Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19184g8.264ON51251227910.0
AGR084C8.264ON42742511751e-158
Ecym_43068.264ON43445110771e-143
SAKL0H16984g8.264ON43542510341e-136
KLTH0G13640g8.264ON4144209581e-125
Kwal_56.237828.264ON4144219381e-122
ZYRO0C01606g8.264ON4324489161e-118
NCAS0B050308.264ON4334238671e-111
TDEL0F039108.264ON4294178511e-109
NDAI0B020008.264ON4334548341e-106
Kpol_543.408.264ON4144237453e-93
YLR090W (XDJ1)8.264ON4594387338e-91
Smik_12.1498.264ON4604667302e-90
KNAG0G020508.264ON4324187012e-86
Suva_10.1748.264ON4564607023e-86
Skud_12.1588.264ON4554497023e-86
TPHA0A017908.264ON4394766785e-83
CAGL0L12276g8.264ON4524375691e-66
ZYRO0A01496g2.243ON4123994752e-53
TBLA0E038102.243ON4103794725e-53
YNL064C (YDJ1)2.243ON4093714654e-52
CAGL0J09966g2.243ON4073724551e-50
ADL257C2.243ON4103764551e-50
Suva_14.2772.243ON4093764523e-50
KAFR0J009402.243ON4113944472e-49
KLLA0F03333g2.243ON4093734453e-49
Smik_14.2632.243ON4093714454e-49
KNAG0I019002.243ON4093754445e-49
Skud_14.2682.243ON4103714445e-49
Ecym_32812.243ON4093734437e-49
KLTH0G09394g2.243ON4113784421e-48
Kpol_1003.122.243ON4083754411e-48
TPHA0C031102.243ON4073754366e-48
Kwal_23.48302.243ON4113774341e-47
TDEL0C046002.243ON4113924244e-46
NDAI0D010302.243ON4113714131e-44
SAKL0E08734g2.243ON4113714113e-44
NCAS0G030002.243ON4103764103e-44
KLLA0E07899g2.218ON4954984022e-42
TDEL0C043502.218ON4624493914e-41
KLTH0G08756g2.218ON4624093881e-40
SAKL0E09306g2.218ON4614823792e-39
TPHA0G006308.730ON3933633621e-37
AER427W2.218ON4704023643e-37
Kwal_23.30612.218ON4584253633e-37
ZYRO0A06226g8.730ON3773623566e-37
NCAS0B005308.730ON3753793435e-35
CAGL0J10296g2.218ON4794333469e-35
KNAG0M020202.218ON4603863405e-34
Kpol_1002.1222.218ON5034153425e-34
Skud_14.2532.218ON5324233364e-33
ZYRO0C15048g2.218ON4914093345e-33
TDEL0B037908.730ON3733643277e-33
YMR214W (SCJ1)8.730ON3773623279e-33
CAGL0F03729g8.730ON3613723213e-32
Smik_13.4228.730ON3783923207e-32
Smik_14.2492.218ON5334263251e-31
SAKL0H05258g8.730ON3683693171e-31
YNL077W (APJ1)2.218ON5284193214e-31
Ecym_62368.730ON3743623111e-30
Suva_14.2622.218ON5364283144e-30
Suva_13.3978.730ON3753683074e-30
NDAI0E008708.730ON3763653066e-30
Skud_13.3838.730ON3753863031e-29
KLLA0C07260g8.730ON3683713004e-29
KLTH0D12496g8.730ON3753752995e-29
TBLA0E036602.218ON4484243018e-29
NCAS0G028502.218ON4944743021e-28
Kwal_26.90248.730ON3753672952e-28
AER346W8.730ON3673622942e-28
KAFR0A041608.730ON3783702934e-28
TPHA0D005508.61ON4863892922e-27
TBLA0B034908.730ON3843642872e-27
KNAG0G028808.730ON3783712854e-27
NDAI0F024502.218ON5304762888e-27
Kpol_1064.408.730ON3873632705e-25
KAFR0C031608.61ON4983462585e-23
KNAG0G011308.61ON5004222505e-22
Ecym_53842.218ON5033012452e-21
TBLA0D026008.61ON5104072401e-20
NCAS0C039508.61ON5194292391e-20
NDAI0G032808.61ON5524332347e-20
Suva_6.448.61ON5074212321e-19
Smik_6.638.61ON5104312283e-19
Skud_6.568.61ON5174812257e-19
YFL016C (MDJ1)8.61ON5114832248e-19
Kpol_1011.98.61ON4954752141e-17
ZYRO0F03652g8.61ON4624202132e-17
TPHA0C029802.218ON5542762081e-16
Kwal_47.179578.61ON4784152016e-16
TBLA0C014801.398ON3531061907e-15
TDEL0H022907.217ON3871231845e-14
TBLA0D042407.217ON389761837e-14
NCAS0E029307.217ON3871061837e-14
CAGL0J04224g8.61ON5222611822e-13
KLTH0A03740g7.217ON395921802e-13
Ecym_43727.217ON579671812e-13
Kwal_0.2071.398ON353701782e-13
KLTH0H12100g1.398ON350701782e-13
CAGL0H03707g1.398ON349701783e-13
NDAI0E045607.217ON394671783e-13
Kpol_1070.227.217ON380921783e-13
TPHA0G014808.698ON660711795e-13
ZYRO0E04598g1.398ON357781765e-13
NDAI0G042501.398ON363751765e-13
KNAG0F008602.15ON626821786e-13
NCAS0C048901.398ON367751756e-13
Kwal_47.181337.217ON393921757e-13
Kpol_1072.48.698ON6611351777e-13
AAL008W1.398ON349701747e-13
YNL007C (SIS1)1.398ON352701748e-13
TDEL0B059601.398ON369781749e-13
Suva_14.3411.398ON359701721e-12
NCAS0G036101.398ON327701711e-12
KLLA0D04818g1.398ON354701712e-12
TPHA0C012607.217ON380931722e-12
SAKL0D08778g1.398ON348701702e-12
Kwal_23.44202.15ON5921211723e-12
Skud_5.1587.217ON391671694e-12
NDAI0F038002.15ON638971705e-12
TBLA0E024907.217ON3661331685e-12
KNAG0H016801.398ON363751675e-12
Kpol_457.151.398ON357701676e-12
Ecym_12921.398ON347701666e-12
KAFR0H031501.398ON359701659e-12
CAGL0J07370g2.15ON623661689e-12
TBLA0B037308.698ON693931671e-11
Smik_14.3211.398ON366701642e-11
Smik_5.1737.217ON391671642e-11
YER048C (CAJ1)7.217ON391671642e-11
Skud_14.3201.398ON368701632e-11
TPHA0L007907.157ON446761642e-11
CAGL0J02750g7.217ON382671632e-11
CAGL0L00957g7.217ON3731031632e-11
SAKL0F08052g7.217ON393671632e-11
TBLA0A011007.157ON434761642e-11
NCAS0G013602.15ON6161201642e-11
KNAG0J018408.698ON650711643e-11
NDAI0C026101.398ON340701613e-11
TPHA0B037601.398ON355701614e-11
YNL227C (JJJ1)2.15ON590691634e-11
KAFR0H023108.698ON655711634e-11
KAFR0L007407.217ON364921604e-11
KLLA0E04423g7.217ON428941614e-11
Kpol_529.212.15ON622661626e-11
CAGL0G07469g8.698ON668821626e-11
TBLA0G001702.15ON659901616e-11
ZYRO0F15400g2.15ON525901607e-11
Smik_14.1062.15ON593921608e-11
KNAG0L013307.217ON396761589e-11
Kpol_526.62.350ON2281101531e-10
TDEL0C008708.61ON4702481571e-10
KLTH0B08338g2.15ON5901201581e-10
SAKL0E14234g2.15ON678661581e-10
KLLA0D13464g7.157ON433871562e-10
TPHA0C045902.350ON233671503e-10
KLLA0D19602g2.15ON620721563e-10
Suva_5.1507.217ON391671543e-10
AFR639W1.113ON1561071453e-10
ZYRO0D16390g7.217ON398671534e-10
TBLA0J018707.157ON470691544e-10
Suva_14.1162.15ON600931554e-10
Skud_13.3232.350ON224671484e-10
Skud_14.1102.15ON596691536e-10
ZYRO0D10934g8.698ON663711527e-10
NDAI0A028207.157ON482851518e-10
KAFR0A079502.15ON551841519e-10
NCAS0C012208.698ON6691381501e-09
Smik_9.2037.157ON432761491e-09
CAGL0J01936g7.157ON425781482e-09
TDEL0G028002.350ON225941442e-09
YMR161W (HLJ1)2.350ON224671432e-09
NDAI0H031802.350ON229671442e-09
KLLA0D07656g8.61ON4712551482e-09
NCAS0D009602.350ON224671432e-09
KNAG0I007407.157ON4251021482e-09
ABL194C2.15ON552661482e-09
Smik_10.3851.113ON1721201402e-09
Suva_13.3402.350ON225671423e-09
YIR004W (DJP1)7.157ON432761463e-09
KLLA0C09823g8.698ON669711473e-09
TDEL0E005002.15ON581811464e-09
Smik_15.4378.698ON663931474e-09
ADR015W7.157ON436851454e-09
CAGL0H04499g2.350ON232671414e-09
TDEL0A064308.698ON666711464e-09
KLLA0D06402g1.297ON631811464e-09
SAKL0F04444g7.157ON429871454e-09
ZYRO0G03850g7.157ON418761454e-09
ADR124C1.297ON611811465e-09
YOR254C (SEC63)8.698ON663931465e-09
Smik_13.3612.350ON224671405e-09
KLTH0F09944g2.350ON233671405e-09
Kwal_23.3578singletonOFF85581305e-09
Ecym_44697.157ON433881446e-09
Suva_8.3038.698ON664931456e-09
NCAS0A132107.157ON414761437e-09
YJR097W (JJJ3)1.113ON1721201367e-09
TDEL0C058801.113ON159981357e-09
TPHA0O019402.15ON598721447e-09
TDEL0H032107.157ON411791437e-09
Skud_9.1817.157ON421791438e-09
Skud_10.3191.113ON1681121359e-09
AFR507W8.61ON474671439e-09
KLTH0A02882g8.61ON4732321439e-09
TBLA0J009701.185ON586641439e-09
Kpol_499.307.157ON408761421e-08
Skud_15.4208.698ON665711431e-08
SAKL0E06050g2.350ON232671371e-08
Suva_9.2137.157ON431761411e-08
Suva_12.1851.113ON168871332e-08
CAGL0C04565g1.113ON175991332e-08
ZYRO0A07502g2.350ON238671352e-08
KLTH0F13398g7.157ON419691392e-08
Ecym_23748.698ON661881402e-08
KAFR0B047807.157ON4231051392e-08
TBLA0B093802.350ON227671343e-08
Kwal_55.209657.157ON421691383e-08
KAFR0F018101.185ON555661393e-08
KLLA0C02981g1.113ON162721303e-08
Smik_10.1681.297ON6491021384e-08
KAFR0A016201.297ON665661384e-08
SAKL0H05984g8.698ON658711384e-08
Suva_6.1481.297ON642961375e-08
KNAG0I008602.350ON219671325e-08
Skud_10.1691.297ON6441021375e-08
NDAI0B002001.185ON594661375e-08
AAL103W8.698ON669711366e-08
SAKL0C03476g1.113ON1651001286e-08
YJL073W (JEM1)1.297ON6451031367e-08
KAFR0B048902.350ON2201191308e-08
Ecym_56262.350ON243671318e-08
KLLA0E01629g2.350ON231671309e-08
Kwal_14.24521.297ON6071011341e-07
KNAG0B052401.297ON668801332e-07
ADL111W7.217ON578691332e-07
Kwal_26.88798.698ON656711332e-07
NDAI0K012308.698ON6801371332e-07
TBLA0C027201.297ON715761322e-07
Kpol_1027.131.297ON641661322e-07
KNAG0C024501.185ON544661313e-07
KLTH0F03124g1.113ON162931233e-07
KLTH0D11770g8.698ON652711303e-07
ZYRO0F15972g1.113ON162931233e-07
KLTH0F04906g1.185ON590661303e-07
TBLA0A055601.92ON312721274e-07
Kpol_2000.561.92ON290681274e-07
NCAS0A093201.297ON635961304e-07
SAKL0C05456g1.185ON583641294e-07
AFL190C2.350ON235671254e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19184g
         (512 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...  1079   0.0  
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...   457   e-158
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...   419   e-143
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...   402   e-136
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...   373   e-125
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...   365   e-122
