Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19228g8.266ON30528915310.0
AGR082C8.266ON2662723846e-44
Ecym_43048.266ON2892803831e-43
SAKL0H16940g8.266ON3032933721e-41
Kwal_56.237778.266ON2672283551e-39
ZYRO0C01562g8.266ON2772363106e-33
TDEL0F039308.266ON2802273081e-32
KLTH0G13596g8.266ON2672343053e-32
Kpol_392.48.266ON2812362391e-22
NDAI0B020108.266ON2812282205e-20
KAFR0B027408.266ON2562271951e-16
NCAS0B050408.266ON2732351854e-15
Suva_10.1758.266ON2992271688e-13
YLR091W (GEP5)8.266ON2932261545e-11
Skud_12.1598.266ON2942211474e-10
KNAG0G020608.266ON2862771352e-08
Smik_12.1508.266ON2922831333e-08
TPHA0J007608.266ON249186979e-04
YBL011W (SCT1)4.96ON759176693.8
Ecym_47167.357ON45252684.5
Skud_2.1004.96ON744172676.0
TBLA0A094705.646ON45855676.8
KLTH0F16698g5.405ON67659668.6
KAFR0G022006.124ON50158668.8
NOTE: 1 genes in the same pillar as KLLA0F19228g were not hit in these BLAST results
LIST: CAGL0L12320g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19228g
         (305 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...   594   0.0  
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...   152   6e-44
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...   152   1e-43
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...   147   1e-41
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...   141   1e-39
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...   124   6e-33
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   123   1e-32
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...   122   3e-32
Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...    97   1e-22
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...    89   5e-20
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...    80   1e-16
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...    76   4e-15
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...    69   8e-13
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...    64   5e-11
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...    61   4e-10
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    57   2e-08
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...    56   3e-08
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    42   9e-04
YBL011W Chr2 (203538..205817) [2280 bp, 759 aa] {ON}  SCT1Glycer...    31   3.8  
Ecym_4716 Chr4 complement(1405721..1407079) [1359 bp, 452 aa] {O...    31   4.5  
Skud_2.100 Chr2 (187076..189310) [2235 bp, 744 aa] {ON} YBL011W ...    30   6.0  
TBLA0A09470 Chr1 complement(2331897..2333273) [1377 bp, 458 aa] ...    30   6.8  
KLTH0F16698g Chr6 (1354232..1356262) [2031 bp, 676 aa] {ON} weak...    30   8.6  
KAFR0G02200 Chr7 (458391..459896) [1506 bp, 501 aa] {ON} Anc_6.1...    30   8.8  

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/289 (100%), Positives = 289/289 (100%)

Query: 1   MKASLLRTSKLYKGLHSITKDAISKVDTFPKNKQHETLHRLNSFNENPTRKTLEKLVYSV 60
           MKASLLRTSKLYKGLHSITKDAISKVDTFPKNKQHETLHRLNSFNENPTRKTLEKLVYSV
Sbjct: 1   MKASLLRTSKLYKGLHSITKDAISKVDTFPKNKQHETLHRLNSFNENPTRKTLEKLVYSV 60

Query: 61  HFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWSRNNKDALDFL 120
           HFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWSRNNKDALDFL
Sbjct: 61  HFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWSRNNKDALDFL 120

Query: 121 SFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKETLRQIFEHYYFL 180
           SFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKETLRQIFEHYYFL
Sbjct: 121 SFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKETLRQIFEHYYFL 180

Query: 181 KTNPKLCATKKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLYSQNPVLTSDAE 240
           KTNPKLCATKKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLYSQNPVLTSDAE
Sbjct: 181 KTNPKLCATKKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLYSQNPVLTSDAE 240

Query: 241 SILTSIVNDPDLNRRTKRLYKNVASRSYLFKDGKFEISELARGGFVLSK 289
           SILTSIVNDPDLNRRTKRLYKNVASRSYLFKDGKFEISELARGGFVLSK
Sbjct: 241 SILTSIVNDPDLNRRTKRLYKNVASRSYLFKDGKFEISELARGGFVLSK 289

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score =  152 bits (384), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 90/272 (33%), Positives = 135/272 (49%), Gaps = 29/272 (10%)

