Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19206g8.265ON26326312381e-174
AGR083W8.265ON2952152186e-20
Ecym_43058.265ON3111161985e-17
SAKL0H16962g8.265ON3363211898e-16
YDR113C (PDS1)8.265ON3732361793e-14
Kpol_543.418.265ON3062901748e-14
ZYRO0C01584g8.265ON2822601675e-13
Suva_2.2738.265ON3762951687e-13
NCAS0B038308.265ON3252741615e-12
NDAI0J013508.265ON4221491572e-11
TDEL0F039208.265ON3222671527e-11
Smik_4.3588.265ON3712131464e-10
KNAG0H032308.265ON2812101421e-09
Skud_4.3748.265ON3732371422e-09
KLTH0G13618g8.265ON3022911234e-07
Kwal_56.237818.265ON2931241138e-06
CAGL0L12298g8.265ON2862641092e-05
KAFR0B055108.265ON275283930.002
TBLA0E044608.265ON277162770.24
TPHA0A017808.265ON35257770.26
NDAI0A053203.328ON45365683.9
SAKL0G17468g4.328ON42135674.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19206g
         (263 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...   481   e-174
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    89   6e-20
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    81   5e-17
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...    77   8e-16
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...    74   3e-14
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    72   8e-14
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...    69   5e-13
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...    69   7e-13
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...    67   5e-12
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    65   2e-11
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...    63   7e-11
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...    61   4e-10
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    59   1e-09
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...    59   2e-09
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    52   4e-07
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    48   8e-06
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    47   2e-05
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    40   0.002
TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {...    34   0.24 
TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...    34   0.26 
NDAI0A05320 Chr1 complement(1199413..1200774) [1362 bp, 453 aa] ...    31   3.9  
SAKL0G17468g Chr7 (1513069..1514334) [1266 bp, 421 aa] {ON} simi...    30   4.3  

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score =  481 bits (1238), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 242/263 (92%), Positives = 242/263 (92%)

Query: 1   MPNEGKENIISVQDPDNDLGLRTPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNA 60
           MPNEGKENIISVQDPDNDLGLRTPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNA
Sbjct: 1   MPNEGKENIISVQDPDNDLGLRTPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNA 60

Query: 61  ALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXX 120
           ALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGMNTFMPRTKSLVL              
Sbjct: 61  ALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGMNTFMPRTKSLVLKDTELNEKNDDEDE 120

Query: 121 XXXXXXXPIFPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPFDKE 180
                  PIFPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPFDKE
Sbjct: 121 EDEEDDLPIFPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPFDKE 180

Query: 181 SIEKLQHHRSPFQVESITFDTEERDPELISLAATDEDLVSPTRYNNHKHNLELDSDNESI 240
           SIEKLQHHRSPFQVESITFDTEERDPELISLAATDEDLVSPTRYNNHKHNLELDSDNESI
Sbjct: 181 SIEKLQHHRSPFQVESITFDTEERDPELISLAATDEDLVSPTRYNNHKHNLELDSDNESI 240

Query: 241 TIELGEEYNGQGLDTLELNSLLD 263
           TIELGEEYNGQGLDTLELNSLLD
Sbjct: 241 TIELGEEYNGQGLDTLELNSLLD 263

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 88.6 bits (218), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 74/215 (34%), Positives = 104/215 (48%), Gaps = 28/215 (13%)

Query: 3   NEGKENIISVQDPDNDLGLRTPLNQMKRTDSLVRG---NRRPLASKDNNRTQSILSVKNN 59
           +E KEN+++       +  RTP++Q+KR+ S + G    R PLASKD N++Q +  +K +
Sbjct: 4   HEDKENLVTSAG-RGAMMPRTPIHQLKRSSSNLAGRNSTRMPLASKDRNQSQGVFGLKTS 62

Query: 60  AALGKSDHPL--KRPASS-FMKNMPENKLKKYGSVLGMN-TFMPRTKSLVLXXXXXXXXX 115
            A G        KRPASS   KNMP++KLKKYGSVLG+    + + KSLVL         
Sbjct: 63  GAGGAGGAQAQSKRPASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLVL--KDTSDCE 120

Query: 116 XXXXXXXXXXXXPIFPSGKSL---------------NLGFGNGLKALIRE---KEDELNI 157
                       P+    KS                 L  G  L  L      +ED   +
Sbjct: 121 SANEESEEEEGNPLAAKLKSRLCSAEEGGNEDDGSSGLLLGEALSQLAAAGETQEDVPPV 180

