Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19206g8.265ON26326312331e-173
Ecym_43058.265ON3113113028e-32
AGR083W8.265ON2952962545e-25
Kpol_543.418.265ON3063092231e-20
SAKL0H16962g8.265ON3363382171e-19
NCAS0B038308.265ON3252892048e-18
YDR113C (PDS1)8.265ON3732911961e-16
TDEL0F039208.265ON3222641899e-16
Suva_2.2738.265ON3762951901e-15
ZYRO0C01584g8.265ON2822591834e-15
Skud_4.3748.265ON3732371854e-15
Kwal_56.237818.265ON2932831801e-14
Smik_4.3588.265ON3712881671e-12
NDAI0J013508.265ON4221491671e-12
CAGL0L12298g8.265ON2862751623e-12
TPHA0A017808.265ON3522851608e-12
KNAG0H032308.265ON2812101543e-11
KLTH0G13618g8.265ON3022961511e-10
TBLA0E044608.265ON2773041288e-08
KAFR0B055108.265ON2752801234e-07
TPHA0C044407.186ON1170122770.38
NDAI0A053203.328ON45365760.43
TBLA0C028501.282ON252572750.70
KAFR0D051105.453ON820106740.84
AGR086C8.262ON53492721.4
Kwal_26.82702.582ON102268721.5
KAFR0J012502.199ON114689721.5
SAKL0G17468g4.328ON42135711.7
NDAI0F005205.668ON57869711.9
Smik_7.3171.371ON460123702.3
YGL099W (LSG1)6.163ON640103693.3
TBLA0B023603.104ON306109683.6
Ecym_72764.156ON59395684.3
Skud_7.1756.163ON64085684.4
Smik_7.1746.163ON64085684.4
TBLA0A025405.475ON67847684.4
Kpol_1030.288.762ON69475684.5
NCAS0A093401.294ON99886684.7
KAFR0L016207.372ON493119675.6
TDEL0C017507.372ON58168675.7
Ecym_13848.863ON59879675.8
KLLA0D15268g3.447ON60595675.8
NCAS0A121805.523ON63674675.8
NDAI0C051908.484ON856115676.1
Smik_20.9singletonON14750646.8
Suva_8.2628.625ON42956667.1
ZYRO0D15598g7.184ON90174668.1
SAKL0H17094g8.259ON1422114668.4
KNAG0G014408.163ON161137668.5
Smik_13.158.852ON35782659.0
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KLLA0F19206g
         (792 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...   479   e-173
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...   120   8e-32
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...   102   5e-25
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    91   1e-20
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...    88   1e-19
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...    83   8e-18
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...    80   1e-16
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...    77   9e-16
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...    78   1e-15
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...    75   4e-15
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...    76   4e-15
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    74   1e-14
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...    69   1e-12
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    69   1e-12
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    67   3e-12
TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...    66   8e-12
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    64   3e-11
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    63   1e-10
TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {...    54   8e-08
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    52   4e-07
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    34   0.38 
NDAI0A05320 Chr1 complement(1199413..1200774) [1362 bp, 453 aa] ...    34   0.43 
TBLA0C02850 Chr3 (682683..690260) [7578 bp, 2525 aa] {ON} Anc_1....    33   0.70 
KAFR0D05110 Chr4 (1004456..1006918) [2463 bp, 820 aa] {ON} Anc_5...    33   0.84 
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...    32   1.4  
Kwal_26.8270 s26 complement(716412..719480) [3069 bp, 1022 aa] {...    32   1.5  
KAFR0J01250 Chr10 complement(230562..234002) [3441 bp, 1146 aa] ...    32   1.5  
SAKL0G17468g Chr7 (1513069..1514334) [1266 bp, 421 aa] {ON} simi...    32   1.7  
NDAI0F00520 Chr6 complement(121123..122859) [1737 bp, 578 aa] {O...    32   1.9  
Smik_7.317 Chr7 (529500..530882) [1383 bp, 460 aa] {ON} YFR012W ...    32   2.3  
YGL099W Chr7 (314631..316553) [1923 bp, 640 aa] {ON}  LSG1Putati...    31   3.3  
TBLA0B02360 Chr2 (551024..551944) [921 bp, 306 aa] {ON} Anc_3.10...    31   3.6  
Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}...    31   4.3  
Skud_7.175 Chr7 (318913..320835) [1923 bp, 640 aa] {ON} YGL099W ...    31   4.4  
Smik_7.174 Chr7 (309939..311861) [1923 bp, 640 aa] {ON} YGL099W ...    31   4.4  
TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.4...    31   4.4  
Kpol_1030.28 s1030 complement(54130..56214) [2085 bp, 694 aa] {O...    31   4.5  
NCAS0A09340 Chr1 complement(1847972..1850968) [2997 bp, 998 aa] ...    31   4.7  
KAFR0L01620 Chr12 complement(293645..295126) [1482 bp, 493 aa] {...    30   5.6  
TDEL0C01750 Chr3 (304284..306029) [1746 bp, 581 aa] {ON} Anc_7.3...    30   5.7  
Ecym_1384 Chr1 (797566..799362) [1797 bp, 598 aa] {ON} similar t...    30   5.8  
KLLA0D15268g Chr4 (1297155..1298972) [1818 bp, 605 aa] {ON} simi...    30   5.8  
NCAS0A12180 Chr1 (2413240..2415150) [1911 bp, 636 aa] {ON} Anc_5...    30   5.8  
NDAI0C05190 Chr3 (1205357..1207927) [2571 bp, 856 aa] {ON} Anc_8...    30   6.1  
Smik_20.9 Chr20 (11068..11511) [444 bp, 147 aa] {ON}  (REAL)           29   6.8  
Suva_8.262 Chr8 complement(475279..476568) [1290 bp, 429 aa] {ON...    30   7.1  
ZYRO0D15598g Chr4 (1301578..1304283) [2706 bp, 901 aa] {ON} simi...    30   8.1  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...    30   8.4  
KNAG0G01440 Chr7 (324547..329382) [4836 bp, 1611 aa] {ON} Anc_8....    30   8.5  
Smik_13.15 Chr13 (26900..27973) [1074 bp, 357 aa] {ON} YML119W (...    30   9.0  

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score =  479 bits (1233), Expect = e-173
 Identities = 242/263 (92%), Positives = 242/263 (92%)
 Frame = +1

Query: 1   MPNEGKENIISVQDPDNDLGLRTPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNA 180
           MPNEGKENIISVQDPDNDLGLRTPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNA
Sbjct: 1   MPNEGKENIISVQDPDNDLGLRTPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNA 60

Query: 181 ALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXX 360
           ALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGMNTFMPRTKSLVL              
Sbjct: 61  ALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGMNTFMPRTKSLVLKDTELNEKNDDEDE 120

Query: 361 XXXXXXXPIFPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPFDKE 540
                  PIFPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPFDKE
Sbjct: 121 EDEEDDLPIFPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPFDKE 180

Query: 541 SIEKLQHHRSPFQVESITFDTEERDPELISLAATDEDLVSPTRYNNHKHNLELDSDNESI 720
           SIEKLQHHRSPFQVESITFDTEERDPELISLAATDEDLVSPTRYNNHKHNLELDSDNESI
Sbjct: 181 SIEKLQHHRSPFQVESITFDTEERDPELISLAATDEDLVSPTRYNNHKHNLELDSDNESI 240

Query: 721 TIELGEEYNGQGLDTLELNSLLD 789
           TIELGEEYNGQGLDTLELNSLLD
Sbjct: 241 TIELGEEYNGQGLDTLELNSLLD 263

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score =  120 bits (302), Expect = 8e-32
 Identities = 111/311 (35%), Positives = 150/311 (48%), Gaps = 50/311 (16%)
 Frame = +1

Query: 7   NEGKENIISVQDPDNDLGLRTPLNQMKRTDS---LVRGNRRPLASKDNNRTQSILSVKNN 177
           +E KENI +  +P   +  RTP++Q+KR+ S   L   +R PLASKD NR+QS  ++K  
Sbjct: 4   HEDKENIPTGSEPSGSIVPRTPMHQLKRSTSNVHLKNNSRLPLASKDRNRSQSGFNLKQQ 63

Query: 178 AALGK-------SDHPLKRPAS-SFMKNMPENKLKKYGSVLGMN-TFMPRTKSLVL--XX 324
              G          +  KRPAS SF+KNMP++KLKKYGSVLG+N   + +TKSLVL    
Sbjct: 64  LVQGHVGGGVMVGQNKSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVLKDAS 123

