LLQW  +R+L +  SSFSP+++L     +PLA    N    T Q        S
Sbjct: 1   MLYKSRSLLQWFPRRSLVTLVSSFSPMKSLV----QPLATSAANTSVSTFQR------PS 50

Query: 58  IFGMLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
           +  ++F L QRRWKSRGNTFQPSTLKRKRRVGFLARARS++GQ+ILKRRK KGRWYLTY
Sbjct: 51  VISLVFGLNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score =  119 bits (297), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 83/116 (71%), Gaps = 4/116 (3%)

Query: 1   MSFITRNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFG 60
           MSF++  L Q++++R+LT+ SSFSPL     R   P++QVN    T  S +     S   
Sbjct: 19  MSFLSSRLFQFSARRSLTTMSSFSPLNVCMFR--SPVSQVNNSIATGSSSSAM--PSYLS 74

Query: 61  MLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
            LF LTQ+RWKSRGNT+QPSTLKRKRRVGFLAR +S+ G +ILKRR+ KGRWYLT+
Sbjct: 75  SLFGLTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score =  117 bits (293), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 61/111 (54%), Positives = 79/111 (71%), Gaps = 7/111 (6%)

Query: 6   RNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFGMLFDL 65
           R++LQW+S+RT+   +  SP+R +      P+ Q+    I   +   A   S+  ML  L
Sbjct: 27  RSMLQWSSRRTI--MTVVSPVRKMA-----PVPQIQYGAIGAFTPAAAPKPSMLSMLLGL 79

Query: 66  TQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
           TQ+RWKSRGNT+QPSTLKRKRRVGFLARARSR+G+ ILKRR+ KGRWYLT+
Sbjct: 80  TQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score =  104 bits (260), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 80/116 (68%), Gaps = 4/116 (3%)

Query: 1   MSFITRNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFG 60
           MSFI   L Q++++R+L+S SSFSPL  +  R         PM     SQ     S +F 
Sbjct: 1   MSFIYNRLFQFSARRSLSSLSSFSPLNAVSCRPS-VFQAAAPMAAERSSQ---GSSPLFS 56

Query: 61  MLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
            LF  TQRRWKSRGNT+QPSTLKRKRRVGFLARA+S+ G ++LKRR+ KGRWYLT+
Sbjct: 57  ALFGFTQRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score =  103 bits (256), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 53/90 (58%), Positives = 68/90 (75%), Gaps = 2/90 (2%)

Query: 27  RTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFGMLFDLTQRRWKSRGNTFQPSTLKRKR 86
           R++ S + RP A +N + +   + T   GS+I G+L    QRRWKSRGNT+QPSTLKRKR
Sbjct: 25  RSISSSIFRPFAGLNSVGLFPGTATNTFGSAITGLLG--LQRRWKSRGNTYQPSTLKRKR 82

Query: 87  RVGFLARARSRSGQQILKRRKNKGRWYLTY 116
           + GFLARARSRSG +IL+RRK KGRWYL++
Sbjct: 83  KFGFLARARSRSGSKILERRKAKGRWYLSH 112

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 97.1 bits (240), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 57/117 (48%), Positives = 74/117 (63%), Gaps = 14/117 (11%)

Query: 1   MSFITRNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFG 60
           MSF+TR+  Q  + R +       P  TL   +   +   N +       ++   +SI G
Sbjct: 1   MSFLTRSFNQLMTGRVI-------PNNTLVDSIKNSILGGNAIG------SRTGLASILG 47

Query: 61  MLFDLT-QRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
           +  DL  QRRWKSRGNT+QPSTLKRKRR+GFLARARS+ G +IL+RRK KGRWYLT+
Sbjct: 48  LNLDLGLQRRWKSRGNTYQPSTLKRKRRIGFLARARSKQGNKILERRKAKGRWYLTH 104

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
           similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 97

 Score = 94.7 bits (234), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 53/113 (46%), Positives = 73/113 (64%), Gaps = 19/113 (16%)

Query: 4   ITRNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFGMLF 63
             RN+ Q  ++R+L +  +++P              V+P++  L     ++G       F
Sbjct: 4   FARNIFQVGARRSLFTMGNWTP------------TTVSPLQRLLGPSPLSSG-------F 44

Query: 64  DLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
            + QRRWKSRGNTFQPSTLKRKRRVGFLARARS+ G +IL+RRK+KGRW+LT+
Sbjct: 45  GMGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQRRKHKGRWFLTH 97