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...   357   e-118
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264    338   e-111
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...   332   e-109
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264    325   e-106
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...   291   3e-93
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...   286   8e-91
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...   285   2e-90
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...   274   2e-86
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...   275   3e-86
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...   275   3e-86
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...   265   5e-83
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...   223   1e-66
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...   187   2e-53
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   186   5e-53
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...   183   4e-52
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   179   1e-50
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...   179   1e-50
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...   178   3e-50
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   176   2e-49
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...   176   3e-49
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...   176   4e-49
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...   175   5e-49
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   175   5e-49
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...   175   7e-49
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...   174   1e-48
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   174   1e-48
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...   172   6e-48
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...   171   1e-47
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...   167   4e-46
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...   163   1e-44
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...   162   3e-44
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...   162   3e-44
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...   159   2e-42
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...   155   4e-41
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...   154   1e-40
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...   150   2e-39
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...   144   1e-37
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...   144   3e-37
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...   144   3e-37
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...   141   6e-37
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730      136   5e-35
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...   137   9e-35
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...   135   5e-34
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...   136   5e-34
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...   134   4e-33
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...   133   5e-33
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...   130   7e-33
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...   130   9e-33
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...   128   3e-32
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...   127   7e-32
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...   129   1e-31
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...   126   1e-31
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...   128   4e-31
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...   124   1e-30
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...   125   4e-30
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...   122   4e-30
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...   122   6e-30
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...   121   1e-29
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...   120   4e-29
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...   119   5e-29
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...   120   8e-29
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218    120   1e-28
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...   118   2e-28
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...   117   2e-28
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...   117   4e-28
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...   117   2e-27
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...   115   2e-27
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...   114   4e-27
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...   115   8e-27
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....   108   5e-25
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...   103   5e-23
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...   100   5e-22
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...    99   2e-21
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    97   1e-20
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    97   1e-20
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    95   7e-20
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    94   1e-19
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    92   3e-19
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    91   7e-19
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    91   8e-19
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    87   1e-17
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    87   2e-17
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    85   1e-16
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    82   6e-16
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    78   7e-15
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    75   5e-14
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    75   7e-14
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     75   7e-14
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    75   2e-13
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    74   2e-13
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    74   2e-13
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...    73   2e-13
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...    73   2e-13
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...    73   3e-13
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             73   3e-13
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    73   3e-13
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    74   5e-13
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...    72   5e-13
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...    72   5e-13
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    73   6e-13
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398     72   6e-13
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    72   7e-13
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    73   7e-13
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...    72   7e-13
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...    72   8e-13
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...    72   9e-13
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...    71   1e-12
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398      70   1e-12
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...    70   2e-12
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    71   2e-12
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...    70   2e-12
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    71   3e-12
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    70   4e-12
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      70   5e-12
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    69   5e-12
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...    69   5e-12
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...    69   6e-12
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...    69   6e-12
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...    68   9e-12
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    69   9e-12
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    69   1e-11
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...    68   2e-11
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    68   2e-11