Query: 325 XXXXXXXXXXXXXXXXXXXPI-------FPSG--------KSLNLGFGNGLKALIR---- 447
                              P+         SG         S  L  G GLK LI+    
Sbjct: 124 DGSQDNGEESDDYDDEEGNPLAAKLRSRLTSGVEDENEDDGSSGLLLGGGLKKLIKLHES 183

Query: 448 ---EKEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPF----QVESITFDTE 606
              + E+   IE AP++  EL +IPNGY+ F+ E I KL  + SPF      E    D+ 
Sbjct: 184 DNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFADREEDDSDST 243

Query: 607 ERDPELISL--AATDEDLVSPTRYNNHKHNLELDSDNESITIELGEEYN--------GQG 756
           E +  LI L     DE   SP++        E    N++I  ELG + +        G+G
Sbjct: 244 EGERLLIPLDFGGIDE---SPSKKQELMATQENIIANKTIVDELGTQADEIQFSFDIGKG 300

Query: 757 LDTLELNSLLD 789
           L + EL SLLD
Sbjct: 301 LSSNELQSLLD 311

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score =  102 bits (254), Expect = 5e-25
 Identities = 96/296 (32%), Positives = 139/296 (46%), Gaps = 35/296 (11%)
 Frame = +1

Query: 7   NEGKENIISVQDPDNDLGLRTPLNQMKRTDSLVRGN---RRPLASKDNNRTQSILSVKNN 177
           +E KEN+++       +  RTP++Q+KR+ S + G    R PLASKD N++Q +  +K +
Sbjct: 4   HEDKENLVTSAGRGAMMP-RTPIHQLKRSSSNLAGRNSTRMPLASKDRNQSQGVFGLKTS 62

Query: 178 AA--LGKSDHPLKRPASSFM-KNMPENKLKKYGSVLGMN-TFMPRTKSLVLXXXXXXXXX 345
            A   G +    KRPASS + KNMP++KLKKYGSVLG+    + + KSLVL         
Sbjct: 63  GAGGAGGAQAQSKRPASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLVL--KDTSDCE 120

Query: 346 XXXXXXXXXXXXPIFPSGK---------------SLNLGFGNGLKALI---REKEDELNI 471
                       P+    K               S  L  G  L  L      +ED   +
Sbjct: 121 SANEESEEEEGNPLAAKLKSRLCSAEEGGNEDDGSSGLLLGEALSQLAAAGETQEDVPPV 180

Query: 472 EYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDP----ELISL-- 633
           EYAP++  ELP++PNGY+      + KL  + SPF       D E  +P    +LI L  
Sbjct: 181 EYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRFGDKEDEENTEPGDSQQLIPLEF 240

Query: 634 AATDEDLVSPTRYNNHKHNLELD----SDNESITIELGEEYNGQGLDTLELNSLLD 789
            A D+   S    +   +   L     S  E   ++  E   G+GLD+ +L+SLLD
Sbjct: 241 GALDDSQSSSDEDDATSNGAALGAIALSQEEPDEVQF-EFAVGEGLDSKDLHSLLD 295

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 90.5 bits (223), Expect = 1e-20
 Identities = 93/309 (30%), Positives = 132/309 (42%), Gaps = 48/309 (15%)
 Frame = +1

Query: 7   NEGKENIISVQDPDNDLGLRTPLNQMKRTDSLVR---------GN--------RRPLASK 135
           ++ KEN I       D+  +TP N +KRT S ++         GN        R PLASK
Sbjct: 2   DQNKENNIFRHAMLKDMP-QTPNNLLKRTHSKLKTGIAKDIQGGNVINTSPQKRLPLASK 60

Query: 136 DNNRTQSILSVKN------------------NAALGKSDHPLKRPASSFMKNMPENKLKK 261
           DNNR+ S L+  N                  N    K  H  ++  S  + +  + KLKK
Sbjct: 61  DNNRSNSFLNNSNVNLNFNINNNNNNNNNNINNNNIKKQHIFQQNKSGILAD--DRKLKK 118

Query: 262 YGSVLGMNTFMPRTKSLVL------XXXXXXXXXXXXXXXXXXXXXPIFPSGKSLNLGFG 423
           YGSVLG N  +P+ KSLVL                               S   + L  G
Sbjct: 119 YGSVLGYNA-LPKVKSLVLKDISDNEDDDDDLLSLKLRDSMNKKSINTNKSNSGIGLLSG 177

Query: 424 NGLKALIRE-KEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFD 600
             L+ LIR+  ED   IE+      +  YIP+ + PFD+  I KL+   SPF++E    D
Sbjct: 178 GNLQQLIRDANEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLEQSNSD 237

Query: 601 TEERDPELISLAATDEDLVSPTRYNNHKHNLELDSDNESITI------ELGEEYNGQGLD 762
            EE   EL+ LA T +D  +         NL +++   S  +      ++   Y G+GLD
Sbjct: 238 DEEDSSELLLLANTSDDEGTHNDKITTNKNLSINNKPNSKDVIPADILDIEPSY-GEGLD 296

Query: 763 TLELNSLLD 789
           + +L  LLD
Sbjct: 297 SNDLEDLLD 305

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
            similar to uniprot|P40316 Saccharomyces cerevisiae
            YDR113C PDS1 Securin that inhibits anaphase by binding
            separin Esp1p also blocks cyclin destruction and mitotic
            exit essential for cell cycle arrest in mitosis in the
            presence of DNA damage or aberrant mitotic spindles also
            present in meiotic nuclei
          Length = 336

 Score = 88.2 bits (217), Expect = 1e-19
 Identities = 90/338 (26%), Positives = 139/338 (41%), Gaps = 77/338 (22%)
 Frame = +1

Query: 7    NEGKENIISVQDPDNDLGLRTPLNQMKRTDSLVR-----------GNRRPLASKDNNRTQ 153
            +E KEN+I      ++    TP + +KR+ S ++           G R PLASKDNN++ 
Sbjct: 4    HENKENVIF----SSENLPTTPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSN 59

Query: 154  SILS----------VKNNAALG----KSDHPLKRPASSFMKN---------MPENKLKKY 264
            ++++            NN+ L     K + P+     SF+           +P+++LKKY
Sbjct: 60   TLINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKY 119

Query: 265  GSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXX--------PIFPSG-KSLN-- 411
            GSVLG N  +PR KSLVL                             P+     K+LN  
Sbjct: 120  GSVLGYNG-LPRVKSLVLKDVDERKVGKSEEGEEEEEDDDEEEEEDNPLAAKLLKALNNH 178

Query: 412  ------------LGFGNGLKALIREKEDE------LNIEYAPKRQKELPYIPNGYDPFDK 537
                        LG   GL+ L++ +  E        IE  P   +ELP++PNGY PF +
Sbjct: 179  NEDDKEEGSIGLLGSNTGLQQLLKHRNVEEGENSDFEIEIVPPHSEELPHVPNGYSPFKE 238

Query: 538  ESIEKLQHHRSPFQVESITFDTEERDPE----LISLAATDEDLVSPTRYNNHKHNLELDS 705
              + KL    SPF +     D EE D       IS+  ++++       +  +    +D 
Sbjct: 239  SDVIKLNTFTSPFSMHKEDSDCEECDDYDGLLTISMVKSEDEEQDDDTNDRKRRKSWIDE 298

Query: 706  ----------DNESITIELGEEYNGQGLDTLELNSLLD 789
                      D     + +   YNG+GL+  +L SLLD
Sbjct: 299  GLATARHGLFDFNKPELYIEPHYNGEGLNKEDLESLLD 336

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score = 83.2 bits (204), Expect = 8e-18
 Identities = 84/289 (29%), Positives = 123/289 (42%), Gaps = 52/289 (17%)
 Frame = +1

Query: 76  NQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMPEN-- 249
           N +  TD L  GN  P       R + +L ++N   L K D+     + S  KN   N  
Sbjct: 48  NSVNATDEL--GNISP-------RRRQLLQLQNRLPLAKKDN--NNSSFSSRKNGLNNIK 96

Query: 250 KLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXXPIFPSGKS-------- 405
           KLKKYGSVLGM+  +PRTKSL+L                      +  + K         
Sbjct: 97  KLKKYGSVLGMDA-LPRTKSLILKDVDDKPDDDEEDEDDNAFGLKLRNAMKQHENNSNEE 155

Query: 406 -----LNLGFG-------------NGLKALIREK--------------------EDELNI 471
                  LG G              GL+ LIRE                     + +  I
Sbjct: 156 ENEGMSGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREI 215