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 84.3 bits (207), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 71/116 (61%), Gaps = 11/116 (9%)

Query: 1   MSFITRNLLQWTSKRTLTSFSSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFG 60
           MS   R L Q+ S+R    FSS SP+  L     +    +N   +   S T       FG
Sbjct: 1   MSLFGR-LYQFQSRRM---FSSISPISALSVLRPQTSMLLNSSPLKTMSLTP------FG 50

Query: 61  MLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
             F + QRRWKSRGNT+QPSTLKRKR  GFLARA+S+ G +ILKRRK KGRW+L++
Sbjct: 51  FGF-IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 83.2 bits (204), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 46/77 (59%), Positives = 57/77 (74%), Gaps = 5/77 (6%)

Query: 41  NPMEITLQSQTQANGSSI-FGMLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSG 99
           +PM   + SQ+   GS + FG+L    QRRWKSRGNT+QPSTLKRKR+ GFLA+AR    
Sbjct: 43  SPMGSNVLSQSPMMGSLLPFGIL----QRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQK 98

Query: 100 QQILKRRKNKGRWYLTY 116
            +ILKRR+ KGRWYLT+
Sbjct: 99  CKILKRRRLKGRWYLTH 115

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 82.8 bits (203), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 1/60 (1%)

Query: 57  SIFGMLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
           + FG  F + QRRWKSRGNT+QPSTLKRKR  GFLARA+S+ G +ILKRRK KGRW+L++
Sbjct: 47  TTFGFGF-IDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 81.3 bits (199), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 46/52 (88%)

Query: 65  LTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
           + QRRWKSRGNT+QPSTLKRKR  GFLARA+S+ G +ILKRRK KGRW+L++
Sbjct: 54  IGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {ON}
           Anc_8.267 YDR115W
          Length = 85

 Score = 80.1 bits (196), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 50/61 (81%)

Query: 56  SSIFGMLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLT 115
           +++F +L    Q+RWKSRGNT+QPSTLKRKR+ GFL+RA+S+   +ILK RK KGRWYL+
Sbjct: 25  TNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLS 84

Query: 116 Y 116
           +
Sbjct: 85  H 85

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
           similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115w
          Length = 98

 Score = 80.1 bits (196), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 59/96 (61%), Gaps = 1/96 (1%)

Query: 21  SSFSPLRTLDSRLHRPLAQVNPMEITLQSQTQANGSSIFGMLFDLTQRRWKSRGNTFQPS 80
           SSF  LR ++      +   N + +     +     S    LF L QRRWKSRGNT+QPS
Sbjct: 4   SSFGVLRPMNLTPGNGMIGKNSVSLIRNEISSGTSFSSILTLFPL-QRRWKSRGNTYQPS 62

Query: 81  TLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
           TLKRKR+ GFLAR  ++   +I+KRRK KGRWYLT+
Sbjct: 63  TLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score = 80.5 bits (197), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 40/58 (68%), Positives = 49/58 (84%), Gaps = 3/58 (5%)

Query: 59  FGMLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
           FG++    QRRWKSRGNT+QPSTLKRKR  GFLARA+S+ G +ILKRRK KGRW+L++
Sbjct: 51  FGLI---GQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 79.0 bits (193), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 36/54 (66%), Positives = 45/54 (83%)

Query: 63  FDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
           F + Q+RWKSRGNT+QPSTLKRKR+ GFL+R R R   +ILKRRK KGRW+L++
Sbjct: 88  FMINQKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.267
           YDR115W
          Length = 94

 Score = 76.3 bits (186), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 45/52 (86%)

Query: 65  LTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
           +  RRWKSRGNT+QPSTLKRKR+ GFL+RA+S +  +ILKRRK KGRW+L++
Sbjct: 43  IDSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
           Anc_8.267 YDR115W
          Length = 86

 Score = 75.1 bits (183), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (85%)

Query: 68  RRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116
           RRWKSRGNT+QPSTLKRKR+ GFLAR R+    ++LKRRK KGRWYL++
Sbjct: 38  RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.131    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,066,039
Number of extensions: 374023
Number of successful extensions: 1250
Number of sequences better than 10.0: 24
Number of HSP's gapped: 1241
Number of HSP's successfully gapped: 24
Length of query: 116
Length of database: 53,481,399
Length adjustment: 86
Effective length of query: 30
Effective length of database: 43,620,123
Effective search space: 1308603690
Effective search space used: 1308603690
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)