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    68   2e-11
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...    67   2e-11
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    68   2e-11
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    67   2e-11
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    67   2e-11
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    67   2e-11
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    68   2e-11
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    68   2e-11
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    68   3e-11
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}               67   3e-11
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...    67   4e-11
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    67   4e-11
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    67   4e-11
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    66   4e-11
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    67   4e-11
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    67   6e-11
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    67   6e-11
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    67   6e-11
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    66   7e-11
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    66   8e-11
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    65   9e-11
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    64   1e-10
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    65   1e-10
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    65   1e-10
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    65   1e-10
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    65   2e-10
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    62   3e-10
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    65   3e-10
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    64   3e-10
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    60   3e-10
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    64   4e-10
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    64   4e-10
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    64   4e-10
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    62   4e-10
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    64   6e-10
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    63   7e-10
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    63   8e-10
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    63   9e-10
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     62   1e-09
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    62   1e-09
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    62   2e-09
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    60   2e-09
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    60   2e-09
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      60   2e-09
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    62   2e-09
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    60   2e-09
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    62   2e-09
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    62   2e-09
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    59   2e-09
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    59   3e-09
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    61   3e-09
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    61   3e-09
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    61   4e-09
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    61   4e-09
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    60   4e-09
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    59   4e-09
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    61   4e-09
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    61   4e-09
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    60   4e-09
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    60   4e-09
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    61   5e-09
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    61   5e-09
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    59   5e-09
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    59   5e-09
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    55   5e-09
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    60   6e-09
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    60   6e-09
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    60   7e-09
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    57   7e-09
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    57   7e-09
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    60   7e-09
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    60   7e-09
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    60   8e-09
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    57   9e-09
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    60   9e-09
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    60   9e-09
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    60   9e-09
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    59   1e-08
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    60   1e-08
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    57   1e-08
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    59   1e-08
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    56   2e-08
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    56   2e-08
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    57   2e-08
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    58   2e-08
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    59   2e-08
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               58   2e-08
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    56   3e-08
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    58   3e-08
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    58   3e-08
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    55   3e-08
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    58   4e-08
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    58   4e-08
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    58   4e-08
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    57   5e-08
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    55   5e-08
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    57   5e-08
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       57   5e-08
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    57   6e-08
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    54   6e-08
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    57   7e-08
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    55   8e-08
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    55   8e-08
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    55   9e-08
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    56   1e-07
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    56   2e-07
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    56   2e-07
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    56   2e-07
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    56   2e-07
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    55   2e-07
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    55   2e-07
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    55   3e-07
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    52   3e-07
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    55   3e-07
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    52   3e-07
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    55   3e-07
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    54   4e-07
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    54   4e-07
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    55   4e-07
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    54   4e-07
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    53   4e-07
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    54   5e-07
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    54   5e-07
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    54   5e-07
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    51   6e-07
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    51   8e-07
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    53   8e-07
