Re-run this search with the SEG filter switched on (default)

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19206g8.265ON26326313600.0
Ecym_43058.265ON3113112624e-26
AGR083W8.265ON2952202562e-25
SAKL0H16962g8.265ON3363322171e-19
YDR113C (PDS1)8.265ON3732142153e-19
Suva_2.2738.265ON3762982013e-17
ZYRO0C01584g8.265ON2822711834e-15
Kwal_56.237818.265ON2932831801e-14
TDEL0F039208.265ON3222771801e-14
Kpol_543.418.265ON3062901792e-14
Smik_4.3588.265ON3712131792e-14
Skud_4.3748.265ON3732151758e-14
NCAS0B038308.265ON3252741731e-13
KNAG0H032308.265ON2812101668e-13
KLTH0G13618g8.265ON3023011552e-11
NDAI0J013508.265ON4221491554e-11
KAFR0B055108.265ON2752891217e-07
CAGL0L12298g8.265ON2862771217e-07
TPHA0A017808.265ON3522101093e-05
TBLA0E044608.265ON277162880.011
Skud_10.1331.290ON121861750.61
YJL080C (SCP160)1.290ON122261750.61
Smik_10.1621.290ON122181731.0
NDAI0A053203.328ON45365683.4
SAKL0G17468g4.328ON42135666.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19206g
         (263 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...   528   0.0  
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...   105   4e-26
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...   103   2e-25
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...    88   1e-19
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...    87   3e-19
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...    82   3e-17
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...    75   4e-15
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    74   1e-14
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...    74   1e-14
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    74   2e-14
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...    74   2e-14
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...    72   8e-14
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...    71   1e-13
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    69   8e-13
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    64   2e-11
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    64   4e-11
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    51   7e-07
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    51   7e-07
TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...    47   3e-05
TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {...    39   0.011
Skud_10.133 Chr10 complement(253506..257162) [3657 bp, 1218 aa] ...    33   0.61 
YJL080C Chr10 complement(285558..289226) [3669 bp, 1222 aa] {ON}...    33   0.61 
Smik_10.162 Chr10 complement(277210..280875) [3666 bp, 1221 aa] ...    33   1.0  
NDAI0A05320 Chr1 complement(1199413..1200774) [1362 bp, 453 aa] ...    31   3.4  
SAKL0G17468g Chr7 (1513069..1514334) [1266 bp, 421 aa] {ON} simi...    30   6.1  

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/263 (100%), Positives = 263/263 (100%)

Query: 1   MPNEGKENIISVQDPDNDLGLRTPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNA 60
           MPNEGKENIISVQDPDNDLGLRTPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNA
Sbjct: 1   MPNEGKENIISVQDPDNDLGLRTPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNA 60

Query: 61  ALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGMNTFMPRTKSLVLKDTELNEKNDDEDE 120
           ALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGMNTFMPRTKSLVLKDTELNEKNDDEDE
Sbjct: 61  ALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGMNTFMPRTKSLVLKDTELNEKNDDEDE 120

Query: 121 EDEEDDLPIFPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPFDKE 180
           EDEEDDLPIFPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPFDKE
Sbjct: 121 EDEEDDLPIFPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPFDKE 180

Query: 181 SIEKLQHHRSPFQVESITFDTEERDPELISLAATDEDLVSPTRYNNHKHNLELDSDNESI 240
           SIEKLQHHRSPFQVESITFDTEERDPELISLAATDEDLVSPTRYNNHKHNLELDSDNESI
Sbjct: 181 SIEKLQHHRSPFQVESITFDTEERDPELISLAATDEDLVSPTRYNNHKHNLELDSDNESI 240

Query: 241 TIELGEEYNGQGLDTLELNSLLD 263
           TIELGEEYNGQGLDTLELNSLLD
Sbjct: 241 TIELGEEYNGQGLDTLELNSLLD 263

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score =  105 bits (262), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 151/311 (48%), Gaps = 53/311 (17%)

Query: 3   NEGKENIISVQDPDNDLGLRTPLNQMKRTDS---LVRGNRRPLASKDNNRTQSILSVKNN 59
           +E KENI +  +P   +  RTP++Q+KR+ S   L   +R PLASKD NR+QS  ++K  
Sbjct: 4   HEDKENIPTGSEPSGSIVPRTPMHQLKRSTSNVHLKNNSRLPLASKDRNRSQSGFNLKQQ 63

Query: 60  -------AALGKSDHPLKRPAS-SFMKNMPENKLKKYGSVLGMNT-FMPRTKSLVLKDT- 109
                    +    +  KRPAS SF+KNMP++KLKKYGSVLG+N   + +TKSLVLKD  
Sbjct: 64  LVQGHVGGGVMVGQNKSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVLKDAS 123