Query: 158 EYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPF 192
           EYAP++  ELP++PNGY+      + KL  + SPF
Sbjct: 181 EYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPF 215

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 80.9 bits (198), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 54/116 (46%), Positives = 74/116 (63%), Gaps = 12/116 (10%)

Query: 3   NEGKENIISVQDPDNDLGLRTPLNQMKRTDS---LVRGNRRPLASKDNNRTQSILSVKNN 59
           +E KENI +  +P   +  RTP++Q+KR+ S   L   +R PLASKD NR+QS  ++K  
Sbjct: 4   HEDKENIPTGSEPSGSIVPRTPMHQLKRSTSNVHLKNNSRLPLASKDRNRSQSGFNLKQQ 63

Query: 60  -------AALGKSDHPLKRPAS-SFMKNMPENKLKKYGSVLGMNT-FMPRTKSLVL 106
                    +    +  KRPAS SF+KNMP++KLKKYGSVLG+N   + +TKSLVL
Sbjct: 64  LVQGHVGGGVMVGQNKSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLTKTKSLVL 119

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 60/121 (49%), Gaps = 17/121 (14%)

Query: 157 IEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPF----QVESITFDTEERDPELISL- 211
           IE AP++  EL +IPNGY+ F+ E I KL  + SPF      E    D+ E +  LI L 
Sbjct: 194 IETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPFLRFADREEDDSDSTEGERLLIPLD 253

Query: 212 -AATDEDLVSPTRYNNHKHNLELDSDNESITIELGEEYN--------GQGLDTLELNSLL 262
               DE   SP++        E    N++I  ELG + +        G+GL + EL SLL
Sbjct: 254 FGGIDE---SPSKKQELMATQENIIANKTIVDELGTQADEIQFSFDIGKGLSSNELQSLL 310

Query: 263 D 263
           D
Sbjct: 311 D 311

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score = 77.4 bits (189), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 89/321 (27%), Positives = 130/321 (40%), Gaps = 84/321 (26%)

Query: 23  TPLNQMKRTDSLVR-----------GNRRPLASKDNNRTQSILSVKNNAALG-------- 63
           TP + +KR+ S ++           G R PLASKDNN++ ++++    +AL         
Sbjct: 20  TPSHLLKRSQSFMKPLASNSPTKKSGKRLPLASKDNNKSNTLINNGQKSALVNLAPNNSL 79

Query: 64  ------KSDHPLKRPASSFMKN---------MPENKLKKYGSVLGMNTFMPRTKSLVLXX 108
                 K + P+     SF+           +P+++LKKYGSVLG N  +PR KSLVL  
Sbjct: 80  LHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYGSVLGYNG-LPRVKSLVLKD 138

Query: 109 XXXXXXXXXXXXXXXXXXXPIFPSG---------KSLN--------------LGFGNGLK 145
                                             K+LN              LG   GL+
Sbjct: 139 VDERKVGKSEEGEEEEEDDDEEEEEDNPLAAKLLKALNNHNEDDKEEGSIGLLGSNTGLQ 198

Query: 146 ALIREKEDE------LNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITF 199
            L++ +  E        IE  P   +ELP++PNGY PF +  + KL    SPF +     
Sbjct: 199 QLLKHRNVEEGENSDFEIEIVPPHSEELPHVPNGYSPFKESDVIKLNTFTSPFSMHKEDS 258

Query: 200 DTEERDPE----LISLAAT-----DEDLVSPTRYNNH--------KHNLELDSDNESITI 242
           D EE D       IS+  +     D+D     R  +         +H L  D +   + I
Sbjct: 259 DCEECDDYDGLLTISMVKSEDEEQDDDTNDRKRRKSWIDEGLATARHGL-FDFNKPELYI 317

Query: 243 ELGEEYNGQGLDTLELNSLLD 263
           E    YNG+GL+  +L SLLD
Sbjct: 318 E--PHYNGEGLNKEDLESLLD 336

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score = 73.6 bits (179), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 100/236 (42%), Gaps = 58/236 (24%)