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    54   8e-07
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    51   8e-07
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    53   1e-06
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    53   1e-06
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    53   1e-06
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    52   1e-06
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    53   1e-06
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    50   1e-06
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    50   2e-06
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    52   2e-06
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    52   2e-06
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    52   3e-06
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    52   3e-06
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    51   4e-06
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    51   5e-06
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    49   5e-06
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    51   5e-06
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    51   6e-06
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    48   6e-06
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    48   9e-06
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    50   1e-05
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    48   1e-05
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    50   1e-05
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    49   2e-05
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    48   2e-05
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    49   2e-05
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    48   2e-05
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    49   3e-05
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    48   3e-05
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    49   3e-05
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    47   3e-05
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    48   5e-05
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    47   6e-05
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    47   8e-05
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    47   8e-05
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    46   1e-04
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    46   2e-04
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    44   4e-04
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    44   4e-04
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    44   4e-04
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    44   7e-04
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    43   8e-04
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    44   8e-04
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    43   8e-04
TBLA0A06620 Chr1 (1617259..1617876) [618 bp, 205 aa] {ON} Anc_3....    42   9e-04
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    44   0.001
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    44   0.001
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    44   0.001
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    43   0.001
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    43   0.001
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    43   0.001
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    43   0.001
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    43   0.001
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    43   0.001
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    43   0.002
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    43   0.002
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    41   0.002
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    42   0.002
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    42   0.002
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    42   0.002
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    42   0.002
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    42   0.003
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    42   0.003
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    42   0.003
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    41   0.004
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    41   0.005
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    41   0.005
Kwal_33.13451 s33 complement(229605..230468) [864 bp, 287 aa] {O...    40   0.008
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    40   0.008
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    40   0.008
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    40   0.009
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    40   0.009
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    40   0.011
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    39   0.014
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    40   0.018
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    39   0.021
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         39   0.022
TDEL0C04920 Chr3 complement(889534..890448) [915 bp, 304 aa] {ON...    39   0.022
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    39   0.025
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    39   0.030
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    39   0.032
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    38   0.034
KLLA0B08459g Chr2 (751178..752065) [888 bp, 295 aa] {ON} similar...    38   0.056
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    37   0.059
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    37   0.067
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    37   0.11 
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    36   0.13 
CAGL0D01584g Chr4 (167879..168781) [903 bp, 300 aa] {ON} similar...    37   0.13 
CAGL0A00297g Chr1 complement(30179..30775) [597 bp, 198 aa] {ON}...    36   0.15 
Kpol_1025.42 s1025 (112594..113172) [579 bp, 192 aa] {ON} (11259...    35   0.16 
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    36   0.18 
KLLA0C02541g Chr3 complement(226721..227533) [813 bp, 270 aa] {O...    36   0.20 
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    36   0.20 
Ecym_7225 Chr7 complement(466300..466908) [609 bp, 202 aa] {ON} ...    35   0.20 
TPHA0L02200 Chr12 complement(457070..457768) [699 bp, 232 aa] {O...    35   0.24 
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    35   0.24 
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    35   0.28 
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    35   0.31 
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    35   0.33 
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    35   0.34 
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    34   0.55 
SAKL0B07568g Chr2 complement(649545..650396) [852 bp, 283 aa] {O...    34   0.57 
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    34   0.73 
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    34   0.87 
NDAI0F01720 Chr6 complement(418941..420365) [1425 bp, 474 aa] {O...    34   1.1  
Smik_16.302 Chr16 complement(552646..553554) [909 bp, 302 aa] {O...    33   1.2  
Suva_12.16 Chr12 (21243..22130) [888 bp, 295 aa] {ON} YFR041C (R...    33   1.5  
KLLA0A04840g Chr1 complement(430541..431113) [573 bp, 190 aa] {O...    32   2.0  
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    32   2.2  
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...    33   2.3  
NCAS0A01690 Chr1 (330511..331077) [567 bp, 188 aa] {ON} Anc_4.10...    32   2.3  
Skud_16.346 Chr16 complement(640855..641760) [906 bp, 301 aa] {O...    32   2.5  
Ecym_2578 Chr2 complement(1130625..1131521) [897 bp, 298 aa] {ON...    32   2.6  
KAFR0F03210 Chr6 complement(634603..635160) [558 bp, 185 aa] {ON...    32   3.4  
YPR061C Chr16 complement(675977..676882) [906 bp, 301 aa] {ON}  ...    32   3.8  
NDAI0D03610 Chr4 (859564..860136) [573 bp, 190 aa] {ON} Anc_4.10...    31   3.9  
TPHA0K01620 Chr11 (345169..345831) [663 bp, 220 aa] {ON} Anc_4.1...    32   3.9  
TDEL0F02440 Chr6 (455229..455807) [579 bp, 192 aa] {ON} Anc_4.10...    31   4.8  
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    30   7.6  
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    30   8.0  
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    30   8.3  
Kwal_23.5985 s23 (1400870..1401745) [876 bp, 291 aa] {ON} YIL079...    31   8.8  