Query: 110 -----------------------ELNEKNDDEDEEDEEDDLPIFPSGKSLNLGFGNGLKA 146
                                  +L  +     E++ EDD                  ++
Sbjct: 124 DGSQDNGEESDDYDDEEGNPLAAKLRSRLTSGVEDENEDDGSSGLLLGGGLKKLIKLHES 183

Query: 147 LIREKEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPF----QVESITFDTE 202
             ++ E+   IE AP++  EL +IPNGY+ F+ E I KL  + SPF      E    D+ 
Sbjct: 184 DNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFADREEDDSDST 243

Query: 203 ERDPELISL--AATDEDLVSPTRYNNHKHNLELDSDNESITIELGEEYN--------GQG 252
           E +  LI L     DE   SP++        E    N++I  ELG + +        G+G
Sbjct: 244 EGERLLIPLDFGGIDE---SPSKKQELMATQENIIANKTIVDELGTQADEIQFSFDIGKG 300

Query: 253 LDTLELNSLLD 263
           L + EL SLLD
Sbjct: 301 LSSNELQSLLD 311

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score =  103 bits (256), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 112/220 (50%), Gaps = 38/220 (17%)

Query: 3   NEGKENIISVQDPDNDLGLRTPLNQMKRTDSLVRG---NRRPLASKDNNRTQSILSVKNN 59
           +E KEN+++       +  RTP++Q+KR+ S + G    R PLASKD N++Q +  +K +
Sbjct: 4   HEDKENLVTSAG-RGAMMPRTPIHQLKRSSSNLAGRNSTRMPLASKDRNQSQGVFGLKTS 62

Query: 60  AALGKSDHPL--KRPASS-FMKNMPENKLKKYGSVLGMN-TFMPRTKSLVLKDT------ 109
            A G        KRPASS   KNMP++KLKKYGSVLG+    + + KSLVLKDT      
Sbjct: 63  GAGGAGGAQAQSKRPASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLVLKDTSDCESA 122

Query: 110 --------------ELNEKNDDEDEEDEEDDLPIFPSGKSLNLGFGNGLKALIRE---KE 152
                         +L  +    +E   EDD        S  L  G  L  L      +E
Sbjct: 123 NEESEEEEGNPLAAKLKSRLCSAEEGGNEDD-------GSSGLLLGEALSQLAAAGETQE 175

Query: 153 DELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPF 192
           D   +EYAP++  ELP++PNGY+      + KL  + SPF
Sbjct: 176 DVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPF 215

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score = 88.2 bits (217), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 95/332 (28%), Positives = 138/332 (41%), Gaps = 106/332 (31%)

Query: 23  TPLNQMKRTDSLVR-----------GNRRPLASKDNNRTQSILSVKNNAALG-------- 63
           TP + +KR+ S ++           G R PLASKDNN++ ++++    +AL         
Sbjct: 20  TPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNTLINNGQKSALVNLAPNNSL 79

Query: 64  ------KSDHPLKRPASSFMKN---------MPENKLKKYGSVLGMNTFMPRTKSLVLKD 108
                 K + P+     SF+           +P+++LKKYGSVLG N  +PR KSLVLKD
Sbjct: 80  LHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYGSVLGYNG-LPRVKSLVLKD 138

Query: 109 TE----------------------------------LNEKNDDEDEEDEEDDLPIFPSGK 134
            +                                  LN  N+D+ EE           G 
Sbjct: 139 VDERKVGKSEEGEEEEEDDDEEEEEDNPLAAKLLKALNNHNEDDKEE-----------GS 187

Query: 135 SLNLGFGNGLKALIREKEDE------LNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHH 188
              LG   GL+ L++ +  E        IE  P   +ELP++PNGY PF +  + KL   
Sbjct: 188 IGLLGSNTGLQQLLKHRNVEEGENSDFEIEIVPPHSEELPHVPNGYSPFKESDVIKLNTF 247

Query: 189 RSPFQVESITFDTEERDPE----LISLAAT-----DEDLVSPTRYNNH--------KHNL 231
            SPF +     D EE D       IS+  +     D+D     R  +         +H L
Sbjct: 248 TSPFSMHKEDSDCEECDDYDGLLTISMVKSEDEEQDDDTNDRKRRKSWIDEGLATARHGL 307

Query: 232 ELDSDNESITIELGEEYNGQGLDTLELNSLLD 263
             D +   + IE    YNG+GL+  +L SLLD
Sbjct: 308 -FDFNKPELYIE--PHYNGEGLNKEDLESLLD 336

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score = 87.4 bits (215), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 104/214 (48%), Gaps = 58/214 (27%)

Query: 39  RRPLASKDNNRTQSI--------------------LSVKNNAALGKSDHPLKRPASSFMK 78
           R PLA+KDNNR++S                     LS++ N  L K     +  + +   
Sbjct: 85  RLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLSIRKNDQLRKLSQISRSRSRANHN 144