Query: 15  LHSITKDAI----SKVDTFPKNKQHETLHRLNSFNENPTRKTLEKLVYSVHFHLLNDPPK 70
           LH  T + I    SK       ++ E +  LN F      + L++LV+ VHF L+   P+
Sbjct: 14  LHRATSEVILAYLSKQQAQYPTERIELVEPLNDFLRKGGHQGLQRLVFHVHFQLMLRAPE 73

Query: 71  HVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWSRNNKDALDFLSFNRHKWLRP 130
           H+ +LR++  EL +FWPYE  HS+L + D    S   LW    ++ L  + + RH WLR 
Sbjct: 74  HLRLLRRHREELQRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVLQQMQYCRHHWLRE 133

Query: 131 KNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKETLRQIFEHYYFLKTNPKLCATK 190
            +                      + E   L   + +E L ++F  Y FLK  P L + +
Sbjct: 134 GD----------------------VPERYALTQAQREEVLHRVFAQYMFLKQRPALWSVR 171

Query: 191 KLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLYSQNPVLTSDAESILTSIVNDP 250
           +L  P+VEIGM P GFDI D+R+D LFK K K +  LLY ++P LT  AE  +  I+ + 
Sbjct: 172 RLPIPVVEIGMTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIAEC 231

Query: 251 DLNRRTKRLYKNVASRSYLF-KDGK-FEISEL 280
              R  +R+Y     R+Y+   D + F +S L
Sbjct: 232 P-TRAMRRIYLRACRRAYVLDADAQLFRVSRL 262

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score =  152 bits (383), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 145/280 (51%), Gaps = 21/280 (7%)

Query: 15  LHSITKDAIS-KVDTFPKN--KQHETLHRLNSFNENPTRKTLEKLVYSVHFHLLNDPPKH 71
           LH+ TK  I+  V +  K   K+ + +  +N +  +     L ++++ V+F +LN   +H
Sbjct: 17  LHAHTKKVIADNVGSVGKGEFKRVDVIEPINRYLLSGEVSYLRRVIFDVYFRILNPKAEH 76

Query: 72  VDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWSRNNKDALDFLSFNRHKWLRPK 131
           V    +Y  EL  FWPYE    +L  + P   S   LWSRNN   LD + ++RH WLR  
Sbjct: 77  VRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLWSRNNAKVLDIMRYDRHLWLR-- 134

Query: 132 NWQTPNEELIKDITGIDGLQSTQITEVLRLPAEK--IKET-----LRQIFEHYYFLKTNP 184
                + E    +  I G   TQ  + LR   +K  + ET     L+ IF HY F+K+ P
Sbjct: 135 -----DREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIALLKLIFSHYLFVKSRP 189

Query: 185 KLCATKKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLYSQNPVLTSDAESILT 244
            LC  K L  PIVE+GM P G D+ D+RIDNLF+K+ K     L    P L+ + ES+L 
Sbjct: 190 TLCGHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLLHDFPPLSREVESLLH 249

Query: 245 SIVNDPDLNRRTKRLYKNVASRSYLF--KDGKFEISELAR 282
           SI+ + D  R   RLYK   + +Y    K  +FE+S L R
Sbjct: 250 SIIKECD--RSMGRLYKWSCNGAYTMDPKTNQFEVSSLCR 287

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score =  147 bits (372), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 147/293 (50%), Gaps = 26/293 (8%)

Query: 7   RTSKLYKGLHSITKDAISKVDTFPKNKQHETLHRLNSFNENPTRKTLEKLVYSVHFHLLN 66
           RT  L +G   +   A+  +DT  +        +L  +  N   K+LE +VY+ +FH  N
Sbjct: 19  RTLDLLEGTVKLCSSAL--LDTLEQ--------KLFDYQANENSKSLEWIVYNTYFHWNN 68

Query: 67  DPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWSRNNKDALDFLSFNRHK 126
             P H+   RQ  ++L + WPYE    +L M  P   S   +W+ NNK  L  + F R+ 
Sbjct: 69  TTPLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKKVLSSMRFERNP 128

Query: 127 WLRPKNWQTPNEELIKDITGIDGLQ-----STQITEVLRLPAEKIKETLRQIFEHYYFLK 181
           W R    +  N   +  I     L+      + ++ + ++   ++     +IF+HY FLK
Sbjct: 129 WCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFHEIFQHYMFLK 188

Query: 182 TNPKLCA-TKKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLYSQNPVLTSDAE 240
            NPKLC   KKL  PIVEI MKP G DI  +RI NLFK+K      LL  +NPVL+ + E
Sbjct: 189 RNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKLLAEENPVLSLENE 248