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score = 1079 bits (2791), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/512 (100%), Positives = 512/512 (100%)

Query: 1   MTYSVFNVKYSERFSSSKPYVFFTTGRFSVLHIWKYQMFKKQYEQEGHVDEEGAIGCTRL 60
           MTYSVFNVKYSERFSSSKPYVFFTTGRFSVLHIWKYQMFKKQYEQEGHVDEEGAIGCTRL
Sbjct: 1   MTYSVFNVKYSERFSSSKPYVFFTTGRFSVLHIWKYQMFKKQYEQEGHVDEEGAIGCTRL 60

Query: 61  TNSNVNYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEV 120
           TNSNVNYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEV
Sbjct: 61  TNSNVNYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEV 120

Query: 121 TAAYEILSDPELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYS 180
           TAAYEILSDPELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYS
Sbjct: 121 TAAYEILSDPELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYS 180

Query: 181 NRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPE 240
           NRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPE
Sbjct: 181 NRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPE 240

Query: 241 ISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEE 300
           ISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEE
Sbjct: 241 ISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEE 300

Query: 301 KSQTVYIPRGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNI 360
           KSQTVYIPRGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNI
Sbjct: 301 KSQTVYIPRGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNI 360

Query: 361 SLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQI 420
           SLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQI
Sbjct: 361 SLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQI 420

Query: 421 NIEFPKDNWFNEKSEITALRNILPGLKSKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAE 480
           NIEFPKDNWFNEKSEITALRNILPGLKSKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAE
Sbjct: 421 NIEFPKDNWFNEKSEITALRNILPGLKSKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAE 480

Query: 481 EKEKYNRKQQEEPHASAFDNDYTQMPSECATQ 512
           EKEKYNRKQQEEPHASAFDNDYTQMPSECATQ
Sbjct: 481 EKEKYNRKQQEEPHASAFDNDYTQMPSECATQ 512

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR090W
           (XDJ1)
          Length = 427

 Score =  457 bits (1175), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 221/425 (52%), Positives = 293/425 (68%), Gaps = 11/425 (2%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
           M +  Y+VLG+   A+E E+++AYR+LAL+YHPDKI DE+ERE SEA FKE++AAY +LS
Sbjct: 1   MTRDLYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLS 60

Query: 129 DPELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEP 188
           D + ++ YD +G      GG G  E  H  DDFMNFF+ Y   +HG      +  + G  
Sbjct: 61  DEQKRAEYDQFGTV---DGGYGHDEFGHGDDDFMNFFR-YGAGRHGYQHEEDDFEEVG-- 114

Query: 189 ESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNG 248
              RT DS +  K+TT+QLY+GKT  F+ +RK LCP C G+GLRK+   +P I C  C G
Sbjct: 115 ---RTADSTVPLKLTTKQLYLGKTFQFKARRKVLCPRCGGSGLRKRAAARPMIRCEGCEG 171

Query: 249 QGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIP 308
           QG+KERI+R+  G + ++   C  C GKG+    +A+D CK C+GK ++ EE   +VY+P
Sbjct: 172 QGYKERISRIGPGLISRERVSCADCGGKGKRIPTTAADNCKKCTGKCVVQEESIISVYVP 231