Query: 39  RRPLASKDNNRTQSI--------------------LSVKNNAALGKSDHPLKRPASSFMK 78
           R PLA+KDNNR++S                     LS++ N  L K     +  + +   
Sbjct: 85  RLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTLSIRKNDQLRKLSQISRSRSRANHN 144

Query: 79  NMPEN--KLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXXPIFPSGKSL 136
           ++  N  KL+KYGSVLG N  +P+ KSLVL                          GK L
Sbjct: 145 DLLSNSRKLQKYGSVLGYNA-LPKMKSLVLKDLADSGKNEESSDDDEGNEDSESKLGKKL 203

Query: 137 ----------------NLGFG-----NGLKALIR--------------EKEDELNIEYAP 161
                           N G G      GL+ LI+              +K D+ +IE AP
Sbjct: 204 QSALLKQDSSDGENELNGGLGLFNEQGGLQQLIKNSTKNEQKTKNDKSDKTDDYDIEIAP 263

Query: 162 KRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISLAATDED 217
           +RQ+ LPY+P GY PF ++ IEKL+   SP++++    D      +L+ L   DE+
Sbjct: 264 QRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLEDEDDTPDKVDLLPLEQIDEE 319

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 71.6 bits (174), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 86/290 (29%), Positives = 122/290 (42%), Gaps = 52/290 (17%)

Query: 22  RTPLNQMKRTDSLVR---------GN--------RRPLASKDNNRTQS------------ 52
           +TP N +KRT S ++         GN        R PLASKDNNR+ S            
Sbjct: 20  QTPNNLLKRTHSKLKTGIAKDIQGGNVINTSPQKRLPLASKDNNRSNSFLNNSNVNLNFN 79

Query: 53  ------ILSVKNNAALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGMNTFMPRTKSLVL 106
                   +   N    K  H  ++  S  + +  + KLKKYGSVLG N  +P+ KSLVL
Sbjct: 80  INNNNNNNNNNINNNNIKKQHIFQQNKSGILAD--DRKLKKYGSVLGYNA-LPKVKSLVL 136

Query: 107 X------XXXXXXXXXXXXXXXXXXXXPIFPSGKSLNLGFGNGLKALIREK-EDELNIEY 159
                                          S   + L  G  L+ LIR+  ED   IE+
Sbjct: 137 KDISDNEDDDDDLLSLKLRDSMNKKSINTNKSNSGIGLLSGGNLQQLIRDANEDVREIEH 196

Query: 160 APKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISLAATDEDLV 219
                 +  YIP+ + PFD+  I KL+   SPF++E    D EE   EL+ LA T +D  
Sbjct: 197 KSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLEQSNSDDEEDSSELLLLANTSDDEG 256

Query: 220 SPTRYNNHKHNLELDSDNESITI------ELGEEYNGQGLDTLELNSLLD 263
           +         NL +++   S  +      ++   Y G+GLD+ +L  LLD
Sbjct: 257 THNDKITTNKNLSINNKPNSKDVIPADILDIEPSY-GEGLDSNDLEDLLD 305

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score = 68.9 bits (167), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 81/260 (31%), Positives = 122/260 (46%), Gaps = 45/260 (17%)

Query: 23  TPLNQMKRTDSLVRGNRR-PLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMP 81
           TP+ +  R+ S VRG RR PLASKD+N++         +A G    P+K+   +    + 
Sbjct: 47  TPVKK-SRSVSPVRGQRRLPLASKDHNKS---------SAAG----PVKKRQPTLQGELL 92

Query: 82  EN--KLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXX-XPIFPSGKSLNL 138
            N  KL+KYGSVLG  T +PRTKSLVL                            +  N 
Sbjct: 93  SNPRKLQKYGSVLGY-TDLPRTKSLVLKDGDDEDDDEEEENSELQKKLQDAMNRREDSNE 151

Query: 139 GFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESIT 198
           G G GL  L+R+ +D+  IEYAP R   L Y P+G+  ++ E I KL+  +   ++    
Sbjct: 152 GLG-GLAKLVRDTKDD--IEYAPHRLPPLEYAPDGHTRWEDEDIVKLK--KVDLRIRDDQ 206

Query: 199 FDTEERDPE--------LISLAATDEDL-------VSPTRYNNHKH-NLELDSDNESITI 242
            D E+ +P+        L+S+ + +ED        + P  +  H    L +  +++   I
Sbjct: 207 DDHEDNEPQENDDGLLPLMSIESNNEDSNENEADEILPKNHRIHPFPKLRVFDEDQVENI 266