Query: 241 SILTSIVNDPD-----LNRRTKRLYKNVASRSYLFKDGK-----FEISELARG 283
           ++L  I+  P       NR+ KRLY+     SY+  + +     F+IS+L++ 
Sbjct: 249 ALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICEDRSIGLDFQISKLSKN 301

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score =  141 bits (355), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 116/228 (50%), Gaps = 32/228 (14%)

Query: 51  KTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWS 110
           KTLE +++  +F   N+ P+H+   R++ NEL  FWPYE   +IL M  P   S   LWS
Sbjct: 47  KTLENIIHHTYFSWENEIPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWS 106

Query: 111 RNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKETL 170
             N   L  + +  + W R                   G + T++   LR          
Sbjct: 107 AGNPRVLAAMRYGSYGWNREGG----------------GERLTELERTLR---------F 141

Query: 171 RQIFEHYYFLKTNPKLCATKK-LQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLY 229
            +IF+H+ FL+  P+LC  +K L  PIVEI MKP G +IAD+RI NLFK+KV  +  +L 
Sbjct: 142 HEIFQHFLFLQRRPQLCKNRKHLSVPIVEIPMKPLGQNIADVRIKNLFKRKVAYVWRILA 201

Query: 230 SQNPVLTSDAESILTSIVNDPDL------NRRTKRLYKNVASRSYLFK 271
             NP L+++ ES+L  I+  P L      +R  KRLY+     +Y+ K
Sbjct: 202 VDNPALSAENESLLMDIIESPQLPQGQTSSRMLKRLYQRACRGAYVIK 249

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score =  124 bits (310), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 120/236 (50%), Gaps = 28/236 (11%)

Query: 41  LNSFNENPTRKTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDP 100
           ++ F ++   K LE L+   HF   N  P  +   + Y  EL   WPYE Q S+L M +P
Sbjct: 48  ISEFEKHNDHKYLEALIQKTHFLWDNPLPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNP 107

Query: 101 NLTSQTILWSRNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLR 160
              SQ  LW    + AL  L F +H+W         +E +I+                 R
Sbjct: 108 RKESQGYLWRDGKELALSNLRFEKHRW--------ADENIIE-----------------R 142

Query: 161 LPAEKIKETLRQIFEHYYFLKTNPKLCA-TKKLQAPIVEIGMKPDGFDIADIRIDNLFKK 219
           L  E+  + L  IF  Y+FLK++ +LC   +K+  PIVEI ++P G D+AD RI NLFK+
Sbjct: 143 LSPEQGTQLLHSIFHQYFFLKSHARLCYNNRKIPVPIVEIPLRPMGNDVADCRIRNLFKR 202

Query: 220 KVKLISDLLYSQNPVLTSDAESILTSIVNDPDLNRRTKRLYKNVASRSYLF-KDGK 274
           K  ++ +LL  +N  L++  E +L  I+   +  R  +RLY+  + R+Y+   +GK
Sbjct: 203 KTAVVWNLLAWENRPLSTRNEQLLGEIITKSE-TRSMRRLYQRASRRAYVVTNEGK 257

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  123 bits (308), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 116/227 (51%), Gaps = 28/227 (12%)

Query: 51  KTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWS 110
           K LE ++Y  HF   +  P H+ + + +  ++   WPYE   SIL M+ P  TS    W 
Sbjct: 60  KALESIIYHTHFVWGSPLPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRYRWE 119

Query: 111 RNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKETL 170
            ++K  L    ++++ W+                   D + S ++T + R          
Sbjct: 120 DSSKTVLSMAEYSKNPWIE------------------DNILSKKLTIIQR------DLLF 155

Query: 171 RQIFEHYYFLKTNPKLCAT-KKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLY 229
             +F HY FLK NP+LC   + L  PIVEI M+P G DIA  RI NLFK KV     +L 
Sbjct: 156 HSVFSHYLFLKANPRLCNNGRNLPIPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILA 215

Query: 230 SQNPVLTSDAESILTSIVNDPDLNRRTKRLYKNVASRSYL--FKDGK 274
            +NPVL+  +E+IL+ I++D   +R+ +RLY+    R+Y+  + DG+
Sbjct: 216 IENPVLSRGSENILSEIISDAS-SRKQRRLYQASCKRAYVMEYDDGE 261