Query: 309 RGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSS-KSHLERKSNDLHTTLNISLVDALT 367
           RGS+HGD  R P  +DME GKETGD++ VIDE +   S LERK  DL+ T+ ISL +ALT
Sbjct: 232 RGSQHGDRLRYPGQSDMEPGKETGDLVFVIDEQTDVSSSLERKGTDLYCTMKISLAEALT 291

Query: 368 GFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKD 427
           GF+ IV  T+D R LR+N+P GKV+RPGNY KF  EGWP+ +G  FGDMYVQ+ IEFPKD
Sbjct: 292 GFTRIVTRTFDERVLRINIPRGKVLRPGNYLKFTNEGWPIEDGARFGDMYVQVLIEFPKD 351

Query: 428 NWFNEKSEITALRNILPGLK-SKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAEEKEKYN 486
           NWFNEK+E+ A+RNILPGL  +  TK  DP NTE+V +YS++ +H  LPDYL  E + Y+
Sbjct: 352 NWFNEKAELDAIRNILPGLADAPSTKTEDPSNTEEVRAYSIIANHTGLPDYLDRENQGYS 411

Query: 487 RKQQE 491
           R+Q E
Sbjct: 412 RQQHE 416

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
           similar to Ashbya gossypii AGR084C
          Length = 434

 Score =  419 bits (1077), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 214/451 (47%), Positives = 292/451 (64%), Gaps = 24/451 (5%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
           M +  Y VLG++ +ATE E+++AYR LAL YHPDKI DE++R  SEA FKE++AAY+ILS
Sbjct: 1   MGKDLYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILS 60

Query: 129 DPELKSRYDMYGDSAFGSGGNGFPEDDHEF--DDFMNFFQQYQRQQHGPHASYSNRHQYG 186
           D + +S YD YG    GS   G  +DD++   +DFMNFF    R   G +  Y +  Q  
Sbjct: 61  DEQKRSEYDHYGRFDEGSFPFGDFDDDYKRGNEDFMNFF----RYGAGRYGQYEDAEQ-- 114

Query: 187 EPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSC 246
              S++T D  +  K++T+QLY+GKT  F+LKR  LC  C G GLRK+      + C  C
Sbjct: 115 -KTSQKTKDFVVPLKLSTKQLYLGKTFQFKLKRNVLCSKCEGLGLRKRAAHCMPMKCGIC 173

Query: 247 NGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVY 306
           +G+GFKER++R++ G++ ++   CD C GKG    +  SD CK C GK +I E    T+Y
Sbjct: 174 DGRGFKERVSRISPGFISRERVPCDECDGKGTVVSRDPSDNCKKCHGKCVIVENSILTLY 233

Query: 307 IPRGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSS-KSHLERKSNDLHTTLNISLVDA 365
           +PRG RH D  R+   ADME GKETGD++  IDE +   + LERK  DLH ++ ISL +A
Sbjct: 234 VPRGHRHADTIRIDGQADMEAGKETGDLVFEIDEITDPDAELERKGTDLHCSITISLAEA 293

Query: 366 LTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFP 425
           LTGF+ +V  T+D+R LR+ +P+GKV+RPGNY KF  EGWP++NG  FGD+YV++NIEFP
Sbjct: 294 LTGFTRLVARTFDDRLLRITIPSGKVLRPGNYLKFTNEGWPINNGSRFGDLYVKVNIEFP 353

Query: 426 KDNWFNEKSEITALRNILPGLK----SKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAEE 481
           KDNW NEKSE+ A+++ILPGLK    S      DP NTED+ SY V+     LPDYLA+E
Sbjct: 354 KDNWLNEKSELEAIKHILPGLKNSSNSHQGDGDDPANTEDINSYYVIQDSSRLPDYLAQE 413

Query: 482 KEKYNRKQQEEPHASAFDNDYTQMPSECATQ 512
            ++ + +Q  E + +          SEC  Q
Sbjct: 414 GQQRSNQQYGERNTA----------SECPVQ 434

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 435

 Score =  402 bits (1034), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 217/425 (51%), Positives = 285/425 (67%), Gaps = 13/425 (3%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y+VLGV  DA++ EI+KAYRKLAL++HPDK+ DE  RE SE  FKE+TAAYEILSD + +
Sbjct: 5   YEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDEDSR 64

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESK-- 191
            +YD+YGD A   G +G   D    DDFMNFF+ Y     G       R  Y E E++  
Sbjct: 65  KKYDVYGDDA--PGASGGGGDPFGDDDFMNFFRTYA----GGGFYDEPRQPYPEEENRSV 118

Query: 192 RTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPE--ISCTSCNGQ 249
           RT D+RI  K++ ++LY GKT  F+ KR  LC  C G+GLRKK  Q P   + C SC G 
Sbjct: 119 RTSDARIPLKLSMKELYNGKTFKFRSKRNVLCDRCQGSGLRKKFQQHPRKPVVCQSCEGH 178

Query: 250 GFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPR 309
           G KERI R+A G+++++   C+ C GKGR       D CK C GK +I+EEK+ TVYIPR
Sbjct: 179 GHKERIKRVAQGFVIRETVKCERCNGKGRTTPTKPEDHCKKCHGKCVISEEKTLTVYIPR 238