Query: 79  NMPEN--KLKKYGSVLGMNTFMPRTKSLVLKDTELNEKN-----DDEDEEDEEDDL---- 127
           ++  N  KL+KYGSVLG N  +P+ KSLVLKD   + KN     DDE  ED E  L    
Sbjct: 145 DLLSNSRKLQKYGSVLGYNA-LPKMKSLVLKDLADSGKNEESSDDDEGNEDSESKLGKKL 203

Query: 128 --PIFPSGKS-----LNLGFG-----NGLKALIR--------------EKEDELNIEYAP 161
              +     S     LN G G      GL+ LI+              +K D+ +IE AP
Sbjct: 204 QSALLKQDSSDGENELNGGLGLFNEQGGLQQLIKNSTKNEQKTKNDKSDKTDDYDIEIAP 263

Query: 162 KRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVE 195
           +RQ+ LPY+P GY PF ++ IEKL+   SP++++
Sbjct: 264 QRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLD 297

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score = 82.0 bits (201), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 95/298 (31%), Positives = 132/298 (44%), Gaps = 80/298 (26%)

Query: 39  RRPLASKDNNRTQSI----------------------LSVKNNAALGKSDHPLKRPASSF 76
           R PLA+KDNNR++S                       LS + N  L K     +      
Sbjct: 84  RLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNTLSTRKNDQLRKLSQVSRNRNRGN 143

Query: 77  MKNMPEN--KLKKYGSVLGMNTFMPRTKSLVLKD----TELNEKNDDED----------- 119
              M  N  KL+KYGSVLG N  +P+ KSLVLKD     +  E +DD+D           
Sbjct: 144 YNGMLNNSRKLQKYGSVLGYNA-LPKMKSLVLKDLADPAKNQESSDDDDGSEGTDNKLSQ 202

Query: 120 -------EEDEEDDLPIFPSGKSLNLGFGN--GLKALIR-----------EKEDELNIEY 159
                  ++   +D   F  G  L   F N  GL+ LI+           E  D+ +IE 
Sbjct: 203 KLQSAFFQQHSSEDEHEFSGGIGL---FNNQGGLQQLIKNTAKGKEGPGKEDGDDHDIEI 259

Query: 160 APKRQKELPYIPNGYDPFDKESIEKLQHHRSPF--QVESITFDTEERDP-ELISLAATDE 216
           AP+RQ+ LPY+P+GY PF +E I KL+   SP+   +E  + +T   D   L+SL   +E
Sbjct: 260 APQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLEGNSNNTNSADKVGLLSLVEVNE 319

Query: 217 ------------DLVSPTRYNNHKHNLELDSDNESITIELGEEYNGQGLDTLELNSLL 262
                       D   P   +    N E D DN ++ + +   YNG+GLD+ EL  LL
Sbjct: 320 EDEKDNTTHTIGDQQEPAELSLALQNSE-DDDNAAMPL-IESLYNGEGLDSEELEDLL 375

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score = 75.1 bits (183), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 88/271 (32%), Positives = 131/271 (48%), Gaps = 67/271 (24%)

Query: 23  TPLNQMKRTDSLVRGNRR-PLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMP 81
           TP+ +  R+ S VRG RR PLASKD+N++         +A G    P+K+   +    + 
Sbjct: 47  TPVKK-SRSVSPVRGQRRLPLASKDHNKS---------SAAG----PVKKRQPTLQGELL 92

Query: 82  EN--KLKKYGSVLGMNTFMPRTKSLVLKD------------TELNEKNDDEDEEDEEDDL 127
            N  KL+KYGSVLG  T +PRTKSLVLKD            +EL +K  D     E+   
Sbjct: 93  SNPRKLQKYGSVLGY-TDLPRTKSLVLKDGDDEDDDEEEENSELQKKLQDAMNRREDS-- 149

Query: 128 PIFPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQH 187
                    N G G GL  L+R+ +D+  IEYAP R   L Y P+G+  ++ E I KL+ 
Sbjct: 150 ---------NEGLG-GLAKLVRDTKDD--IEYAPHRLPPLEYAPDGHTRWEDEDIVKLK- 196

Query: 188 HRSPFQVESITFDTEERDPE--------LISLAATDEDL-------VSPTRYNNHKH-NL 231
            +   ++     D E+ +P+        L+S+ + +ED        + P  +  H    L
Sbjct: 197 -KVDLRIRDDQDDHEDNEPQENDDGLLPLMSIESNNEDSNENEADEILPKNHRIHPFPKL 255

Query: 232 ELDSDNESITIELGEEYNGQGLDTLELNSLL 262
            +  +++   I     YNG+GL+  EL  LL
Sbjct: 256 RVFDEDQVENI-----YNGEGLNAEELEDLL 281

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 86/283 (30%), Positives = 123/283 (43%), Gaps = 51/283 (18%)

Query: 23  TPLNQMKRTDSLVRG-------NRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASS 75
           TP + + R+ S ++         R+PLASKDNN++   L  K    L K   P    A S
Sbjct: 20  TPTHLLSRSQSFMKNISPKRAEQRKPLASKDNNKSTGFLGAKE--PLRKRTRPTVNHAGS 77