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score =  122 bits (305), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 74/234 (31%), Positives = 115/234 (49%), Gaps = 32/234 (13%)

Query: 42  NSFNENPTRKTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPN 101
             +  + + K+LE +V+  +FH  N+   H+   R++  EL   WPYE   SIL MD P 
Sbjct: 38  QQYTADGSSKSLESIVHLTYFHWCNEDAPHIKKFREHYAELRDHWPYEFHRSILSMDTPK 97

Query: 102 LTSQTILWSRNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRL 161
             S   LWS N+   L  +S+ +        +    EE           + +++TE+ R 
Sbjct: 98  TQSIRFLWSSNSPKVLSKMSYEK--------YAHDTEE-----------RPSRLTELQR- 137

Query: 162 PAEKIKETLRQIFEHYYFLKTNPKLCATKK-LQAPIVEIGMKPDGFDIADIRIDNLFKKK 220
                     ++F+H+ FLK+ P LC T+K L  PIVEI MKP G +I ++R+ NLFK+K
Sbjct: 138 -----TVQFHEVFQHFLFLKSRPHLCKTRKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRK 192

Query: 221 VKLISDLLYSQNPVLTSDAESILTSIVNDPDL------NRRTKRLYKNVASRSY 268
           +  +  +L   +P L+   E  L  I++ P L       R  KRLY+     +Y
Sbjct: 193 IAYVWKVLALDSPALSRQNELSLAKIIDSPQLPEDVSSKRELKRLYQRACRGAY 246

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score = 96.7 bits (239), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/236 (31%), Positives = 106/236 (44%), Gaps = 26/236 (11%)

Query: 38  LHRLNSFNENPTRKTLEKLVYSVHFHLLNDP-PKHVDILRQYPNELAKFWPYEMQHSILE 96
           + ++NS  EN +R  LEK+V   H    ND  P H++  + +  EL   WPYE    +L 
Sbjct: 56  ISKINSKVENESR-ALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLN 114

Query: 97  MDDPNLTSQTILWSRNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQIT 156
           M  P  T   I    NN D      FN +K      W              + +   ++T
Sbjct: 115 MARPG-TGSLIYLCLNNDDRF----FNFYKSQINNKW-------------FNSVDQYKLT 156

Query: 157 EVLRLPAEKIKETLRQIFEHYYFLKTNPKLCATKKLQAPIVEIGMKPDGFDIADIRIDNL 216
           +  R+           IF+  +FLK +  +    K   PIVE+ +KP G DI   RI NL
Sbjct: 157 DEQRV------SIYNDIFKQIFFLKRHTTISEVNKNMVPIVEVPLKPIGCDIPACRIKNL 210

Query: 217 FKKKVKLISDLLYSQNPVLTSDAESILTSIVNDPDLNRRTKRLYKNVASRSYLFKD 272
           F KKV  I  LL   +P ++   E I+ +I+ D   NRR  RLY+     SY+F D
Sbjct: 211 FNKKVDYIWKLLSLSSPAISLSHEKIIMNILEDTKDNRRINRLYRRSLKNSYVFDD 266

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score = 89.4 bits (220), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 67/228 (29%), Positives = 109/228 (47%), Gaps = 36/228 (15%)

Query: 49  TRKTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTIL 108
           + KTLE ++Y  +F   ND   H+   ++  + L  FWP+ + HS +   D    S  + 
Sbjct: 67  SNKTLESIIYHTYFEWTNDLASHLKPFQRQYSTLLTFWPH-IYHSKI---DSKKNSIILT 122

Query: 109 WSRNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEK-IK 167
           W++         S N    LR         EL+  +     L          +P +K  +
Sbjct: 123 WNK---------SSNSKNMLR---------ELLSHLNYTQSL----------VPQKKDFQ 154

Query: 168 ETLRQIFEHYYFLKTNPKLCAT-KKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISD 226
              ++I++HY FL  NP LC+  K+L +PIVEI M   G+DI   RI+NL + K+    +
Sbjct: 155 VIFKKIYQHYIFLSLNPSLCSNGKRLPSPIVEIPMNAMGYDIPKKRINNLLRSKIARTWN 214