Query: 472 EYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISL----AA 639
           EYAP R++ LP++P GY PF  E I KL+   S ++++S     E+ D +L++L     +
Sbjct: 216 EYAPIREEPLPFVPFGYTPFTPEDINKLKTFHSSYKLDSPVSTVEDAD-KLLALETIETS 274

Query: 640 TDEDLVSPTRYNNHKHNLELDSDNESITIELGEEYNGQGLDTLELNSLL 786
            D++        +H+     DS+++S  I+L   YNG+GLD  +L  LL
Sbjct: 275 VDDEAEWEHEVRHHRRRPTRDSNDDS--IDLVPLYNGEGLDEDDLQDLL 321

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score = 80.1 bits (196), Expect = 1e-16
 Identities = 84/291 (28%), Positives = 117/291 (40%), Gaps = 67/291 (23%)
 Frame = +1

Query: 115 RRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKN------------------- 237
           R PLA+KDNNR++S +  + +     +D P  +   S  KN                   
Sbjct: 85  RLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLSIRKNDQLRKLSQISRSRSRANHN 144

Query: 238 ---MPENKLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXXPIFPSGKSL 408
                  KL+KYGSVLG N  +P+ KSLVL                          GK L
Sbjct: 145 DLLSNSRKLQKYGSVLGYNA-LPKMKSLVLKDLADSGKNEESSDDDEGNEDSESKLGKKL 203

Query: 409 ----------------NLGFG-----NGLKALIR--------------EKEDELNIEYAP 483
                           N G G      GL+ LI+              +K D+ +IE AP
Sbjct: 204 QSALLKQDSSDGENELNGGLGLFNEQGGLQQLIKNSTKNEQKTKNDKSDKTDDYDIEIAP 263

Query: 484 KRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISLAATDE----- 648
           +RQ+ LPY+P GY PF ++ IEKL+   SP++++    D      +L+ L   DE     
Sbjct: 264 QRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLEDEDDTPDKVDLLPLEQIDEEGEKD 323

Query: 649 DLVSPTRYNNHKHNLELDSDN-----ESITIELGEEYNGQGLDTLELNSLL 786
           +    TR       L L S N        T+EL   Y+ +GLD  EL  L+
Sbjct: 324 ETECITRNQEEGAALPLLSKNFKEVAAVPTMEL--VYSEEGLDPEELEDLV 372

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score = 77.4 bits (189), Expect = 9e-16
 Identities = 81/264 (30%), Positives = 115/264 (43%), Gaps = 36/264 (13%)
 Frame = +1

Query: 103 VRGNRRPLASKDNNRTQSIL----------SVKNNAALGKSDHPLKRPASSFMKNMPEN- 249
           V+  R PLASKDNNR+   L          S+K N +  K     KR A+     +  N 
Sbjct: 68  VQQGRPPLASKDNNRSTGFLPQLQKLQQQPSLKRNLSQSK-----KRNANVVDGQLLTNP 122

Query: 250 -KLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXXPIF-----------P 393
            +LKKYGSVLG N  +P+ KSLVL                      +             
Sbjct: 123 RRLKKYGSVLGYNA-LPKMKSLVLKDVDQVGEQGEDENDDEDEDHILRLKLHNAIDRSDE 181

Query: 394 SGKSLNLGFG-NGLKALIRE-KEDE-----LNIEYAPKRQKELPYIPNGYDPFDKESIEK 552
            G+ +   F  +GL  L+R+ K+DE       IEY P+R + LPYIP G+    +E  +K
Sbjct: 182 EGEEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYDK 241

Query: 553 LQHHRSPFQVESITFDTEERDP------ELISLAATDEDLVSPTRYNNHKHNLELDSDNE 714
           L+  RSP+ +E    D+++         E I  A  DE++         +  L      +
Sbjct: 242 LKTFRSPYLIEDDYSDSDDDKQDGFLQLEEIGSAGDDENIERENLTVKQREMLP-----Q 296

Query: 715 SITIELGEEYNGQGLDTLELNSLL 786
             T E+   Y G+GLD  +LN LL
Sbjct: 297 YDTFEIQPSYCGEGLDASDLNDLL 320

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score = 77.8 bits (190), Expect = 1e-15
 Identities = 85/295 (28%), Positives = 117/295 (39%), Gaps = 71/295 (24%)
 Frame = +1

Query: 115 RRPLASKDNNRTQSI----------------------LSVKNNAALGKSDHPLKRPASSF 228
           R PLA+KDNNR++S                       LS + N  L K     +      
Sbjct: 84  RLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNTLSTRKNDQLRKLSQVSRNRNRGN 143

Query: 229 MKNMPEN--KLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXXPIFPSGK 402
              M  N  KL+KYGSVLG N  +P+ KSLVL                           +
Sbjct: 144 YNGMLNNSRKLQKYGSVLGYNA-LPKMKSLVLKDLADPAKNQESSDDDDGSEGTDNKLSQ 202

Query: 403 SLNLGF---------------------GNGLKALIR-----------EKEDELNIEYAPK 486
            L   F                       GL+ LI+           E  D+ +IE AP+
Sbjct: 203 KLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNTAKGKEGPGKEDGDDHDIEIAPQ 262

Query: 487 RQKELPYIPNGYDPFDKESIEKLQHHRSPF--QVESITFDTEERDP-ELISLAATDE--- 648
           RQ+ LPY+P+GY PF +E I KL+   SP+   +E  + +T   D   L+SL   +E   
Sbjct: 263 RQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLEGNSNNTNSADKVGLLSLVEVNEEDE 322

Query: 649 ---------DLVSPTRYNNHKHNLELDSDNESITIELGEEYNGQGLDTLELNSLL 786
                    D   P   +    N E D DN ++ + +   YNG+GLD+ EL  LL
Sbjct: 323 KDNTTHTIGDQQEPAELSLALQNSE-DDDNAAMPL-IESLYNGEGLDSEELEDLL 375

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score = 75.1 bits (183), Expect = 4e-15
 Identities = 80/259 (30%), Positives = 119/259 (45%), Gaps = 19/259 (7%)
 Frame = +1

Query: 67  TPLNQMKRTDSLVRGNRR-PLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMP 243
           TP+ +  R+ S VRG RR PLASKD+N++         +A G    P+K+   +    + 
Sbjct: 47  TPVKK-SRSVSPVRGQRRLPLASKDHNKS---------SAAG----PVKKRQPTLQGELL 92

Query: 244 EN--KLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXXP-IFPSGKSLNL 414
            N  KL+KYGSVLG  T +PRTKSLVL                            +  N 
Sbjct: 93  SNPRKLQKYGSVLGY-TDLPRTKSLVLKDGDDEDDDEEEENSELQKKLQDAMNRREDSNE 151

Query: 415 GFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESIT 594
           G G GL  L+R+ +D+  IEYAP R   L Y P+G+  ++ E I KL+  +   ++    
Sbjct: 152 GLG-GLAKLVRDTKDD--IEYAPHRLPPLEYAPDGHTRWEDEDIVKLK--KVDLRIRDDQ 206

Query: 595 FDTEERDPE--------LISLAATDEDL-------VSPTRYNNHKHNLELDSDNESITIE 729
            D E+ +P+        L+S+ + +ED        + P  +  H        D + +   
Sbjct: 207 DDHEDNEPQENDDGLLPLMSIESNNEDSNENEADEILPKNHRIHPFPKLRVFDEDQVE-- 264

Query: 730 LGEEYNGQGLDTLELNSLL 786
               YNG+GL+  EL  LL
Sbjct: 265 --NIYNGEGLNAEELEDLL 281

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score = 75.9 bits (185), Expect = 4e-15
 Identities = 67/237 (28%), Positives = 93/237 (39%), Gaps = 58/237 (24%)
 Frame = +1

Query: 115 RRPLASKDNNRTQSILSVKNNAALGKSDH--PLKRPASSFMKNMP--------------- 243
           R PLA+KDNNR++S + V     L K     P ++   S  KN                 
Sbjct: 84  RLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNTLSIRKNDQLRQLSQISRNRTRAN 143

Query: 244 -------ENKLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXXPIFPSGK 402
                    KL+KYGSVLG N  +P+ KSLVL                     P    G 
Sbjct: 144 YNELLNNSRKLQKYGSVLGYNA-LPKMKSLVLKDLAGPAKNQESSDDDDGSEGPESKLGV 202

Query: 403 SLNLGF---------------------GNGLKALIR-------------EKEDELNIEYA 480
            L   F                       GL+ LI+             + +D+  IE A
Sbjct: 203 KLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNTTKGKQGSKEEDDDDDDYEIEIA 262