Query: 76  FMKNMPENKLKKYGSVLGMNT-FMPRTKSLVLKD---TELNEKNDDEDEEDEEDDLPIFP 131
           F+ N       + G V  +NT   PR KSLVLKD    E ++ +  E E+DE + L    
Sbjct: 78  FIGNT------RPGVVPILNTNGAPRIKSLVLKDDIEEEQSQSDGGEAEDDESNSLAAKL 131

Query: 132 SGKSLNL---------------------GFGNGLKALIREKEDELNIEYAPKRQKELPYI 170
            GK LN                           L +   + + +L +E  P R + LP+I
Sbjct: 132 RGK-LNARDRDDSTEQGGLLGATGGLQGLANTKLHSETLDSDSDLEVEVIPPRPEPLPHI 190

Query: 171 PNGYDPFDKESIEKLQ-HHRSPFQV---ESITFDTEERDPELISLAATDEDLVSPTRYNN 226
           P+GY PF  E I KLQ    SPFQ+   +     + +   +L +L   ++D +    ++ 
Sbjct: 191 PHGYTPFTDEDIGKLQDTEASPFQLNFADDDDDASSQDSTQLFTLKLDNDDNLGDQEHDR 250

Query: 227 HK-HNLELDSDNESIT-----IELGEEYNGQGLDTLELNSLLD 263
            + H  E      SI       EL   Y G GL T EL SLL+
Sbjct: 251 KRLHTPEKKPTRASIAQQAADFELDPIYAGHGLSTKELESLLE 293

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 89/277 (32%), Positives = 122/277 (44%), Gaps = 73/277 (26%)

Query: 35  VRGNRRPLASKDNNRTQSILSV----------KNNAALGKSDHPLKRPASSFMKNMPEN- 83
           V+  R PLASKDNNR+   L            K N +  K     KR A+     +  N 
Sbjct: 68  VQQGRPPLASKDNNRSTGFLPQLQKLQQQPSLKRNLSQSK-----KRNANVVDGQLLTNP 122

Query: 84  -KLKKYGSVLGMNTFMPRTKSLVLKDTE----------------------LNEKNDDEDE 120
            +LKKYGSVLG N  +P+ KSLVLKD +                      L+   D  DE
Sbjct: 123 RRLKKYGSVLGYNA-LPKMKSLVLKDVDQVGEQGEDENDDEDEDHILRLKLHNAIDRSDE 181

Query: 121 EDEEDDLPIFPSGKSLNLGFGNGLKALIRE-KEDE-----LNIEYAPKRQKELPYIPNGY 174
           E EE             L   +GL  L+R+ K+DE       IEY P+R + LPYIP G+
Sbjct: 182 EGEEVG----------GLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPEGH 231

Query: 175 DPFDKESIEKLQHHRSPFQVESITFDTEERDP------ELISLAATDEDLVSPTRYNNHK 228
               +E  +KL+  RSP+ +E    D+++         E I  A  DE++         +
Sbjct: 232 LSLAQEDYDKLKTFRSPYLIEDDYSDSDDDKQDGFLQLEEIGSAGDDENI--------ER 283

Query: 229 HNLELDSDN---ESITIELGEEYNGQGLDTLELNSLL 262
            NL +       +  T E+   Y G+GLD  +LN LL
Sbjct: 284 ENLTVKQREMLPQYDTFEIQPSYCGEGLDASDLNDLL 320

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 93/290 (32%), Positives = 134/290 (46%), Gaps = 52/290 (17%)

Query: 22  RTPLNQMKRTDSLVR---------GN--------RRPLASKDNNRTQSILSVKNNAALG- 63
           +TP N +KRT S ++         GN        R PLASKDNNR+ S L+  N      
Sbjct: 20  QTPNNLLKRTHSKLKTGIAKDIQGGNVINTSPQKRLPLASKDNNRSNSFLNNSNVNLNFN 79

Query: 64  -----------------KSDHPLKRPASSFMKNMPENKLKKYGSVLGMNTFMPRTKSLVL 106
                            K  H  ++  S  + +  + KLKKYGSVLG N  +P+ KSLVL
Sbjct: 80  INNNNNNNNNNINNNNIKKQHIFQQNKSGILAD--DRKLKKYGSVLGYNA-LPKVKSLVL 136

Query: 107 KDTELNEKNDDEDEEDE------EDDLPIFPSGKSLNLGFGNGLKALIREK-EDELNIEY 159
           KD   NE +DD+    +      +  +    S   + L  G  L+ LIR+  ED   IE+
Sbjct: 137 KDISDNEDDDDDLLSLKLRDSMNKKSINTNKSNSGIGLLSGGNLQQLIRDANEDVREIEH 196