Query: 227 LLYSQNPVLTSDAESILTSIVNDPDL--NRRTKRLYKNVASRSYLFKD 272
            L   NP+L  + E+ L  I+N      +R+ ++LY+   S SY+ K+
Sbjct: 215 YLAITNPILNLENEAQLDEIINGSSAIKSRQLRKLYRRACSNSYVIKN 262

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score = 79.7 bits (195), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 96/227 (42%), Gaps = 47/227 (20%)

Query: 43  SFNENPTRKTLEKLVYSVHFHLLNDPPKHVD-ILRQYPNELAKFWPYEMQHSILEMDDPN 101
           S+      K LE ++Y ++F  LN+ P H+  +L QY   L   WP E +H   +  +P 
Sbjct: 57  SYETTGKSKFLESIIYRLYFQWLNEVPSHLKPLLNQY-EHLKSNWPIE-RHIKFKNAEPE 114

Query: 102 LTSQTILWSRNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRL 161
             S    W RN   A+D                         ++  DG+           
Sbjct: 115 AISLRNAWMRNKATAVD-------------------------LSTSDGV----------- 138

Query: 162 PAEKIKETLRQIFEHYYFLKTNPKLCATKKLQAPIVEIGMKPDGFDIADIRIDNLFKKKV 221
                   ++ I  H+ +L+ N      KK+  PI+E+ +   G +I + R++NL KK++
Sbjct: 139 --------IKPILNHFRYLRVNEDRLCKKKVGLPILEVPLNVFGTEIPECRVNNLLKKRI 190

Query: 222 KLISDLLYSQNPVLTSDAESILTSIVNDPDLNRRTKRLYKNVASRSY 268
             +   L   NP+L+   E  L SI+ND    R  KR+Y    SR+Y
Sbjct: 191 AHVKKSLLEDNPMLSPKLEDTLHSIINDSKNTRALKRVYLRSCSRAY 237

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score = 75.9 bits (185), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 60/235 (25%), Positives = 103/235 (43%), Gaps = 41/235 (17%)

Query: 51  KTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWS 110
           K LE + Y+ +F   N  P H+ + ++    L ++WP      +    D    S  + W+
Sbjct: 67  KVLESIAYNTYFIWNNPVPSHLQVFQKNNEMLRRYWPCVYHRGM----DTKRDSIIVQWA 122

Query: 111 R-NNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKET 169
           + NN DAL   + N    ++P       EEL+                            
Sbjct: 123 KSNNGDALLKGTMNH---IQPG---ASAEELL---------------------------M 149

Query: 170 LRQIFEHYYFLKTNPKLCA-TKKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLL 228
            ++IF+HY FL  N ++ +  K+LQ P+V + M   G  I  +R+ NLF+KKV   ++ L
Sbjct: 150 FKKIFQHYIFLTLNARITSNAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANAL 209

Query: 229 YSQNPVLTSDAESILTSIVND--PDLNRRTKRLYKNVASRSYLFKDGKFEISELA 281
            + NPVL  +    L  I+N    + +R  +RLY+  +  +++      E  + A
Sbjct: 210 CALNPVLNVENHGFLDEIINADYENTSRSLRRLYQRASKNAHVIAGESPESIQFA 264

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score = 69.3 bits (168), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 59/227 (25%), Positives = 102/227 (44%), Gaps = 14/227 (6%)

Query: 51  KTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWS 110
           K LE +VY  HF   N  P+H  + +++ + L   WP+E   S+++           L S
Sbjct: 67  KALESIVYQTHFQWNNPRPRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGKLISLTS 126

Query: 111 RNNKDALDFLSFNRHK--WLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKE 168
           + N    D+ +  + K  W+R               +    L    I E+    AE+   
Sbjct: 127 KGNWLKADWTTLFQVKNPWVR---------TPPPPPSPSLSLAQNSIAELDAFTAERTF- 176

Query: 169 TLRQIFEHYYFLKTNPKLCAT-KKLQAPIVEIGMKPDGFDIADIR-IDNLFKKKVKLISD 226
            ++ +  HY FL TN  L    KK  +P+V+I ++    +I+  + I  LF +++  I  
Sbjct: 177 LVKSLGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYT 236

Query: 227 LLYSQNPVLTSDAESILTSIVNDPDLNRRTKRLYKNVASRSYLFKDG 273
            L+ +NP L++  E  L ++ +D  L RR  RLY    +R+Y   + 
Sbjct: 237 SLFVENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIANA 283