Query: 481 PKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISLAATDED 651
           P+RQ+ LPY+P+GY  F +E IEKL+   SP++++            L+SL   DE+
Sbjct: 263 PQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELDLEDHGDSVDRVGLLSLEVIDEE 319

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 73.9 bits (180), Expect = 1e-14
 Identities = 84/283 (29%), Positives = 115/283 (40%), Gaps = 42/283 (14%)
 Frame = +1

Query: 67  TPLNQMKRTDSLVRG-------NRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASS 225
           TP + + R+ S ++         R+PLASKDNN++   L  K    L K   P    A S
Sbjct: 20  TPTHLLSRSQSFMKNISPKRAEQRKPLASKDNNKSTGFLGAKE--PLRKRTRPTVNHAGS 77

Query: 226 FMKNMPENKLKKYGSVLGMNTF-MPRTKSLVLXXXXXXXXXXXXXXXXXXXXXPIFPS-- 396
           F+ N       + G V  +NT   PR KSLVL                         +  
Sbjct: 78  FIGNT------RPGVVPILNTNGAPRIKSLVLKDDIEEEQSQSDGGEAEDDESNSLAAKL 131

Query: 397 -GKSLN-------------LGFGNGLKALIREK--------EDELNIEYAPKRQKELPYI 510
            GK LN             LG   GL+ L   K        + +L +E  P R + LP+I
Sbjct: 132 RGK-LNARDRDDSTEQGGLLGATGGLQGLANTKLHSETLDSDSDLEVEVIPPRPEPLPHI 190

Query: 511 PNGYDPFDKESIEKLQH-HRSPFQVESITFD---TEERDPELISLAATDEDLVSPTRYNN 678
           P+GY PF  E I KLQ    SPFQ+     D   + +   +L +L   ++D +    ++ 
Sbjct: 191 PHGYTPFTDEDIGKLQDTEASPFQLNFADDDDDASSQDSTQLFTLKLDNDDNLGDQEHDR 250

Query: 679 HK-HNLELDSDNESIT-----IELGEEYNGQGLDTLELNSLLD 789
            + H  E      SI       EL   Y G GL T EL SLL+
Sbjct: 251 KRLHTPEKKPTRASIAQQAADFELDPIYAGHGLSTKELESLLE 293

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score = 68.9 bits (167), Expect = 1e-12
 Identities = 79/288 (27%), Positives = 115/288 (39%), Gaps = 64/288 (22%)
 Frame = +1

Query: 115 RRPLASKDNNRTQSILSVKNNA----------------ALGKSDHPLKRPASSFMKNMPE 246
           R PLA+KDNNR +S + +  N+                ++ K+D   K    S  +N   
Sbjct: 84  RLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNTLSIRKNDQLRKLSQISRNRNRVN 143

Query: 247 N--------KLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXXPIFPSGK 402
           +        KL+KYGSVLG N  +P+ KSLVL                           K
Sbjct: 144 HSDLLNNTRKLQKYGSVLGYNA-LPKMKSLVLKDLVDPGKNEESSDDDDGSEGSENKLSK 202

Query: 403 SL------------------NLGFGN---GLKALIR-----------EKEDELNIEYAPK 486
            L                  ++G  N   GL+ LI+           +  D   IE AP+
Sbjct: 203 KLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNSVQNESKSKSDNADGYEIEIAPQ 262

Query: 487 RQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISLAATDE-----D 651
           R   LPY+P+GY PF +E I+KL+   SP++++           +L+ L A +E     +
Sbjct: 263 RLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELDLEDDGGSTDKVDLLPLEAINEESEQDE 322

Query: 652 LVSPTRYNNHKHNLELDSDN-ESITI--ELGEEYNGQGLDTLELNSLL 786
           +V           L L S N   IT    +    NG+GLD  EL  L+
Sbjct: 323 IVHIAGDREEGTPLPLLSKNLRKITAIPTIESLCNGEGLDPEELEDLI 370

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 68.9 bits (167), Expect = 1e-12
 Identities = 49/149 (32%), Positives = 70/149 (46%), Gaps = 37/149 (24%)
 Frame = +1

Query: 454 EDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEER-----DP 618
           ++E +IEYAP R+  LPYIP GY PF  E I KL+ + SPF +     D ++      DP
Sbjct: 271 DEEDDIEYAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIHHDHSDYQQSPSTLGDP 330

Query: 619 ELI--------SLAATDEDLVSPTRY-------------NNHKHNLEL----DSDNES-- 717
           E++          A T     SP+ Y              + KHN  +    ++DNES  
Sbjct: 331 EMLLSLQSFDTQTATTSSSCASPSLYPTTPIHKDTNINTTDQKHNTVILNVHNNDNESEG 390

Query: 718 -----ITIELGEEYNGQGLDTLELNSLLD 789
                   E+ + YNG GLD  +LN L++
Sbjct: 391 EYGGEHDQEIDKIYNGDGLDEDDLNDLIN 419

 Score = 34.7 bits (78), Expect = 0.24
 Identities = 38/117 (32%), Positives = 47/117 (40%), Gaps = 18/117 (15%)
 Frame = +1

Query: 22  NIISVQDPD-----------NDLGL-RTPLNQMKRTDSLVRGNRRPLASKDNNRTQSILS 165
           +I+S Q PD           +D G    P N   R   L   NR PL+ KDNN +     
Sbjct: 50  SILSKQKPDIKPGNLELQLQSDAGAGAVPPNISPRRQLLQLQNRFPLSKKDNNNS----- 104

Query: 166 VKNNAALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGMNT------FMPRTKSLVL 318
                        LK+    F       +LKKYGSVLG+ T       + R KSLVL
Sbjct: 105 -----------FILKQQQQQF----DHKRLKKYGSVLGLGTDGNNHNNLTRIKSLVL 146

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 67.0 bits (162), Expect = 3e-12
 Identities = 75/275 (27%), Positives = 115/275 (41%), Gaps = 31/275 (11%)
 Frame = +1

Query: 58  GLRTPLNQMKRTDSLV----RGNRRPLASKDNN--RTQSILSVKNNAALGKSDHPLKRPA 219
           G  TP   +KRT S +     G R+PLASKD N  R+ S LS+K N     S+    +PA
Sbjct: 20  GPATPTQLLKRTRSTLLPKKNGQRQPLASKDKNYNRSSSYLSLKRN-----SNQKKLKPA 74

Query: 220 SSFMKNMPENKLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXXP---IF 390
            +   +   N  ++  S++  +      K                               
Sbjct: 75  VTRAGSTANNANRRVTSLILKDIASGDEKESASESDSEDDEESNPLALKIKQALTHSIAS 134

Query: 391 PSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQ---- 558
             GK+  L   +GL+ +  +++ +  IE A  R+ E PY P GY+P D   +EKL+    
Sbjct: 135 AEGKTGLLNGKSGLRKIFNDRDLDREIEVASVREPEKPYEPEGYEPLDDSDLEKLKLKNA 194

Query: 559 HHRSPFQVES--------------ITFDTEERDPE---LISLAATDEDLVSPTRYNNHKH 687
            +R  F ++S              +  D EE   E   L     TDE +   TR N    
Sbjct: 195 INRPTFIMDSPRAISIVGDDSPQLLPLDLEESKLEEGVLNDKNTTDEVI---TRANTQAK 251

Query: 688 NLEL-DSDNESITIELGEEYNGQGLDTLELNSLLD 789
           N  + +S ++  ++E+   Y+G+GLD  EL  LLD
Sbjct: 252 NANITESIDDCSSVEIDSIYDGRGLDEQELLDLLD 286

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score = 66.2 bits (160), Expect = 8e-12
 Identities = 75/285 (26%), Positives = 115/285 (40%), Gaps = 56/285 (19%)
 Frame = +1

Query: 103 VRGNRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGM 282
           ++ NR PLASKDNN ++      N+  L  +   L +  S    N   NKL+KYGS+LG+
Sbjct: 72  IKLNRLPLASKDNNNSRR----SNSFILQNNKLVLNKQLSLLNNNQTSNKLRKYGSILGV 127

Query: 283 NTFMPRT-------KSLVLXXXXXXXXXXXXXXXXXXXXX--------------PIFPSG 399
           N     T       KSL+L                                   P+    
Sbjct: 128 NNNGNNTNKTLNPVKSLILKDIPDNGNENDDDDDDDDDNIITLNLKNALQSKKEPLLNQL 187

Query: 400 KSLN--------------LGFGNGLKALIREK-------EDEL--NIEYAPKRQKELPYI 510
           K+                 G GNGL+ LI +        E E+   IE       +L Y 
Sbjct: 188 KNAKKNSYSDSEEEEIGLFGKGNGLQKLISQSMNHKTKIEAEIIPEIETKSAAYPDLSYS 247