Query: 160 APKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISLAATDEDLV 219
                 +  YIP+ + PFD+  I KL+   SPF++E    D EE   EL+ LA T +D  
Sbjct: 197 KSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLEQSNSDDEEDSSELLLLANTSDDEG 256

Query: 220 SPTRYNNHKHNLELDSDNESITI------ELGEEYNGQGLDTLELNSLLD 263
           +         NL +++   S  +      ++   Y G+GLD+ +L  LLD
Sbjct: 257 THNDKITTNKNLSINNKPNSKDVIPADILDIEPSY-GEGLDSNDLEDLLD 305

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 97/213 (45%), Gaps = 57/213 (26%)

Query: 39  RRPLASKDNNRTQSILSV----------------KNNAALGKSDHPLKRPASSFMKNMPE 82
           R PLA+KDNNR +S + +                +N  ++ K+D   K    S  +N   
Sbjct: 84  RLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNTLSIRKNDQLRKLSQISRNRNRVN 143

Query: 83  N--------KLKKYGSVLGMNTFMPRTKSLVLKD-------------------------- 108
           +        KL+KYGSVLG N  +P+ KSLVLKD                          
Sbjct: 144 HSDLLNNTRKLQKYGSVLGYNA-LPKMKSLVLKDLVDPGKNEESSDDDDGSEGSENKLSK 202

Query: 109 ---TELNEKNDDEDEEDEEDDLPIFPSGKSLNLGFGNGLKALIREKEDELN---IEYAPK 162
                L +++  +DE +   D+ +F +   L     N ++   + K D  +   IE AP+
Sbjct: 203 KLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNSVQNESKSKSDNADGYEIEIAPQ 262

Query: 163 RQKELPYIPNGYDPFDKESIEKLQHHRSPFQVE 195
           R   LPY+P+GY PF +E I+KL+   SP++++
Sbjct: 263 RLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELD 295

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score = 72.0 bits (175), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 68/215 (31%), Positives = 98/215 (45%), Gaps = 59/215 (27%)

Query: 39  RRPLASKDNNRTQSILSVKNNAALGKSDH--PLKRPASSFMKN--------MPEN----- 83
           R PLA+KDNNR++S + V     L K     P ++   S  KN        +  N     
Sbjct: 84  RLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNTLSIRKNDQLRQLSQISRNRTRAN 143

Query: 84  ---------KLKKYGSVLGMNTFMPRTKSLVLKDTELNEKNDDEDEEDEEDDLPIFPSGK 134
                    KL+KYGSVLG N  +P+ KSLVLKD     KN +  ++D+  + P    G 
Sbjct: 144 YNELLNNSRKLQKYGSVLGYNA-LPKMKSLVLKDLAGPAKNQESSDDDDGSEGPESKLGV 202

Query: 135 SLNLGF---------------------GNGLKALIR-------------EKEDELNIEYA 160
            L   F                       GL+ LI+             + +D+  IE A
Sbjct: 203 KLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNTTKGKQGSKEEDDDDDDYEIEIA 262

Query: 161 PKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVE 195
           P+RQ+ LPY+P+GY  F +E IEKL+   SP++++
Sbjct: 263 PQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELD 297

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score = 71.2 bits (173), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 87/274 (31%), Positives = 125/274 (45%), Gaps = 74/274 (27%)

Query: 29  KRTDSLVRGNRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMPENKLKKY 88
           +R   L   NR PLA KDNN + S  S KN                  + N+   KLKKY
Sbjct: 62  RRRQLLQLQNRLPLAKKDNNNS-SFSSRKNG-----------------LNNI--KKLKKY 101

Query: 89  GSVLGMNTFMPRTKSLVLKDTELNEKNDDEDEEDEEDDLPIFPSGKSL------------ 136
           GSVLGM+  +PRTKSL+LKD +    +D+EDE+D    L +  + K              
Sbjct: 102 GSVLGMDA-LPRTKSLILKDVDDKPDDDEEDEDDNAFGLKLRNAMKQHENNSNEEENEGM 160

Query: 137 -NLGFG-------------NGLKALIREKEDELN--------------------IEYAPK 162
             LG G              GL+ LIRE   E +                    IEYAP 
Sbjct: 161 SGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPI 220

Query: 163 RQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISL----AATDEDL 218
           R++ LP++P GY PF  E I KL+   S ++++S     E+ D +L++L     + D++ 
Sbjct: 221 REEPLPFVPFGYTPFTPEDINKLKTFHSSYKLDSPVSTVEDAD-KLLALETIETSVDDEA 279

Query: 219 VSPTRYNNHKHNLELDSDNESITIELGEEYNGQG 252
                  +H+     DS+++S  I+L   YNG+G
Sbjct: 280 EWEHEVRHHRRRPTRDSNDDS--IDLVPLYNGEG 311

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 68.6 bits (166), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 107/210 (50%), Gaps = 35/210 (16%)