Query: 310 GSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKS-HLERKSNDLHTTLNISLVDALTG 368
           GSR+GD  +L   AD E  K TGD++ VI+E+   S +LER+ +DLHT L ISL +A+TG
Sbjct: 239 GSRNGDIVKLEGEADQEPDKVTGDLLFVIEENPETSTNLERRGDDLHTRLKISLSEAITG 298

Query: 369 FSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSN-GDSFGDMYVQINIEFPKD 427
           F  +V  T D+R L++ +P GKVIRPGNY + + EGWPL + G+ FGDMYVQ++IEFP D
Sbjct: 299 FEKVVTTTLDDRILKLKIPQGKVIRPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFPPD 358

Query: 428 NWFNEKSEITALRNILPGLKSKDTKDPDPL-NTEDVLSYSVLHSHDELPDYLAEEKEKYN 486
           NWF+EKS++  LR +LP + +    D   L NTE V+ YSV+ S DELPDYL+ EK +Y 
Sbjct: 359 NWFSEKSDVEVLRTLLPEVPNARVADTGDLNNTETVIDYSVVKSADELPDYLSYEKGEYQ 418

Query: 487 RKQQE 491
            ++QE
Sbjct: 419 GQEQE 423

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
           {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 414

 Score =  373 bits (958), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 193/420 (45%), Positives = 267/420 (63%), Gaps = 25/420 (5%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132
           PY+ LGV  DAT+ EI+KAYR+LAL++HPDK+ DE+ R+ SE  FKEV AAYE+LS+ E 
Sbjct: 3   PYETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEK 62

Query: 133 KSRYDMYGDSAFGSGGNGFPEDDHEFDD--FMNFFQQYQRQQHGPHASYSNRHQYGEPES 190
           +  YD YGD+      NGF  D   F D  F +FF  +   +      Y + ++   P S
Sbjct: 63  RQNYDTYGDT------NGFSGDYSGFQDGDFASFFGNFASNR------YQDEYEAQSPPS 110

Query: 191 KRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQG 250
            RT D+ +  ++T ++LY GKT+ FQ KR  +C  C GTG+R++   +   +C+ C G G
Sbjct: 111 PRTDDAHVPIRLTMQELYNGKTIRFQAKRNVVCNRCEGTGVRRR--ARHASACSQCEGHG 168

Query: 251 FKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRG 310
            K+R+ RL  G++ ++   CD CKG G+  +  + D CK C GK +  E K+  VYIPRG
Sbjct: 169 VKQRLRRLGPGFVTREIVQCDKCKGLGKNLR--SEDMCKKCHGKRVTPESKNLNVYIPRG 226

Query: 311 SRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFS 370
           SRHGD   L   AD E GK  GD++  I E+S+ S LER+ +DL+  + ISL DALTGF 
Sbjct: 227 SRHGDRVVLKGEADEEPGKIPGDLVFDIAENSASSSLERRGSDLYAKITISLSDALTGFE 286

Query: 371 TIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSN-GDSFGDMYVQINIEFPKDNW 429
             VC T D R L++ VP G+V+RPGN+ +   EGWPL + G  FGDMYVQI+IEFP D+W
Sbjct: 287 KEVCTTLDGRLLKLKVPLGQVVRPGNFVRIDNEGWPLDDQGSKFGDMYVQIDIEFPPDHW 346

Query: 430 FNEKSEITALRNILP-GLKSKDTKD-----PDPLNTEDVLSYSVLHSHDELPDYLAEEKE 483
           F+E+S++ +L+N+LP  + S  T D      DP NTE  L +S++ S +ELP YL+EE E
Sbjct: 347 FSERSDVKSLQNLLPQAVSSSATSDFNASASDPANTETPLKFSIVKSAEELPQYLSEESE 406

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {ON}
           YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig 173]
           FULL
          Length = 414

 Score =  365 bits (938), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 195/421 (46%), Positives = 263/421 (62%), Gaps = 26/421 (6%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132
           PYD LGV  DAT+ EI+KAYR+LAL++HPDK+ DE+ RE SE  FKEV AAYE+LS+ E 
Sbjct: 3   PYDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEK 62

Query: 133 KSRYDMYGDSAFGSGGNGFPEDDHEFDD--FMNFFQQYQRQQHGPHASYSNRHQYGEPES 190
           +  YD YGD+      NG+ +    F D  F +FF  +          Y +   +     
Sbjct: 63  RRNYDTYGDT------NGYSDSYGGFQDGDFASFFGNFA------SGRYEDEEDFRAHAR 110

Query: 191 KRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQG 250
            RT D+ +S ++T + LY GKTV FQ  R  +C  C G G+RK+   +   +CT C G G
Sbjct: 111 PRTDDAHVSLRLTMQDLYNGKTVRFQSTRNVVCNRCEGAGIRKR--ARHASACTHCEGHG 168

Query: 251 FKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRG 310
            K+R+ RL  G++ ++   C  C+G G+  +  + D CK C GK +  E K+  VYIPRG
Sbjct: 169 VKQRLRRLGPGFVTRETVQCTKCRGLGKNLR--SEDLCKKCHGKRVTPETKNLNVYIPRG 226

Query: 311 SRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFS 370
           SRH D   L   AD E GK TGD++  I EDS+ S+LER+ +DLHT + ISL DALTGF 
Sbjct: 227 SRHNDRIVLEGEADEEPGKLTGDLVFDISEDSTTSNLERRGSDLHTKIIISLSDALTGFE 286