Query: 511 PNGYDPFDKESIEKLQHHRSPFQ----VESITFDTEERDP----ELISLAATDED----L 654
           P GY PF+ E I+KL   +SP+      +S+  D    +     EL ++ ++D+D    L
Sbjct: 248 PEGYIPFNNEDIKKLNTFKSPYSNLNVNDSLLADHNNNNNSGLLELENVGSSDDDDDNNL 307

Query: 655 VSPTRYNNHKHNLELDSDNESITIELGEEYNGQGLDTLELNSLLD 789
           ++ +   + + + + + +   I  E+   YN  GLD  EL +LLD
Sbjct: 308 LNISNIQDGRGSRQTNDNETFIDFEIQPSYN-DGLDANELENLLD 351

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 63.9 bits (154), Expect = 3e-11
 Identities = 61/210 (29%), Positives = 96/210 (45%), Gaps = 24/210 (11%)
 Frame = +1

Query: 7   NEGKENIISV-QDPDNDL------GLRTPLNQMKRTDSL----VRGNRRPLASKDNNRTQ 153
           NE KEN ++V Q P +++       L+   ++ K++ S+     RG R PLASKDNN + 
Sbjct: 4   NEDKENAVAVPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRGGRLPLASKDNNASG 63

Query: 154 SILSVKNNAALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGM-NTFMPRTKSLVLXXXX 330
            ++S K    LG      ++PA    +     KLK+YGS+LG  N  + R+KSL+L    
Sbjct: 64  LVVSGK----LG------RQPADQVREANSSRKLKRYGSLLGYDNRQLTRSKSLILKDPE 113

Query: 331 XXXXXXXXXXXXXXXXXPIFPSGK------------SLNLGFGNGLKALIREKEDELNIE 474
                             I  +               +    G GL  L+R+ ++   +E
Sbjct: 114 APNESSKSVTKRLLLDEEIAKNSSDGDDDGDDTDILKIRSQLGGGLDRLVRQSQNR-ELE 172

Query: 475 YAPKRQKELPYIPNGYDPFDKESIEKLQHH 564
             P+ Q ELPYIP+G+    +  I KL+ +
Sbjct: 173 IRPQAQDELPYIPDGHIILHEADIAKLRDY 202

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 62.8 bits (151), Expect = 1e-10
 Identities = 78/296 (26%), Positives = 110/296 (37%), Gaps = 55/296 (18%)
 Frame = +1

Query: 67  TPLNQMKRTDSLVRGN-------RRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASS 225
           TP + + R+ S ++         RRPLASKDNNR+ S L  K    L K   P    A S
Sbjct: 20  TPRHLLSRSQSFMKNKSPKRAEARRPLASKDNNRSVSYLGTKE--PLRKRTRPGVNHAGS 77

Query: 226 FMKNM---PENKLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXXPIF-- 390
           F+ N    P   L   G+        P+ KSLVL                          
Sbjct: 78  FVGNARLGPAPTLNASGA--------PKIKSLVLKDGIEEEGSQSEGAEVDEDDDDDSNR 129

Query: 391 ---------------PSGKSLNL-GFGNGLKALI--------REKEDELNIEYAPKRQKE 498
                            G+   L G   GL++L+         E + +  +E  P R + 
Sbjct: 130 LAAKLRTKLLSRDRDAEGEQTGLLGATGGLQSLLGPKLSQRAEESDSDQEVEVIPPRPEP 189

Query: 499 LPYIPNGYDPFDKESIEKLQH-HRSPFQVESITFDTEERDPELISLAAT----------D 645
           LP++P GY PF ++ I KLQ    SPFQ   + F   + D ++ S  +T          D
Sbjct: 190 LPHVPEGYTPFGEQEIAKLQGVDVSPFQ---LNFSGVDEDEDINSQDSTQLFTLNFDRDD 246

Query: 646 EDLVSPTRYNNHKHN--------LELDSDNESITIELGEEYNGQGLDTLELNSLLD 789
            D     +    +H+        +      +S   EL   Y G GL   EL SLL+
Sbjct: 247 NDDTDADQSGRKRHHTPERTTIPISTGQRRKSDVFELEPTYAGNGLTAKELESLLE 302

>TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {ON}
           Anc_8.265 YDR113C
          Length = 277

 Score = 53.9 bits (128), Expect = 8e-08
 Identities = 77/304 (25%), Positives = 119/304 (39%), Gaps = 44/304 (14%)
 Frame = +1

Query: 7   NEGKENIISVQDPDNDLGLRTPLNQMKRTDS-LVRGN----------------------- 114
           N  KENI +          RTP  Q+KR  S +++ N                       
Sbjct: 2   NSNKENIFTAP--------RTPSPQLKRDSSNILKFNSTTHTNVLKSKITDVPSNASGIT 53

Query: 115 -RRPLASKDNN-RTQSILSVKNNAALGKSDHPLKRPASSFMKNM-PENKLKKYGSVLGM- 282
            RRPLASKD N R  ++  VK++ +   S+            NM P N+LKKYGSVLG  
Sbjct: 54  ARRPLASKDKNVRRTALGQVKSSISSNNSNTNSTNNNDKNKNNMLPMNRLKKYGSVLGYS 113

Query: 283 -NTFMPR-TKSLVLXXXXXXXXXXXXXXXXXXXXXPIFPSGKSLNLGFGNGLKALIREKE 456
            NT     +K+L+L                                     +  L ++K 
Sbjct: 114 NNTINSNASKTLIL-----------------------------------KDIAPLEKDKH 138

Query: 457 DELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVE-SITFDTEERD------ 615
            E  IE      KEL Y P  Y  F++E I+ L  +   F ++ +  FD  + D      
Sbjct: 139 IEDEIETRSYEPKELDYEPENYFGFNQEEIDGLNDYTFNFNLQPNNEFDNNDNDDNEADA 198

Query: 616 ------PELISLAATDEDLV-SPTRYNNHKHNLELDSDNESITIELGEEYNGQGLDTLEL 774
                  + +S+++ +E ++ + T  NNH +N   +  N   T    ++   Q  D LEL
Sbjct: 199 GDDSLTDDTMSISSLEEIVIGTSTNENNHVNNKNSNMINNIHT----KQDQTQSDDELEL 254

Query: 775 NSLL 786
            +++
Sbjct: 255 ETMI 258

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 52.0 bits (123), Expect = 4e-07
 Identities = 69/280 (24%), Positives = 123/280 (43%), Gaps = 26/280 (9%)
 Frame = +1

Query: 25  IISVQDPD-NDLGLRTPLNQMKRTDSLVRGNRRPLASKDNNRTQSIL-SVKNNAALGKSD 198
           ++++Q P+ N +   T   ++     L +  + PL SK+ N++ SIL S K N       
Sbjct: 16  VLALQTPNTNFVKKNTTSTRISPLKRLQQQGKLPLQSKNGNKSNSILISHKGN------- 68

Query: 199 HPLKRPASSFMKNMPENKLKKYGSVLGM----NTFMPRTKSLVLXXXXXXXXXXXXXXXX 366
                            ++KKYGS+LG+    N  +P+TKSL+L                
Sbjct: 69  ---------------NTRIKKYGSILGLENPGNFKLPKTKSLILKDNESSESEEEDGLLN 113

Query: 367 XXXXXPIFPSGKSLNL-GFGN-GLKA-------LIREKEDELNIEYAPKRQKELPYIPNG 519
                 +  S    +  G G+ GL A       +  + + E++I    ++  EL YIP+ 
Sbjct: 114 RKLKEALSRSQNDEDREGDGSVGLFAKEAFQNHISNDDDSEIDIINGKEKDVELSYIPDH 173

Query: 520 YDPFDKESIEKLQHHRSPFQVESITF------DTEERDPELISLAATD-EDLVSPTRYNN 678
           Y+    + IEKL+      + +S         D+  +  EL  ++ +D E+ + P+ YN 
Sbjct: 174 YEVIAADEIEKLKQVNLGTRFKSSASSGLNDNDSTIQFLELEHVSDSDTEENIDPS-YNG 232

Query: 679 ----HKHNLELDSDNESITIELGEEYNGQGLDTLELNSLL 786
                K++ +  S +  IT E+G +Y G GLD  ++ ++L
Sbjct: 233 VNRIGKNSTKSKSIDFDITEEIGTKYAGSGLDDDDIEAML 272

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score = 34.3 bits (77), Expect = 0.38
 Identities = 34/122 (27%), Positives = 58/122 (47%), Gaps = 5/122 (4%)
 Frame = +1