Query: 243 ELGEEYNGQGLDTLELNSLL 262
                YNG+GL+  EL  LL
Sbjct: 267 -----YNGEGLNAEELEDLL 281

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score = 69.3 bits (168), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 87/295 (29%), Positives = 119/295 (40%), Gaps = 74/295 (25%)

Query: 39  RRPLASKDNNRTQSI----------------------LSVKNNAALGKSDHPLKRPASSF 76
           R PLA+KDNNR++S                       LS + N  L K     +      
Sbjct: 84  RLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNTLSTRKNDQLRKLSQVSRNRNRGN 143

Query: 77  MKNMPEN--KLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXX-----------XX 123
              M  N  KL+KYGSVLG N  +P+ KSLVL                            
Sbjct: 144 YNGMLNNSRKLQKYGSVLGYNA-LPKMKSLVLKDLADPAKNQESSDDDDGSEGTDNKLSQ 202

Query: 124 XXXXPIFPSGKS-----LNLGFG-----NGLKALIR-----------EKEDELNIEYAPK 162
                 F    S      + G G      GL+ LI+           E  D+ +IE AP+
Sbjct: 203 KLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNTAKGKEGPGKEDGDDHDIEIAPQ 262

Query: 163 RQKELPYIPNGYDPFDKESIEKLQHHRSPF--QVESITFDTEERDP-ELISLAATDE--- 216
           RQ+ LPY+P+GY PF +E I KL+   SP+   +E  + +T   D   L+SL   +E   
Sbjct: 263 RQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLEGNSNNTNSADKVGLLSLVEVNEEDE 322

Query: 217 ---------DLVSPTRYNNHKHNLELDSDNESITIELGEEYNGQGLDTLELNSLL 262
                    D   P   +    N E D DN ++ + +   YNG+GLD+ EL  LL
Sbjct: 323 KDNTTHTIGDQQEPAELSLALQNSE-DDDNAAMPL-IESLYNGEGLDSEELEDLL 375

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score = 66.6 bits (161), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 79/274 (28%), Positives = 113/274 (41%), Gaps = 74/274 (27%)

Query: 29  KRTDSLVRGNRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMPENKLKKY 88
           +R   L   NR PLA KDNN + S  S KN                  + N+   KLKKY
Sbjct: 62  RRRQLLQLQNRLPLAKKDNNNS-SFSSRKNG-----------------LNNI--KKLKKY 101

Query: 89  GSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXXPIFPSGKSL------------ 136
           GSVLGM+  +PRTKSL+L                      +  + K              
Sbjct: 102 GSVLGMDA-LPRTKSLILKDVDDKPDDDEEDEDDNAFGLKLRNAMKQHENNSNEEENEGM 160

Query: 137 -NLGFG-------------NGLKALIREKEDELN--------------------IEYAPK 162
             LG G              GL+ LIRE   E +                    IEYAP 
Sbjct: 161 SGLGIGLFHDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPI 220

Query: 163 RQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISL----AATDEDL 218
           R++ LP++P GY PF  E I KL+   S ++++S     E+ D +L++L     + D++ 
Sbjct: 221 REEPLPFVPFGYTPFTPEDINKLKTFHSSYKLDSPVSTVEDAD-KLLALETIETSVDDEA 279

Query: 219 VSPTRYNNHKHNLELDSDNESITIELGEEYNGQG 252
                  +H+     DS+++S  I+L   YNG+G
Sbjct: 280 EWEHEVRHHRRRPTRDSNDDS--IDLVPLYNGEG 311

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 71/149 (47%), Gaps = 37/149 (24%)

Query: 152 EDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEER-----DP 206
           ++E +IEYAP R+  LPYIP GY PF  E I KL+ + SPF +     D ++      DP
Sbjct: 271 DEEDDIEYAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFAIHHDHSDYQQSPSTLGDP 330

Query: 207 E-LISL-------AATDEDLVSPTRY-------------NNHKHNLEL----DSDNESIT 241
           E L+SL       A T     SP+ Y              + KHN  +    ++DNES  
Sbjct: 331 EMLLSLQSFDTQTATTSSSCASPSLYPTTPIHKDTNINTTDQKHNTVILNVHNNDNESEG 390