Query: 3   NEGKENIISV-QDPDNDL------GLRTPLNQMKRTDSL----VRGNRRPLASKDNNRTQ 51
           NE KEN ++V Q P +++       L+   ++ K++ S+     RG R PLASKDNN + 
Sbjct: 4   NEDKENAVAVPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRGGRLPLASKDNNASG 63

Query: 52  SILSVKNNAALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGM-NTFMPRTKSLVLKDTE 110
            ++S K    LG+      +PA    +     KLK+YGS+LG  N  + R+KSL+LKD E
Sbjct: 64  LVVSGK----LGR------QPADQVREANSSRKLKRYGSLLGYDNRQLTRSKSLILKDPE 113

Query: 111 L-NEKN---------DDEDEEDEEDDLPIFPSGKSLNL--GFGNGLKALIREKEDELNIE 158
             NE +         D+E  ++  D          L +    G GL  L+R+ ++   +E
Sbjct: 114 APNESSKSVTKRLLLDEEIAKNSSDGDDDGDDTDILKIRSQLGGGLDRLVRQSQNR-ELE 172

Query: 159 YAPKRQKELPYIPNGYDPFDKESIEKLQHH 188
             P+ Q ELPYIP+G+    +  I KL+ +
Sbjct: 173 IRPQAQDELPYIPDGHIILHEADIAKLRDY 202

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 64.3 bits (155), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 120/301 (39%), Gaps = 78/301 (25%)

Query: 23  TPLNQMKRTDSLVRGN-------RRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASS 75
           TP + + R+ S ++         RRPLASKDNNR+ S L  K    L K   P    A S
Sbjct: 20  TPRHLLSRSQSFMKNKSPKRAEARRPLASKDNNRSVSYLGTKE--PLRKRTRPGVNHAGS 77

Query: 76  FMKNMPENKLKKYGSVLGMN-TFMPRTKSLVLKD-------------------------- 108
           F+ N       + G    +N +  P+ KSLVLKD                          
Sbjct: 78  FVGNA------RLGPAPTLNASGAPKIKSLVLKDGIEEEGSQSEGAEVDEDDDDDSNRLA 131

Query: 109 TELNEK--NDDEDEEDEEDDLPIFPSGKSLNLGFGNGLKALI--------REKEDELNIE 158
            +L  K  + D D E E+  L          LG   GL++L+         E + +  +E
Sbjct: 132 AKLRTKLLSRDRDAEGEQTGL----------LGATGGLQSLLGPKLSQRAEESDSDQEVE 181

Query: 159 YAPKRQKELPYIPNGYDPFDKESIEKLQH-HRSPFQVESITFDTEE-----RDPELISL- 211
             P R + LP++P GY PF ++ I KLQ    SPFQ+     D +E        +L +L 
Sbjct: 182 VIPPRPEPLPHVPEGYTPFGEQEIAKLQGVDVSPFQLNFSGVDEDEDINSQDSTQLFTLN 241

Query: 212 -AATDEDLVSPTRYNNHKHN--------LELDSDNESITIELGEEYNGQGLDTLELNSLL 262
               D D     +    +H+        +      +S   EL   Y G GL   EL SLL
Sbjct: 242 FDRDDNDDTDADQSGRKRHHTPERTTIPISTGQRRKSDVFELEPTYAGNGLTAKELESLL 301

Query: 263 D 263
           +
Sbjct: 302 E 302

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 64.3 bits (155), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 71/149 (47%), Gaps = 37/149 (24%)

Query: 152 EDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEER-----DP 206
           ++E +IEYAP R+  LPYIP GY PF  E I KL+ + SPF +     D ++      DP
Sbjct: 271 DEEDDIEYAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIHHDHSDYQQSPSTLGDP 330

Query: 207 E-LISL-------AATDEDLVSPTRY-------------NNHKHNLEL----DSDNESIT 241
           E L+SL       A T     SP+ Y              + KHN  +    ++DNES  
Sbjct: 331 EMLLSLQSFDTQTATTSSSCASPSLYPTTPIHKDTNINTTDQKHNTVILNVHNNDNESEG 390

Query: 242 IELGEE-------YNGQGLDTLELNSLLD 263
              GE        YNG GLD  +LN L++
Sbjct: 391 EYGGEHDQEIDKIYNGDGLDEDDLNDLIN 419

 Score = 35.8 bits (81), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 42/94 (44%), Gaps = 26/94 (27%)

Query: 23  TPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMPE 82
            P N   R   L   NR PL+ KDNN          N+ +      LK+    F      
Sbjct: 77  VPPNISPRRQLLQLQNRFPLSKKDNN----------NSFI------LKQQQQQF----DH 116

Query: 83  NKLKKYGSVLGMNT------FMPRTKSLVLKDTE 110
            +LKKYGSVLG+ T       + R KSLVLKD +
Sbjct: 117 KRLKKYGSVLGLGTDGNNHNNLTRIKSLVLKDID 150

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 134/289 (46%), Gaps = 67/289 (23%)