Query: 439  LIREKEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDP 618
            LI EKE+E + E +   +KE+  I    + F+ +   KL+  ++  +VE ++ + E +D 
Sbjct: 755  LICEKENETSYENSNALEKEIQSITKDLNEFNNDKGSKLKELKA--EVEKLSKEIETKDR 812

Query: 619  ELISLAATDEDLVSPTRYNNHKHNLELDSDNESITIELGEEYNGQGLDTL-----ELNSL 783
             L      D+  +  T        LEL+++  +  IE   E   Q  DTL     E +SL
Sbjct: 813  HL-----DDKTELFQT--------LELETEQHNTDIETNTELVKQAEDTLKELKIEEDSL 859

Query: 784  LD 789
            +D
Sbjct: 860  ID 861

>NDAI0A05320 Chr1 complement(1199413..1200774) [1362 bp, 453 aa]
           {ON} Anc_3.328 YPR047W
          Length = 453

 Score = 33.9 bits (76), Expect = 0.43
 Identities = 19/65 (29%), Positives = 29/65 (44%)
 Frame = +1

Query: 103 VRGNRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGM 282
           + G   P ++KD N TQSIL++ N       +HP+       ++ + E KL         
Sbjct: 29  INGKEYPTSNKDTNVTQSILNLTNRNLHLNPNHPI-----GILRTIIETKLNSLSPYKTF 83

Query: 283 NTFMP 297
           N F P
Sbjct: 84  NNFSP 88

>TBLA0C02850 Chr3 (682683..690260) [7578 bp, 2525 aa] {ON} Anc_1.282
            YKR021W
          Length = 2525

 Score = 33.5 bits (75), Expect = 0.70
 Identities = 28/72 (38%), Positives = 37/72 (51%), Gaps = 7/72 (9%)
 Frame = +1

Query: 49   NDLGLRTPLN-----QMKRTDSLVR--GNRRPLASKDNNRTQSILSVKNNAALGKSDHPL 207
            ND  LRTP       ++K  +SL    G++ PLA K  N  ++ LSVK   A+ K+   L
Sbjct: 1427 NDKSLRTPTRSKDPLEIKTENSLKTPIGDKPPLAIKSENSIKTPLSVKPPVAI-KAVKSL 1485

Query: 208  KRPASSFMKNMP 243
            K P SS  K  P
Sbjct: 1486 KTPVSSPSKIKP 1497

>KAFR0D05110 Chr4 (1004456..1006918) [2463 bp, 820 aa] {ON}
           Anc_5.453 YDR379W
          Length = 820

 Score = 33.1 bits (74), Expect = 0.84
 Identities = 29/106 (27%), Positives = 47/106 (44%), Gaps = 3/106 (2%)
 Frame = +1

Query: 475 YAPKR---QKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISLAATD 645
           Y  KR   +K LP +PN  +     SI      RSP +  S T   +   P +I+  +T 
Sbjct: 141 YEEKRRRLEKNLPVLPNNLNNNSDTSIPLTIPDRSPDRPASPTQSVQSNIPAIIT--STS 198

Query: 646 EDLVSPTRYNNHKHNLELDSDNESITIELGEEYNGQGLDTLELNSL 783
           E +V+  +Y +     E + +NE      GEE  G+     ++N +
Sbjct: 199 ESIVA--QYLDDSKGEEEEGENEEEEEREGEEEEGEEEGQAKINHI 242

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score = 32.3 bits (72), Expect = 1.4
 Identities = 24/92 (26%), Positives = 41/92 (44%), Gaps = 7/92 (7%)
 Frame = +1

Query: 19  ENIISVQDPDNDLGLRTPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNAALGKS- 195
           EN ++ QDPD  L +R P    +     V     P++ +   R  S  ++K  ++   + 
Sbjct: 440 ENEVARQDPDQ-LEIRPPSQNNESLSDRVSSEEPPVSKERKKRKISKRALKTASSPSPNV 498

Query: 196 ------DHPLKRPASSFMKNMPENKLKKYGSV 273
                 +  L  P SSF KN+  ++  +YG V
Sbjct: 499 NEEYYNNSELAGPGSSFFKNISTSQEPRYGDV 530

>Kwal_26.8270 s26 complement(716412..719480) [3069 bp, 1022 aa] {ON}
           YKL057C (NUP120) - 100-kDa protein (predicted molecular
           weight is 120 kDa) with two leucine zipper motifs,
           coiled-coil region, and some homology to Nup133p [contig
           280] FULL
          Length = 1022

 Score = 32.3 bits (72), Expect = 1.5
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 1/68 (1%)
 Frame = +1

Query: 541 SIEKLQHHRSPFQVESITFDTEERDPELISLAATDEDLVSPTRYNNHKHNL-ELDSDNES 717
           S E   +H     +ES+  D ++R  E  SL    ++++     + + H+L ++DS+ ES
Sbjct: 425 SPESPYNHEYLLNLESVLKDLKKRSDEPSSLTLFQDEIIMVNSLSLYSHSLYKIDSELES 484

Query: 718 ITIELGEE 741
           I   L EE
Sbjct: 485 IFYNLNEE 492

>KAFR0J01250 Chr10 complement(230562..234002) [3441 bp, 1146 aa]
           {ON} Anc_2.199 YNL091W
          Length = 1146

 Score = 32.3 bits (72), Expect = 1.5
 Identities = 24/89 (26%), Positives = 38/89 (42%)
 Frame = +1

Query: 448 EKEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELI 627
           E ED+ + +YA      L    +  D  D E  +   HH+  +Q +  +++ E+RD E  
Sbjct: 403 EYEDDYDDDYAEYESDSLSEYADSEDYEDYEEDDHHHHHQF-YQDDENSYEDEDRDDEDE 461

Query: 628 SLAATDEDLVSPTRYNNHKHNLELDSDNE 714
              A DE        N+   N   D +NE
Sbjct: 462 EDEAEDEVDEDDINENDEVENGNFDENNE 490

>SAKL0G17468g Chr7 (1513069..1514334) [1266 bp, 421 aa] {ON} similar
           to uniprot|Q2VQX1 Saccharomyces cerevisiae YLR443W ECM7
           Non-essential protein of unknown function
          Length = 421

 Score = 32.0 bits (71), Expect = 1.7
 Identities = 15/35 (42%), Positives = 23/35 (65%)
 Frame = +1

Query: 388 FPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQ 492
           FPSGK+L+  F +  +AL++   D L++E AP  Q
Sbjct: 361 FPSGKNLHAPFTDSNEALVQNNLDTLSLERAPSFQ 395

>NDAI0F00520 Chr6 complement(121123..122859) [1737 bp, 578 aa] {ON}
           Anc_5.668 YKR077W
          Length = 578

 Score = 32.0 bits (71), Expect = 1.9
 Identities = 17/69 (24%), Positives = 31/69 (44%)
 Frame = +1

Query: 52  DLGLRTPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFM 231
           +L L    N   +   +++ N +P  +  NN   S L+  NN     S   +  P+S F+
Sbjct: 230 NLSLNIDSNGKAKIQPIIKQNNQPSKNNQNNDDVSSLTNNNNHYHNNSSSSMNIPSSQFI 289

Query: 232 KNMPENKLK 258
           K  P + ++
Sbjct: 290 KYSPVSPIR 298

>Smik_7.317 Chr7 (529500..530882) [1383 bp, 460 aa] {ON} YFR012W
           (REAL)
          Length = 460

 Score = 31.6 bits (70), Expect = 2.3
 Identities = 31/123 (25%), Positives = 54/123 (43%), Gaps = 17/123 (13%)
 Frame = +1

Query: 391 PSGKS--LNLGFGNGLKALIREKEDELNIEYAPKRQKELP---YIPNGYD-PFDKESIEK 552
           PS KS  L+  F N L+  +   +DEL  E  P  +K      +IPN +  P   +  + 
Sbjct: 233 PSSKSVYLSTSFSNNLQRTLDPNQDELPPEIIPSVKKATSVNFFIPNLHGAPMFSDRSKS 292

Query: 553 LQHHRSPFQVESITFDTEERDPEL-----ISLAATDEDLVSPTRYNNHK------HNLEL 699
            Q   S  +++      ++ D E+     I      ED+ SP+++N++       H  +L
Sbjct: 293 NQKTLSIHEIDIANLFVKQEDREMPVKKKIENVLYYEDITSPSQHNHNSPWLFGVHTTQL 352