Query: 242 IELGEE-------YNGQGLDTLELNSLLD 263
              GE        YNG GLD  +LN L++
Sbjct: 391 EYGGEHDQEIDKIYNGDGLDEDDLNDLIN 419

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 37/90 (41%), Gaps = 26/90 (28%)

Query: 23  TPLNQMKRTDSLVRGNRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMPE 82
            P N   R   L   NR PL+ KDNN +                  LK+    F      
Sbjct: 77  VPPNISPRRQLLQLQNRFPLSKKDNNNS----------------FILKQQQQQF----DH 116

Query: 83  NKLKKYGSVLGMNT------FMPRTKSLVL 106
            +LKKYGSVLG+ T       + R KSLVL
Sbjct: 117 KRLKKYGSVLGLGTDGNNHNNLTRIKSLVL 146

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score = 63.2 bits (152), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 81/267 (30%), Positives = 115/267 (43%), Gaps = 53/267 (19%)

Query: 35  VRGNRRPLASKDNNRTQSILSV----------KNNAALGKSDHPLKRPASSFMKNMPEN- 83
           V+  R PLASKDNNR+   L            K N +  K     KR A+     +  N 
Sbjct: 68  VQQGRPPLASKDNNRSTGFLPQLQKLQQQPSLKRNLSQSK-----KRNANVVDGQLLTNP 122

Query: 84  -KLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXXPIF-----------P 131
            +LKKYGSVLG N  +P+ KSLVL                      +             
Sbjct: 123 RRLKKYGSVLGYNA-LPKMKSLVLKDVDQVGEQGEDENDDEDEDHILRLKLHNAIDRSDE 181

Query: 132 SGKSLNLGFG-NGLKALIRE-KEDE-----LNIEYAPKRQKELPYIPNGYDPFDKESIEK 184
            G+ +   F  +GL  L+R+ K+DE       IEY P+R + LPYIP G+    +E  +K
Sbjct: 182 EGEEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYDK 241

Query: 185 LQHHRSPFQVESITFDTEERDP------ELISLAATDEDLVSPTRYNNHKHNLELDSDN- 237
           L+  RSP+ +E    D+++         E I  A  DE++         + NL +     
Sbjct: 242 LKTFRSPYLIEDDYSDSDDDKQDGFLQLEEIGSAGDDENI--------ERENLTVKQREM 293

Query: 238 --ESITIELGEEYNGQGLDTLELNSLL 262
             +  T E+   Y G+GLD  +LN LL
Sbjct: 294 LPQYDTFEIQPSYCGEGLDASDLNDLL 320

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score = 60.8 bits (146), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 88/213 (41%), Gaps = 57/213 (26%)

Query: 39  RRPLASKDNNRTQSILSV----------------KNNAALGKSDHPLKRPASSFMKNMPE 82
           R PLA+KDNNR +S + +                +N  ++ K+D   K    S  +N   
Sbjct: 84  RLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNTLSIRKNDQLRKLSQISRNRNRVN 143

Query: 83  N--------KLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXXPIFPSGK 134
           +        KL+KYGSVLG N  +P+ KSLVL                           K
Sbjct: 144 HSDLLNNTRKLQKYGSVLGYNA-LPKMKSLVLKDLVDPGKNEESSDDDDGSEGSENKLSK 202

Query: 135 SL------------------NLGFGN---GLKALIR-----------EKEDELNIEYAPK 162
            L                  ++G  N   GL+ LI+           +  D   IE AP+
Sbjct: 203 KLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNSVQNESKSKSDNADGYEIEIAPQ 262

Query: 163 RQKELPYIPNGYDPFDKESIEKLQHHRSPFQVE 195
           R   LPY+P+GY PF +E I+KL+   SP++++
Sbjct: 263 RLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELD 295

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 59.3 bits (142), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 96/210 (45%), Gaps = 35/210 (16%)

Query: 3   NEGKENIISV-QDPDNDL------GLRTPLNQMKRTDSL----VRGNRRPLASKDNNRTQ 51
           NE KEN ++V Q P +++       L+   ++ K++ S+     RG R PLASKDNN + 
Sbjct: 4   NEDKENAVAVPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRGGRLPLASKDNNASG 63

Query: 52  SILSVKNNAALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGM-NTFMPRTKSLVLXXXX 110
            ++S K    LG      ++PA    +     KLK+YGS+LG  N  + R+KSL+L    
Sbjct: 64  LVVSGK----LG------RQPADQVREANSSRKLKRYGSLLGYDNRQLTRSKSLILKDPE 113

Query: 111 XXXXXXXXXXXXXXXXXPIFPSGKS------------LNLGFGNGLKALIREKEDELNIE 158
                             I  +               +    G GL  L+R+ ++   +E
Sbjct: 114 APNESSKSVTKRLLLDEEIAKNSSDGDDDGDDTDILKIRSQLGGGLDRLVRQSQNR-ELE 172

Query: 159 YAPKRQKELPYIPNGYDPFDKESIEKLQHH 188
             P+ Q ELPYIP+G+    +  I KL+ +
Sbjct: 173 IRPQAQDELPYIPDGHIILHEADIAKLRDY 202

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/237 (28%), Positives = 95/237 (40%), Gaps = 59/237 (24%)

Query: 39  RRPLASKDNNRTQSILSVKNNAALGKSDH--PLKRPASSFMKN--------MPEN----- 83
           R PLA+KDNNR++S + V     L K     P ++   S  KN        +  N     
Sbjct: 84  RLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNTLSIRKNDQLRQLSQISRNRTRAN 143

Query: 84  ---------KLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXXPIFPSGK 134
                    KL+KYGSVLG N  +P+ KSLVL                     P    G 
Sbjct: 144 YNELLNNSRKLQKYGSVLGYNA-LPKMKSLVLKDLAGPAKNQESSDDDDGSEGPESKLGV 202

Query: 135 SLNLGF---------------------GNGLKALIR-------------EKEDELNIEYA 160
            L   F                       GL+ LI+             + +D+  IE A
Sbjct: 203 KLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNTTKGKQGSKEEDDDDDDYEIEIA 262

Query: 161 PKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVESITFDTEERDPELISLAATDED 217
           P+RQ+ LPY+P+GY  F +E IEKL+   SP++++            L+SL   DE+
Sbjct: 263 PQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELDLEDHGDSVDRVGLLSLEVIDEE 319

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 110/291 (37%), Gaps = 58/291 (19%)

Query: 23  TPLNQMKRTDSLVRGN-------RRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASS 75
           TP + + R+ S ++         RRPLASKDNNR+ S L  K    L K   P    A S
Sbjct: 20  TPRHLLSRSQSFMKNKSPKRAEARRPLASKDNNRSVSYLGTKE--PLRKRTRPGVNHAGS 77

Query: 76  FMKNMPENKLKKYGSVLGMN-TFMPRTKSLVLXXXXXXXXXXXXXXXXXXXXXPIF---- 130
           F+ N       + G    +N +  P+ KSLVL                            
Sbjct: 78  FVGNA------RLGPAPTLNASGAPKIKSLVLKDGIEEEGSQSEGAEVDEDDDDDSNRLA 131

Query: 131 -------------PSGKSLNL-GFGNGLKALI--------REKEDELNIEYAPKRQKELP 168
                          G+   L G   GL++L+         E + +  +E  P R + LP
Sbjct: 132 AKLRTKLLSRDRDAEGEQTGLLGATGGLQSLLGPKLSQRAEESDSDQEVEVIPPRPEPLP 191

Query: 169 YIPNGYDPFDKESIEKLQH-HRSPFQVESITFDTEE-----RDPELISL--AATDEDLVS 220
           ++P GY PF ++ I KLQ    SPFQ+     D +E        +L +L     D D   
Sbjct: 192 HVPEGYTPFGEQEIAKLQGVDVSPFQLNFSGVDEDEDINSQDSTQLFTLNFDRDDNDDTD 251

Query: 221 PTRYNNHKHN--------LELDSDNESITIELGEEYNGQGLDTLELNSLLD 263
             +    +H+        +      +S   EL   Y G GL   EL SLL+
Sbjct: 252 ADQSGRKRHHTPERTTIPISTGQRRKSDVFELEPTYAGNGLTAKELESLLE 302

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 60/124 (48%), Gaps = 10/124 (8%)

Query: 150 EKEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQH-HRSPFQV---ESITFDTEERD 205
           + + +L +E  P R + LP+IP+GY PF  E I KLQ    SPFQ+   +     + +  
Sbjct: 170 DSDSDLEVEVIPPRPEPLPHIPHGYTPFTDEDIGKLQDTEASPFQLNFADDDDDASSQDS 229