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score = 63.9 bits (154), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 101/226 (44%), Gaps = 29/226 (12%)

Query: 51  KTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEM-----DDPNLTSQ 105
           K LE ++Y  HF   N  P+H  + +++ + L   WP+E    +++         N TS 
Sbjct: 67  KALESIIYQTHFQWNNPLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNGKLNSTSS 126

Query: 106 TILWSRNNKDALDFLSFN-RHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAE 164
             +W + +   L    FN ++ W+     QTP   +    T +D     +I  +      
Sbjct: 127 RSVWLKADWITL----FNVKNPWV-----QTPPSLMRLSGTDLDTFTPERIFLI------ 171

Query: 165 KIKETLRQIFEHYYFLKTNPKLCAT-KKLQAPIVEIGMKPDGFDIADIR-IDNLFKKKVK 222
                   +  HY FL  N  L    KK  +P V+I ++    +++  + I  LF +++ 
Sbjct: 172 ------NSLGNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLS 225

Query: 223 LISDLLYSQNPVLTSDAESILTSIVNDPDLNRRTKRLYKNVASRSY 268
            I   L+ +NP L+ + E  LT++  D  + RR +RLY    +R+Y
Sbjct: 226 HIYKSLFIENPPLSPENELALTAVFYDETVERRLRRLYMRACARAY 271

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 54/221 (24%), Positives = 95/221 (42%), Gaps = 16/221 (7%)

Query: 51  KTLEKLVYSVHFHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWS 110
           K LE +++  HF   N  P+H  + +++   L   WP+E   S+++    +      + S
Sbjct: 67  KALESIIFQTHFQWNNPRPRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNGKLNSMAS 126

Query: 111 RNNKDALDFLSFNRHKWLRPKNW-QTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKET 169
           +      D+ +  + K      W QTP         G   L +                 
Sbjct: 127 KGTWLKADWTTLFQVK----NTWVQTPPASTSPAYHGGANLDAFTPERTF---------L 173

Query: 170 LRQIFEHYYFLKTNPKLCAT-KKLQAPIVEIGMKPDGFDIA-DIRIDNLFKKKVKLISDL 227
           +  +  HY FL  N  L    KK   P V+I ++    +++   +I  LF +++  I   
Sbjct: 174 VNSLGNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTS 233

Query: 228 LYSQNPVLTSDAESILTSIVNDPDLNRRTKRLYKNVASRSY 268
           L+ +NP L++D E  L ++ +D  L+RR KRLY    +R+Y
Sbjct: 234 LFVENPPLSADNELALMAVFHDDSLDRRHKRLYMRACARAY 274

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 114/277 (41%), Gaps = 55/277 (19%)

Query: 15  LHSITKDAISK----VDTFPKNKQ-HETL---HRLNSFNENPTRKTLEKLVYSVH----- 61
           LHS+T   +S+      + P+ K   ETL   H + S  ++   K L  L+  ++     
Sbjct: 17  LHSLTLARLSRHVAATKSIPRLKHVAETLQNFHDVPSTKKHTQYKILTTLLLQLYCQWDN 76

Query: 62  -FHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWSRNNKDALDFL 120
            F  L+  P H+    Q    L + WP E   S+ +    + T +   W  NNK AL  +
Sbjct: 77  SFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLSLKQSTKGHATLKHA-WVTNNKHALQ-M 134

Query: 121 SFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKETLRQIFEHYYFL 180
           SF+        N  + N EL                          + +LRQI  HY  L
Sbjct: 135 SFDAAA----ANPTSGNIEL--------------------------RGSLRQILSHYQLL 164

Query: 181 KTNPKLCATKKLQAPIVEIGMKPDGFDIADIRIDNLFKKKVKLISDLLYSQNPVL-TSDA 239
             N ++    KLQ P+ EI +   G +I   R  NL ++KV  +  +L  + P L  ++ 
Sbjct: 165 YNNMRMFGKIKLQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTEC 224

Query: 240 ESILTSIV--NDPDLN------RRTKRLYKNVASRSY 268
            + LT+I+  + P         R+ +RLY+   +  Y
Sbjct: 225 IAELTAIIAGDGPAARSGNYSPRQLRRLYRRAFAGCY 261

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 117/283 (41%), Gaps = 34/283 (12%)