Query: 700 DSD 708
            +D
Sbjct: 353 AND 355

>YGL099W Chr7 (314631..316553) [1923 bp, 640 aa] {ON}  LSG1Putative
           GTPase involved in 60S ribosomal subunit biogenesis;
           required for the release of Nmd3p from 60S subunits in
           the cytoplasm
          Length = 640

 Score = 31.2 bits (69), Expect = 3.3
 Identities = 27/103 (26%), Positives = 52/103 (50%), Gaps = 4/103 (3%)
 Frame = +1

Query: 427 GLKALIREKEDELN----IEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESIT 594
           G K   R+ +++L     I+YA +++  + Y+P+G   F  +     +H  +  ++ S+T
Sbjct: 15  GPKPTHRKNKNKLELGRAIKYARQKENAIEYLPDGEMRFTTD-----KHEANWVKLRSVT 69

Query: 595 FDTEERDPELISLAATDEDLVSPTRYNNHKHNLELDSDNESIT 723
              E    E +S AA  +   +  R++N K  + +DS N+S T
Sbjct: 70  --QESALDEFLSTAALADKDFTADRHSNVK-IIRMDSGNDSAT 109

>TBLA0B02360 Chr2 (551024..551944) [921 bp, 306 aa] {ON} Anc_3.104
           YOL093W
          Length = 306

 Score = 30.8 bits (68), Expect = 3.6
 Identities = 24/109 (22%), Positives = 46/109 (42%), Gaps = 4/109 (3%)
 Frame = +1

Query: 451 KEDELNIEYAPKRQKELPYIPNGYD-PFDKESIEKLQHHRSPFQVESI---TFDTEERDP 618
           + D+     A +R     Y+  G + P + +S  KL H++S   ++ I    FD    D 
Sbjct: 49  RRDKRKAARAKRRAIIQGYLDRGEELPDEYKSTPKLNHNQSDSGIKIIMDCAFDELMNDK 108

Query: 619 ELISLAATDEDLVSPTRYNNHKHNLELDSDNESITIELGEEYNGQGLDT 765
           E+ S+        +  R  NH  ++++ S N+ +     +E      +T
Sbjct: 109 EITSMTTQITRSYASNRRENHYADIKITSFNKRVKARFDKELKSSRYET 157

>Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}
           similar to Ashbya gossypii AGL051C
          Length = 593

 Score = 30.8 bits (68), Expect = 4.3
 Identities = 22/95 (23%), Positives = 44/95 (46%), Gaps = 3/95 (3%)
 Frame = +1

Query: 511 PNGYDPFDKESIEKLQHHRSPFQVESITFDTE---ERDPELISLAATDEDLVSPTRYNNH 681
           P+  +  ++E  E+ +       VES++   E   + D E +SL   + +        +H
Sbjct: 315 PSENEEDEEEEAEEEEAEEEAADVESVSLKDEAPFDDDVETVSLKDAERE--------DH 366

Query: 682 KHNLELDSDNESITIELGEEYNGQGLDTLELNSLL 786
           K    ++   E++ ++LG+E  G GLD  E  + +
Sbjct: 367 K---PVEGMREALVVDLGDENKGNGLDDSETEAAI 398

>Skud_7.175 Chr7 (318913..320835) [1923 bp, 640 aa] {ON} YGL099W
           (REAL)
          Length = 640

 Score = 30.8 bits (68), Expect = 4.4
 Identities = 23/85 (27%), Positives = 44/85 (51%)
 Frame = +1

Query: 469 IEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISLAATDE 648
           I+YA +++  + Y+P+G   F  +     +H  +  ++ S+T   E    E +S AA  +
Sbjct: 33  IKYARQKENAIEYLPDGEMRFTTD-----KHEANWVKLRSVT--QESALDEFLSTAALAD 85

Query: 649 DLVSPTRYNNHKHNLELDSDNESIT 723
              +  R++N K  + +DS N+S T
Sbjct: 86  KDFTADRHSNVK-IIRMDSGNDSAT 109

>Smik_7.174 Chr7 (309939..311861) [1923 bp, 640 aa] {ON} YGL099W
           (REAL)
          Length = 640

 Score = 30.8 bits (68), Expect = 4.4
 Identities = 23/85 (27%), Positives = 44/85 (51%)
 Frame = +1

Query: 469 IEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISLAATDE 648
           I+YA +++  + Y+P+G   F  +     +H  +  ++ S+T   E    E +S AA  +
Sbjct: 33  IKYARQKENAIEYLPDGEMRFTTD-----KHEANWVKLRSVT--QESALDEFLSTAALAD 85

Query: 649 DLVSPTRYNNHKHNLELDSDNESIT 723
              +  R++N K  + +DS N+S T
Sbjct: 86  KDFTADRHSNVK-IIRMDSGNDSAT 109

>TBLA0A02540 Chr1 (613560..615596) [2037 bp, 678 aa] {ON} Anc_5.475
           YOR138C
          Length = 678

 Score = 30.8 bits (68), Expect = 4.4
 Identities = 15/47 (31%), Positives = 24/47 (51%)
 Frame = +1

Query: 592 TFDTEERDPELISLAATDEDLVSPTRYNNHKHNLELDSDNESITIEL 732
           T DT+ER+    S   T +  +S   YNN   N   DSD+++ +  +
Sbjct: 30  TPDTQEREAISTSDLLTAQKTISSNNYNNDNSNSSFDSDSQATSCHI 76

>Kpol_1030.28 s1030 complement(54130..56214) [2085 bp, 694 aa] {ON}
           complement(54130..56214) [2085 nt, 695 aa]
          Length = 694

 Score = 30.8 bits (68), Expect = 4.5
 Identities = 20/75 (26%), Positives = 35/75 (46%)
 Frame = +1

Query: 67  TPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMPE 246
           TP+   K     +  ++ P  ++   R    ++ +NN       +  KRPAS  + +M  
Sbjct: 20  TPIRDYKNDYFHLHDDKLPKQNRFQIRNHPSMANRNN-----DKYKFKRPASLHLDDMSP 74

Query: 247 NKLKKYGSVLGMNTF 291
           + LKK  S L ++TF
Sbjct: 75  SNLKKQYSPLNIDTF 89

>NCAS0A09340 Chr1 complement(1847972..1850968) [2997 bp, 998 aa]
           {ON} Anc_1.294 YJL076W
          Length = 998

 Score = 30.8 bits (68), Expect = 4.7
 Identities = 27/86 (31%), Positives = 39/86 (45%), Gaps = 5/86 (5%)
 Frame = +1

Query: 34  VQDPDND----LGLRTPL-NQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNAALGKSD 198
           V DPD      L L TP+   M      + G R    S  +N  Q I + K N+    S 
Sbjct: 266 VVDPDKSKQQRLLLGTPIMTTMTPNRVTLTGQRVVSESHTSNSLQFIPNNKENSTQRLSS 325

Query: 199 HPLKRPASSFMKNMPENKLKKYGSVL 276
           +  +R  S+ +KN+PE K+ +   VL
Sbjct: 326 NSNRRVNSAVLKNIPEPKITEVEKVL 351

>KAFR0L01620 Chr12 complement(293645..295126) [1482 bp, 493 aa] {ON}
           Anc_7.372 YER088C
          Length = 493

 Score = 30.4 bits (67), Expect = 5.6
 Identities = 31/119 (26%), Positives = 50/119 (42%), Gaps = 3/119 (2%)
 Frame = +1

Query: 439 LIREKEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDP 618
           LI +K+D +       + KEL   P+ Y  FDK+ I   ++H+SP               
Sbjct: 348 LINQKKDSII------KAKELHQFPSTYTFFDKQII---KNHQSP--------------- 383

Query: 619 ELISLAATDEDLVSPTRYNNHKHNLELDSDNESITIELGE---EYNGQGLDTLELNSLL 786
                        SP+ Y++H HNL   S  +  T++  +   E + + L   EL+ LL
Sbjct: 384 -------------SPSPYHHHPHNLNFYSPQQVWTVDEDQLLIENSIRNLSIKELSILL 429

>TDEL0C01750 Chr3 (304284..306029) [1746 bp, 581 aa] {ON} Anc_7.372
           YER088C
          Length = 581

 Score = 30.4 bits (67), Expect = 5.7
 Identities = 20/68 (29%), Positives = 32/68 (47%)
 Frame = +1

Query: 517 GYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISLAATDEDLVSPTRYNNHKHNLE 696
           G D   +ES++ L H  SP  +      ++E  P  I  + T  D VS    ++H H   
Sbjct: 496 GNDDDYEESVDPLHHSLSPPLI------SKENTPASIISSTTTNDDVSSMSTDHHLHREH 549