Query: 206 PELISLAATDEDLVSPTRYNNHK-HNLELDSDNESIT-----IELGEEYNGQGLDTLELN 259
            +L +L   ++D +    ++  + H  E      SI       EL   Y G GL T EL 
Sbjct: 230 TQLFTLKLDNDDNLGDQEHDRKRLHTPEKKPTRASIAQQAADFELDPIYAGHGLSTKELE 289

Query: 260 SLLD 263
           SLL+
Sbjct: 290 SLLE 293

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 44/92 (47%), Gaps = 16/92 (17%)

Query: 23  TPLNQMKRTDSLVRG-------NRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASS 75
           TP + + R+ S ++         R+PLASKDNN++   L  K    L K   P    A S
Sbjct: 20  TPTHLLSRSQSFMKNISPKRAEQRKPLASKDNNKSTGFLGAKE--PLRKRTRPTVNHAGS 77

Query: 76  FMKNMPENKLKKYGSVLGMNT-FMPRTKSLVL 106
           F+ N       + G V  +NT   PR KSLVL
Sbjct: 78  FIGNT------RPGVVPILNTNGAPRIKSLVL 103

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 108/264 (40%), Gaps = 39/264 (14%)

Query: 20  GLRTPLNQMKRTDSLV----RGNRRPLASKDNN--RTQSILSVKNNAALGKSDHPLKRPA 73
           G  TP   +KRT S +     G R+PLASKD N  R+ S LS+K N     S+    +PA
Sbjct: 20  GPATPTQLLKRTRSTLLPKKNGQRQPLASKDKNYNRSSSYLSLKRN-----SNQKKLKPA 74

Query: 74  SSFMKNMPENKLKKYGSVLGMNTFMPRTKSLVLXXXXXXXXXX---XXXXXXXXXXXPIF 130
            +   +   N  ++  S++  +      K                               
Sbjct: 75  VTRAGSTANNANRRVTSLILKDIASGDEKESASESDSEDDEESNPLALKIKQALTHSIAS 134

Query: 131 PSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQH--- 187
             GK+  L   +GL+ +  +++ +  IE A  R+ E PY P GY+P D   +EKL+    
Sbjct: 135 AEGKTGLLNGKSGLRKIFNDRDLDREIEVASVREPEKPYEPEGYEPLDDSDLEKLKLKNA 194

Query: 188 -HRSPFQVES--------------ITFDTEERDPE---LISLAATDEDLVSPTRYNNHKH 229
            +R  F ++S              +  D EE   E   L     TDE +   TR N    
Sbjct: 195 INRPTFIMDSPRAISIVGDDSPQLLPLDLEESKLEEGVLNDKNTTDEVI---TRANTQAK 251

Query: 230 NLEL-DSDNESITIELGEEYNGQG 252
           N  + +S ++  ++E+   Y+G+G
Sbjct: 252 NANITESIDDCSSVEIDSIYDGRG 275

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 69/283 (24%), Positives = 123/283 (43%), Gaps = 55/283 (19%)

Query: 9   IISVQDPDNDLGLR----TPLNQMKRTDSLVRGNRRPLASKDNNRTQSIL-SVKNNAALG 63
           ++++Q P+ +   +    T ++ +KR   L +  + PL SK+ N++ SIL S K N    
Sbjct: 16  VLALQTPNTNFVKKNTTSTRISPLKR---LQQQGKLPLQSKNGNKSNSILISHKGNNT-- 70

Query: 64  KSDHPLKRPASSFMKNMPENKLKKYGSVLGM----NTFMPRTKSLVLXXXXXXXXXXXXX 119
                               ++KKYGS+LG+    N  +P+TKSL+L             
Sbjct: 71  --------------------RIKKYGSILGLENPGNFKLPKTKSLILKDNESSESEEEDG 110

Query: 120 XXXXXXXXPIFPSGK--------SLNLGFGNGLKALIREKED-ELNIEYAPKRQKELPYI 170
                    +  S          S+ L      +  I   +D E++I    ++  EL YI
Sbjct: 111 LLNRKLKEALSRSQNDEDREGDGSVGLFAKEAFQNHISNDDDSEIDIINGKEKDVELSYI 170