Query: 15  LHSITKDAI--SKVDTFPKNKQHET---LHRLNSFNENPTR--------KTLEKLVYSVH 61
           LH ITK+A+  +  DT    K  E    L +L   +E   R        K LE ++Y  H
Sbjct: 18  LHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQDLRTALKALESIIYQTH 77

Query: 62  FHLLNDPPKHVDILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWSRNNKDALDFLS 121
           F   N  P+H  + +++ + L   WP+E    +++    +      + S+      D+ +
Sbjct: 78  FKWNNPRPRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKGKLNSIPSKTTWLKADWAT 137

Query: 122 FNRHK--WLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAEKIKETLRQIFEHYYF 179
             + K  W+     QTP        T +D     +   V              +   Y F
Sbjct: 138 LFQVKNPWV-----QTPPTPKNLSETDLDAFTPERAFLV------------NSLGNQYKF 180

Query: 180 LKTNPKLCAT-KKLQAPIVEIGMKPDGFDIADIR-IDNLFKKKVKLISDLLYSQNPVLTS 237
           L  N  L    KK  +P V+I ++    +++  + I  LF +++  I   L+ +NP L+ 
Sbjct: 181 LIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEENPPLSP 240

Query: 238 DAESILTSIVNDPDLNRRTKRLYKNVASRSYLFKDGKFEISEL 280
             +  L +I ND  ++RR KRLY    +R+Y   +    I  L
Sbjct: 241 ANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNADSTIEPL 283

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 42.0 bits (97), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 83/186 (44%), Gaps = 22/186 (11%)

Query: 51  KTLEKLVYSVHFHLLNDPPKHVDILRQYP---NELAKFWPYEMQHSILEMDDPNL---TS 104
           K L+++++  H  + N+  K+ D L+ +    N L   WPYE +H IL   + N+    +
Sbjct: 73  KCLQRIIFKTHL-IFNNSYKNYDHLKAFKLKYNYLTHNWPYE-RHDILFAANKNVPETKA 130

Query: 105 QTILWSRNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQITEVLRLPAE 164
              LW+  N D L F+     K+++    Q  N+ + +       L+    +E+  L   
Sbjct: 131 LEYLWNNCNSDNLAFMG---SKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEI 187

Query: 165 KIK-----ETLRQIFEHYYFLKTNPKLCATKKLQAPIVEIGMKPDGFDIADIRIDNLFKK 219
             +         ++F+  +++ T        KLQ PIV + +   G  I   R+ N FKK
Sbjct: 188 IDEKEIEINLFGELFKQLHYINT------INKLQIPIVILPLNALGLKIPKSRLYNKFKK 241

Query: 220 KVKLIS 225
           K+++  
Sbjct: 242 KLQVFG 247

>YBL011W Chr2 (203538..205817) [2280 bp, 759 aa] {ON}  SCT1Glycerol
           3-phosphate/dihydroxyacetone phosphate dual
           substrate-specific sn-1 acyltransferase of the
           glycerolipid biosynthesis pathway, prefers 16-carbon
           fatty acids, similar to Gpt2p, gene is constitutively
           transcribed
          Length = 759

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 71/176 (40%), Gaps = 22/176 (12%)

Query: 26  VDTFPKNKQHETLHRLNSFNENPTRKTLEKLVYSVHFHLLNDPPKHVDI-LRQYPNELAK 84
           +  FP+   H+             R  L  L   V    L    KH D+ ++  P  +  
Sbjct: 247 IGIFPEGGSHD-------------RTNLLPLKAGVAIMALGCMDKHPDVNVKIVPCGMNY 293

Query: 85  FWPYEMQ-HSILEMDDPNLTSQTILWS----RNNKDALDFLSFNRHKWLRPKNWQTPNEE 139
           F P++ +  +++E  DP    + ++        N+DA+  L     K L+       + E
Sbjct: 294 FHPHKFRSRAVVEFGDPIEIPKELVAKYHNPETNRDAVKELLDTISKGLQSVTVTCSDYE 353

Query: 140 LIKDITGIDGLQSTQITEVLRLPAEKIKETLRQIFEHYYFLKTNPKLC-ATKKLQA 194
            +  +  I  L  TQ +  L LP   I E  R++ + Y F + +PK+   TK + A
Sbjct: 354 TLMVVQTIRRLYMTQFSTKLPLPL--IVEMNRRMVKGYEFYRNDPKIADLTKDIMA 407