Query: 9   IISVQDPDNDL----GLRTPLNQMKRTDSLVRGNRRPLASKDNNRTQSIL-SVKNNAALG 63
           ++++Q P+ +        T ++ +KR   L +  + PL SK+ N++ SIL S K N    
Sbjct: 16  VLALQTPNTNFVKKNTTSTRISPLKR---LQQQGKLPLQSKNGNKSNSILISHKGNNT-- 70

Query: 64  KSDHPLKRPASSFMKNMPENKLKKYGSVLGM----NTFMPRTKSLVLKDTE--------- 110
                               ++KKYGS+LG+    N  +P+TKSL+LKD E         
Sbjct: 71  --------------------RIKKYGSILGLENPGNFKLPKTKSLILKDNESSESEEEDG 110

Query: 111 -LNEK-----NDDEDEEDEEDDLPIFPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQ 164
            LN K     +  +++ED E D  +    K     F N +     + + E++I    ++ 
Sbjct: 111 LLNRKLKEALSRSQNDEDREGDGSVGLFAKE---AFQNHIS---NDDDSEIDIINGKEKD 164

Query: 165 KELPYIPNGYDPFDKESIEKLQHHRSPFQVESITF------DTEERDPELISLAATD-ED 217
            EL YIP+ Y+    + IEKL+      + +S         D+  +  EL  ++ +D E+
Sbjct: 165 VELSYIPDHYEVIAADEIEKLKQVNLGTRFKSSASSGLNDNDSTIQFLELEHVSDSDTEE 224

Query: 218 LVSPTRYNN----HKHNLELDSDNESITIELGEEYNGQGLDTLELNSLL 262
            + P+ YN      K++ +  S +  IT E+G +Y G GLD  ++ ++L
Sbjct: 225 NIDPS-YNGVNRIGKNSTKSKSIDFDITEEIGTKYAGSGLDDDDIEAML 272

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 51.2 bits (121), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 116/277 (41%), Gaps = 65/277 (23%)

Query: 20  GLRTPLNQMKRTDSLV----RGNRRPLASKDNN--RTQSILSVKNNAALGKSDHPLKRPA 73
           G  TP   +KRT S +     G R+PLASKD N  R+ S LS+K N+   K    + R  
Sbjct: 20  GPATPTQLLKRTRSTLLPKKNGQRQPLASKDKNYNRSSSYLSLKRNSNQKKLKPAVTRAG 79

Query: 74  SSFMKNMPENKLKKYGSVLGMNTFMPRTKSLVLKDTELNEKNDDEDEEDEEDDLPIFP-- 131
           S+                   N    R  SL+LKD    ++ +   E D EDD    P  
Sbjct: 80  ST------------------ANNANRRVTSLILKDIASGDEKESASESDSEDDEESNPLA 121

Query: 132 --------------SGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPF 177
                          GK+  L   +GL+ +  +++ +  IE A  R+ E PY P GY+P 
Sbjct: 122 LKIKQALTHSIASAEGKTGLLNGKSGLRKIFNDRDLDREIEVASVREPEKPYEPEGYEPL 181

Query: 178 DKESIEKLQ----HHRSPFQVES--------------ITFDTEERDPE---LISLAATDE 216
           D   +EKL+     +R  F ++S              +  D EE   E   L     TDE
Sbjct: 182 DDSDLEKLKLKNAINRPTFIMDSPRAISIVGDDSPQLLPLDLEESKLEEGVLNDKNTTDE 241

Query: 217 DLVSPTRYNNHKHNLEL-DSDNESITIELGEEYNGQG 252
            +   TR N    N  + +S ++  ++E+   Y+G+G
Sbjct: 242 VI---TRANTQAKNANITESIDDCSSVEIDSIYDGRG 275

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 87/210 (41%), Gaps = 64/210 (30%)

Query: 35  VRGNRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGM 94
           ++ NR PLASKDNN ++      N+  L  +   L +  S    N   NKL+KYGS+LG+
Sbjct: 72  IKLNRLPLASKDNNNSRR----SNSFILQNNKLVLNKQLSLLNNNQTSNKLRKYGSILGV 127

Query: 95  NTFMPR-------TKSLVLKD-------------------TELNEKNDDEDEED------ 122
           N             KSL+LKD                     LN KN  + +++      
Sbjct: 128 NNNGNNTNKTLNPVKSLILKDIPDNGNENDDDDDDDDDNIITLNLKNALQSKKEPLLNQL 187

Query: 123 -----------EEDDLPIFPSGKSLNLGFGNGLKALIREKEDE---------LNIEYAPK 162
                      EE+++ +F        G GNGL+ LI +  +            IE    
Sbjct: 188 KNAKKNSYSDSEEEEIGLF--------GKGNGLQKLISQSMNHKTKIEAEIIPEIETKSA 239