Query: 697 LDSDNESI 720
            + DN++I
Sbjct: 550 SNDDNKTI 557

>Ecym_1384 Chr1 (797566..799362) [1797 bp, 598 aa] {ON} similar to
           Ashbya gossypii AFR438W
          Length = 598

 Score = 30.4 bits (67), Expect = 5.8
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 5/79 (6%)
 Frame = +1

Query: 442 IREKEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPE 621
           + ++E +L I        EL +     D FD+E  + L+  R    V +I    EE D E
Sbjct: 508 VEDEELQLKIALLESESTELHH----QDTFDEELQQALEESRKLHAVSNINIGAEEEDEE 563

Query: 622 LI-----SLAATDEDLVSP 663
           L+     S   TD  L +P
Sbjct: 564 LVRILEQSRLETDATLKNP 582

>KLLA0D15268g Chr4 (1297155..1298972) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53261 Saccharomyces cerevisiae YGR103W NOP7
           Nucleolar protein involved in rRNA processing and 60S
           ribosomal subunit biogenesis constituent of several
           different pre-ribosomal particles
          Length = 605

 Score = 30.4 bits (67), Expect = 5.8
 Identities = 24/95 (25%), Positives = 43/95 (45%), Gaps = 6/95 (6%)
 Frame = +1

Query: 436 ALIREKEDELNIEYAPKRQKELPYIPNGY------DPFDKESIEKLQHHRSPFQVESITF 597
           A +   ED+ + E   ++QKEL     G       D  D ES +K +  +        T 
Sbjct: 494 AAVALNEDDEDDEDELRQQKELELEAQGISYSEAKDVIDSESSDKKKKKK-----RKATE 548

Query: 598 DTEERDPELISLAATDEDLVSPTRYNNHKHNLELD 702
           + EE+D +LI ++     L    +Y+N K + +++
Sbjct: 549 EEEEKDLKLIMMSNKQRKLYKKMKYSNEKKDEKIE 583

>NCAS0A12180 Chr1 (2413240..2415150) [1911 bp, 636 aa] {ON}
           Anc_5.523 YDR419W
          Length = 636

 Score = 30.4 bits (67), Expect = 5.8
 Identities = 20/74 (27%), Positives = 32/74 (43%), Gaps = 7/74 (9%)
 Frame = +1

Query: 577 QVESITFDTEERDPELISLAATDEDLVSPTRYNNHKHNLELDSDNE-------SITIELG 735
           Q +    +T  ++PEL      D D  +   +N H  +LE DS+ E        +  +L 
Sbjct: 521 QAQIFQKNTANKEPELTVQGTDDADTNAARTFNCHLCSLEFDSEREFQEHLDFHVASKLS 580

Query: 736 EEYNGQGLDTLELN 777
           E  NG   D+  L+
Sbjct: 581 ESLNGFNGDSKNLS 594

>NDAI0C05190 Chr3 (1205357..1207927) [2571 bp, 856 aa] {ON}
           Anc_8.484
          Length = 856

 Score = 30.4 bits (67), Expect = 6.1
 Identities = 24/115 (20%), Positives = 52/115 (45%), Gaps = 1/115 (0%)
 Frame = +1

Query: 442 IREKEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPE 621
           ++E+E EL  +    +Q+EL +         ++   K Q +    Q+ + TF T  R P 
Sbjct: 499 LKEREIELQRKELDLKQRELVFKQQSILQQQRQITHKQQQYYQSPQLPTETFATPPRSPV 558

Query: 622 LISLAATDEDLVSPTRYNN-HKHNLELDSDNESITIELGEEYNGQGLDTLELNSL 783
           + + ++ D    S T+ +N +K+     + N ++      +    GL  L+ +++
Sbjct: 559 INNHSSNDSRKASYTKLHNINKNGRSTSNTNPTLLANNFVDPISSGLPPLQTSNM 613

>Smik_20.9 Chr20 (11068..11511) [444 bp, 147 aa] {ON}  (REAL)
          Length = 147

 Score = 29.3 bits (64), Expect = 6.8
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 7/50 (14%)
 Frame = +1

Query: 661 PTRYNNHKHNLELDSDNESITIELGEEYNGQG-----LDTLE--LNSLLD 789
           P+  +N+K ++ L S+N  +++ L  EYNG G     LDT +  L SLLD
Sbjct: 88  PSNNHNNKESIILLSNNPLLSLSLLVEYNGGGEQLKKLDTNKDILKSLLD 137

>Suva_8.262 Chr8 complement(475279..476568) [1290 bp, 429 aa] {ON}
           YOR209C (REAL)
          Length = 429

 Score = 30.0 bits (66), Expect = 7.1
 Identities = 22/56 (39%), Positives = 30/56 (53%)
 Frame = +1

Query: 442 IREKEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEE 609
           +R  +DE  IEY    QKE+PY+P+ Y  +  +S  KL         E ITF +EE
Sbjct: 63  LRFTKDE--IEYL---QKEIPYLPSAYIKYISDSNFKLNPE------EHITFTSEE 107

>ZYRO0D15598g Chr4 (1301578..1304283) [2706 bp, 901 aa] {ON} similar
           to uniprot|P40547 Saccharomyces cerevisiae YIL017C VID28
           Vacuole import and degradation
          Length = 901

 Score = 30.0 bits (66), Expect = 8.1
 Identities = 22/74 (29%), Positives = 30/74 (40%), Gaps = 7/74 (9%)
 Frame = +1

Query: 505 YIPNGYDPFDKESIEKLQHHRSPF----QVESITFDTEERDPELISLAATDEDLVSPTRY 672
           Y   GY P  +     L H  SPF     ++ +  D EE D E        ED  S T  
Sbjct: 773 YALEGYTPSQESDSRALIHQNSPFSSNNDIDKVLMDDEEEDEEEDDQEENGED-TSDTSD 831

Query: 673 NNHK---HNLELDS 705
           N+ +   H++  DS
Sbjct: 832 NDDEFVHHSMSTDS 845

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 30.0 bits (66), Expect = 8.4
 Identities = 26/114 (22%), Positives = 52/114 (45%), Gaps = 12/114 (10%)
 Frame = +1

Query: 439  LIREKEDELNI--EYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEER 612
            L  E ED+  +  E   + Q+E+   PN  D  ++++ E+ Q  ++  +++S+  D  E 
Sbjct: 1127 LPEENEDDFEVQDEEVQREQREMSSDPNAMDIDEEQAAEQFQVQQTDGEIDSMDIDEYEN 1186

Query: 613  ----------DPELISLAATDEDLVSPTRYNNHKHNLELDSDNESITIELGEEY 744
                      + +L S+   D +L    + +   H +    DN  + I++ EEY
Sbjct: 1187 ETSNGLPKFSEAQLQSIQIEDVEL----QIDELNHYV----DNAHVDIDVLEEY 1232

>KNAG0G01440 Chr7 (324547..329382) [4836 bp, 1611 aa] {ON} Anc_8.163
            YBL017C
          Length = 1611

 Score = 30.0 bits (66), Expect = 8.5
 Identities = 13/37 (35%), Positives = 22/37 (59%)
 Frame = +1

Query: 631  LAATDEDLVSPTRYNNHKHNLELDSDNESITIELGEE 741
            LA  DED    + + +H++N ++D D+ES+   L  E
Sbjct: 1517 LAGHDEDANDLSSFMDHENNFDIDDDDESVPAGLNGE 1553

>Smik_13.15 Chr13 (26900..27973) [1074 bp, 357 aa] {ON} YML119W
           (REAL)
          Length = 357

 Score = 29.6 bits (65), Expect = 9.0
 Identities = 22/82 (26%), Positives = 36/82 (43%), Gaps = 1/82 (1%)
 Frame = +1

Query: 61  LRTPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSF-MKN 237
           LR   N   + +     NR    + + NR+    +    A +G S HP  +  S    K+
Sbjct: 66  LRPRFNSTSQINKGFNENRYAGCNNNGNRSSRYANTTGAANVGASSHPHHQSVSHLNTKS 125

Query: 238 MPENKLKKYGSVLGMNTFMPRT 303
           +  N+ K+  S+  + TF PRT
Sbjct: 126 LKFNQTKEVNSIKDI-TFPPRT 146

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.134    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,300,338
Number of extensions: 1398807
Number of successful extensions: 3929
Number of sequences better than 10.0: 50
Number of HSP's gapped: 3881
Number of HSP's successfully gapped: 68
Length of query: 264
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 157
Effective length of database: 41,212,137
Effective search space: 6470305509
Effective search space used: 6470305509
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.4 bits)
S2: 33 (17.3 bits)