>Ecym_4716 Chr4 complement(1405721..1407079) [1359 bp, 452 aa] {ON}
           similar to Ashbya gossypii AAR077C
          Length = 452

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%), Gaps = 8/52 (15%)

Query: 165 KIKETLRQIFEHYYFLKTNP--KLCATKKLQAPIVEIGMKPDGFDIADIRID 214
           K+ +  R+ FE Y F KT P  K   + + + PI ++GMKPD     D+R D
Sbjct: 26  KLTQQQRKTFEEYKFWKTQPVTKFGESIEEEGPI-KLGMKPD-----DVRND 71

>Skud_2.100 Chr2 (187076..189310) [2235 bp, 744 aa] {ON} YBL011W
           (REAL)
          Length = 744

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 70/172 (40%), Gaps = 21/172 (12%)

Query: 26  VDTFPKNKQHETLHRLNSFNENPTRKTLEKLVYSVHFHLLNDPPKHVDI-LRQYPNELAK 84
           +  FP+   H+             R  L  L   V    L    KH D+ ++  P  +  
Sbjct: 247 IGIFPEGGSHD-------------RTDLLPLKAGVAIMALGCMEKHPDVNVKIVPCGMNY 293

Query: 85  FWPYEMQ-HSILEMDDP-NLTSQTILWSRN---NKDALDFLSFNRHKWLRPKNWQTPNEE 139
           F P++ +  +++E  DP  +  + I    N   N++A+  L     K L+       + E
Sbjct: 294 FHPHKFRSRAVVEFGDPIEIPKELIAKYHNPETNREAVKELLDTISKGLQSVTVTCSDYE 353

Query: 140 LIKDITGIDGLQSTQITEVLRLPAEKIKETLRQIFEHYYFLKTNPKLCATKK 191
            +  +  I  L  TQ +  L LP   I E  R++ + Y F + +PK+   +K
Sbjct: 354 TLMVVQTIRRLYMTQFSSKLPLPL--IVEMNRRMVKGYEFYRNDPKIVDLRK 403

>TBLA0A09470 Chr1 complement(2331897..2333273) [1377 bp, 458 aa]
           {ON} Anc_5.646 YKL162C
          Length = 458

 Score = 30.4 bits (67), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 29/55 (52%), Gaps = 7/55 (12%)

Query: 73  DILRQYPNELAKFWPYEMQHSILEMDDPNLTSQTILWSRNNKD----ALDFLSFN 123
           DILR  PNEL +   Y  +  I E    NL +Q + +++N  D     +DFL+ N
Sbjct: 212 DILRYLPNELVR---YNFEKKIWEQGMINLENQYVWFNKNIDDECSNTIDFLNLN 263

>KLTH0F16698g Chr6 (1354232..1356262) [2031 bp, 676 aa] {ON} weakly
           similar to uniprot|P50273 YDR350C Saccharomyces
           cerevisiae CM10 Mitochondrial inner membrane protein
           required for assembly of the F0 sector of mitochondrial
           F1F0 ATP synthase
          Length = 676

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 26/59 (44%), Gaps = 10/59 (16%)

Query: 142 KDITGIDGLQSTQITEVLRLPAEKIKETLRQ----------IFEHYYFLKTNPKLCATK 190
           K I GI  LQ     E+ R     + ETL Q           F+HYYFL  N  L ++K
Sbjct: 122 KRIYGIIKLQKALYPEIARTNGILVPETLHQWFWQNLRKDETFQHYYFLIQNDVLLSSK 180

>KAFR0G02200 Chr7 (458391..459896) [1506 bp, 501 aa] {ON} Anc_6.124
           YBR227C
          Length = 501

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 144 ITGIDGLQSTQITEVLRLPAEKIKETLRQIFEHYYFLKTNPKLCATKKLQAPIVEIGM 201
           IT +D LQ+T +  +LR P   + +    IF+ +       +LC TKK    I ++ +
Sbjct: 354 ITALDPLQTTDLYNILREPKNALLDQYEYIFKQF-----GVRLCVTKKAIKRIAQLAL 406

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,183,608
Number of extensions: 1534141
Number of successful extensions: 5459
Number of sequences better than 10.0: 44
Number of HSP's gapped: 5624
Number of HSP's successfully gapped: 47
Length of query: 305
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 196
Effective length of database: 40,982,805
Effective search space: 8032629780
Effective search space used: 8032629780
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)