Query: 171 PNGYDPFDKESIEKLQHHRSPFQVESITF------DTEERDPELISLAATD-EDLVSPTR 223
           P+ Y+    + IEKL+      + +S         D+  +  EL  ++ +D E+ + P+ 
Sbjct: 171 PDHYEVIAADEIEKLKQVNLGTRFKSSASSGLNDNDSTIQFLELEHVSDSDTEENIDPS- 229

Query: 224 YNN----HKHNLELDSDNESITIELGEEYNGQGLDTLELNSLL 262
           YN      K++ +  S +  IT E+G +Y G GLD  ++ ++L
Sbjct: 230 YNGVNRIGKNSTKSKSIDFDITEEIGTKYAGSGLDDDDIEAML 272

>TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {ON}
           Anc_8.265 YDR113C
          Length = 277

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 66/162 (40%), Gaps = 40/162 (24%)

Query: 39  RRPLASKDNN-RTQSILSVKNNAALGKSDHPLKRPASSFMKNM-PENKLKKYGSVLGM-- 94
           RRPLASKD N R  ++  VK++ +   S+            NM P N+LKKYGSVLG   
Sbjct: 55  RRPLASKDKNVRRTALGQVKSSISSNNSNTNSTNNNDKNKNNMLPMNRLKKYGSVLGYSN 114

Query: 95  NTFMPR-TKSLVLXXXXXXXXXXXXXXXXXXXXXPIFPSGKSLNLGFGNGLKALIREKED 153
           NT     +K+L+L                                     +  L ++K  
Sbjct: 115 NTINSNASKTLILKD-----------------------------------IAPLEKDKHI 139

Query: 154 ELNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHHRSPFQVE 195
           E  IE      KEL Y P  Y  F++E I+ L  +   F ++
Sbjct: 140 EDEIETRSYEPKELDYEPENYFGFNQEEIDGLNDYTFNFNLQ 181

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 35  VRGNRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMPENKLKKYGSV 91
           ++ NR PLASKDNN ++      N+  L  +   L +  S    N   NKL+KYGS+
Sbjct: 72  IKLNRLPLASKDNNNSRR----SNSFILQNNKLVLNKQLSLLNNNQTSNKLRKYGSI 124

 Score = 33.5 bits (75), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 138 LGFGNGLKALIREKEDE---------LNIEYAPKRQKELPYIPNGYDPFDKESIEKLQHH 188
            G GNGL+ LI +  +            IE       +L Y P GY PF+ E I+KL   
Sbjct: 206 FGKGNGLQKLISQSMNHKTKIEAEIIPEIETKSAAYPDLSYSPEGYIPFNNEDIKKLNTF 265

Query: 189 RSPF 192
           +SP+
Sbjct: 266 KSPY 269

>NDAI0A05320 Chr1 complement(1199413..1200774) [1362 bp, 453 aa]
          {ON} Anc_3.328 YPR047W
          Length = 453

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 5/65 (7%)

Query: 35 VRGNRRPLASKDNNRTQSILSVKNNAALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGM 94
          + G   P ++KD N TQSIL++ N       +HP+       ++ + E KL         
Sbjct: 29 INGKEYPTSNKDTNVTQSILNLTNRNLHLNPNHPI-----GILRTIIETKLNSLSPYKTF 83

Query: 95 NTFMP 99
          N F P
Sbjct: 84 NNFSP 88

>SAKL0G17468g Chr7 (1513069..1514334) [1266 bp, 421 aa] {ON} similar
           to uniprot|Q2VQX1 Saccharomyces cerevisiae YLR443W ECM7
           Non-essential protein of unknown function
          Length = 421

 Score = 30.4 bits (67), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 23/35 (65%)

Query: 130 FPSGKSLNLGFGNGLKALIREKEDELNIEYAPKRQ 164
           FPSGK+L+  F +  +AL++   D L++E AP  Q
Sbjct: 361 FPSGKNLHAPFTDSNEALVQNNLDTLSLERAPSFQ 395

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.132    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,426,020
Number of extensions: 1323884
Number of successful extensions: 3941
Number of sequences better than 10.0: 60
Number of HSP's gapped: 3998
Number of HSP's successfully gapped: 78
Length of query: 263
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 156
Effective length of database: 41,212,137
Effective search space: 6429093372
Effective search space used: 6429093372
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 64 (29.3 bits)