Query: 163 RQKELPYIPNGYDPFDKESIEKLQHHRSPF 192
              +L Y P GY PF+ E I+KL   +SP+
Sbjct: 240 AYPDLSYSPEGYIPFNNEDIKKLNTFKSPY 269

>TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {ON}
           Anc_8.265 YDR113C
          Length = 277

 Score = 38.5 bits (88), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 69/162 (42%), Gaps = 40/162 (24%)

Query: 39  RRPLASKDNN-RTQSILSVKNNAALGKSDHPLKRPASSFMKNM-PENKLKKYGSVLGM-- 94
           RRPLASKD N R  ++  VK++ +   S+            NM P N+LKKYGSVLG   
Sbjct: 55  RRPLASKDKNVRRTALGQVKSSISSNNSNTNSTNNNDKNKNNMLPMNRLKKYGSVLGYSN 114

Query: 95  NTFMP-RTKSLVLKDTELNEKNDDEDEEDEEDDLPIFPSGKSLNLGFGNGLKALIREKED 153
           NT     +K+L+LKD    EK  D+  EDE                              
Sbjct: 115 NTINSNASKTLILKDIAPLEK--DKHIEDE------------------------------ 142

Query: 154 ELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVE 195
              IE      KEL Y P  Y  F++E I+ L  +   F ++
Sbjct: 143 ---IETRSYEPKELDYEPENYFGFNQEEIDGLNDYTFNFNLQ 181

>Skud_10.133 Chr10 complement(253506..257162) [3657 bp, 1218 aa]
           {ON} YJL080C (REAL)
          Length = 1218

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 110 ELNEKNDDEDEEDEEDDLPIFPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPY 169
           E+NE + DED +D   D+ +F   +S+++     L A++RE+     I+     +K LPY
Sbjct: 216 EVNEGSYDEDMDDTTSDVSLFGDFESVSMAKAKIL-AIVREETKNATIKVVVDDEKYLPY 274

Query: 170 I 170
           +
Sbjct: 275 V 275

>YJL080C Chr10 complement(285558..289226) [3669 bp, 1222 aa] {ON}
           SCP160Essential RNA-binding G protein effector of mating
           response pathway, mainly associated with nuclear
           envelope and ER, interacts in mRNA-dependent manner with
           translating ribosomes via multiple KH domains, similar
           to vertebrate vigilins
          Length = 1222

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 110 ELNEKNDDEDEEDEEDDLPIFPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPY 169
           E+NE + DED +D   ++ +F   +S+NL     L A+++E+     I+   + +K LPY
Sbjct: 216 EVNENSYDEDMDDTTSNVSLFGDFESVNLAKAKIL-AIVKEETKNATIKLVVEDEKYLPY 274

Query: 170 I 170
           I
Sbjct: 275 I 275

>Smik_10.162 Chr10 complement(277210..280875) [3666 bp, 1221 aa]
           {ON} YJL080C (REAL)
          Length = 1221

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 45/81 (55%), Gaps = 2/81 (2%)

Query: 110 ELNEKNDDEDEEDEEDDLPIFPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPY 169
           E+NE + DED +D   D+ ++   +S+N+     + A+++E+     I+   + ++ LPY
Sbjct: 216 EVNEDSYDEDMDDTTSDVSLYGDFESVNMAKAK-IMAIVKEETKNATIKLVVEDERYLPY 274

Query: 170 I-PNGYDPFDKESIEKLQHHR 189
           +  +G+   D E   K+Q ++
Sbjct: 275 VDVSGFVSNDGEEEIKVQLYK 295

>NDAI0A05320 Chr1 complement(1199413..1200774) [1362 bp, 453 aa]
          {ON} Anc_3.328 YPR047W
          Length = 453

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 5/65 (7%)

Query: 35 VRGNRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGM 94
          + G   P ++KD N TQSIL++ N       +HP+       ++ + E KL         
Sbjct: 29 INGKEYPTSNKDTNVTQSILNLTNRNLHLNPNHPI-----GILRTIIETKLNSLSPYKTF 83

Query: 95 NTFMP 99
          N F P
Sbjct: 84 NNFSP 88

>SAKL0G17468g Chr7 (1513069..1514334) [1266 bp, 421 aa] {ON} similar
           to uniprot|Q2VQX1 Saccharomyces cerevisiae YLR443W ECM7
           Non-essential protein of unknown function
          Length = 421

 Score = 30.0 bits (66), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 23/35 (65%)

Query: 130 FPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQ 164
           FPSGK+L+  F +  +AL++   D L++E AP  Q
Sbjct: 361 FPSGKNLHAPFTDSNEALVQNNLDTLSLERAPSFQ 395

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.131    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,286,255
Number of extensions: 1824706
Number of successful extensions: 25546
Number of sequences better than 10.0: 478
Number of HSP's gapped: 24857
Number of HSP's successfully gapped: 488
Length of query: 263
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 156
Effective length of database: 41,212,137
Effective search space: 6429093372
Effective search space used: 6429093372
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 64 (29.3 bits)