Query: 371 TIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSN-GDSFGDMYVQINIEFPKDNW 429
             VC T D R LR+ +P G+VIRPGNY   K EGWPL + G  FG+MYVQINIEFP D+W
Sbjct: 287 KEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDDEGKKFGNMYVQINIEFPPDHW 346

Query: 430 FNEKSEITALRNILP------GLKSKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAEEKE 483
           ++E+ EI ALRNI+P         S  + +PDP+NTE + ++ +L S +ELP+YL ++ E
Sbjct: 347 YSERGEIEALRNIIPQSTSSSAASSSASAEPDPVNTE-MPTFDILKSAEELPNYLPDDAE 405

Query: 484 K 484
           +
Sbjct: 406 Q 406

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {ON}
           similar to uniprot|P39102 Saccharomyces cerevisiae
           YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
           related to Ydj1p
          Length = 432

 Score =  357 bits (916), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 196/448 (43%), Positives = 269/448 (60%), Gaps = 28/448 (6%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD LGV +DAT+VEI+KAYRKLAL++HPDK+ D++ RE SE  FKE+TAAYE+LSD E +
Sbjct: 4   YDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEKR 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRT 193
           S+YD YGD+A G         D E + FMNFF Q+       +          +P   R+
Sbjct: 64  SKYDTYGDTADGP--------DFEDESFMNFFTQFNSGFGF-NGGGGGGFPGAQPGDDRS 114

Query: 194 PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKH-FQKPEISCTSCNGQGFK 252
            D ++  K++    Y GK   FQ KRK +C  C G+G R++     P+ +C SC G+G+K
Sbjct: 115 DDVQVPLKVSMADCYNGKVFKFQSKRKIVCEKCEGSGWRRRSGGPPPQTNCKSCQGRGYK 174

Query: 253 ERITRLAGGYMVKDHTVCDACKGKGRYRKKSASD--TCKHCSGKGLINEEKSQTVYIPRG 310
           E++ R+A G + +    C  C GKG+Y  K  S+   CK C G+G+I E K  TV IPRG
Sbjct: 175 EQLRRVAPGMVAQQTVSCGMCHGKGKYVSKPTSEKNQCKKCRGQGMIEEAKPLTVSIPRG 234

Query: 311 SRHGDEFRLPQMADMEYGK-ETGDVIIVIDEDSSKS---HLERKSNDLHTTLNISLVDAL 366
           SRHGD       AD E GK +TGD+I ++DE +       LER+  DL T ++ISL +A+
Sbjct: 235 SRHGDRIVFEGEADQEVGKSKTGDLIFIVDEGTEPPEGVRLERRGYDLITNISISLAEAI 294

Query: 367 TGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPL-SNGDSFGDMYVQINIEFP 425
           TG    + +T D R L+++ PAGKVI PG   K + EGWPL S+   FGD+YV ++I FP
Sbjct: 295 TGLDRTLTKTLDGRVLKLSTPAGKVISPGKIIKVEQEGWPLNSHATKFGDLYVLVDIVFP 354

Query: 426 KDNWFNEKSEITALRNILPGLKSKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAEEKEKY 485
           +DNWF EKS++  +RNILP   + +    DP NTE V    ++   D+LPDY+    ++Y
Sbjct: 355 RDNWFAEKSDLLKIRNILPSEAANNDVKADPGNTEQVSDMKLV---DQLPDYMGSNGDQY 411

Query: 486 NRKQQEEPHAS-AFDNDYTQMPSECATQ 512
                 E HAS AF +D T    +CA Q
Sbjct: 412 ----AHEGHASGAFPDDGT---PQCAQQ 432

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  338 bits (867), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 190/423 (44%), Positives = 260/423 (61%), Gaps = 36/423 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEA--ERETSEAMFKEVTAAYEILSDPE 131
           Y VLGV  +AT+ +I+KAYRKLAL++HPDK+++    +RE SE  FKE++AAYEILSD +
Sbjct: 5   YAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILSDED 64

Query: 132 LKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESK 191
            ++ YD+YG                ++D F +FF   Q ++   H        Y +P  K
Sbjct: 65  KRAHYDLYGSEEEQQ------RQQRQYDPFESFFNFEQDEEPSRH--------YEDP--K 108

Query: 192 RTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQK----PEISCTSCN 247
           R+PD +I  KMT ++LY GKT  F+ KR  +C +C G G R++   +    PE+ C  C 
Sbjct: 109 RSPDVKIPLKMTIQELYNGKTFKFKFKRNVICDNCEGLGWRRRKNGQVTVPPEVECKLCK 168

Query: 248 GQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDT--CKHCSGKGLINEEKSQTV 305
           GQGF E++  LA G+  ++   C  C GKG++  K+ S+   CK C G+GL  E K  TV
Sbjct: 169 GQGFTEKVRMLAPGFATREKRKCKQCDGKGKHYAKANSEKNKCKKCHGEGLFAESKVLTV 228

Query: 306 YIPRGSRHGDEFRLPQMADMEYGK-ETGDVIIVIDEDS---SKSHLERKSNDLHTTLNIS 361
            +PRG R GD  ++   AD E GK +TGD+I  I+ED        LERK ++  T LNIS
Sbjct: 229 SVPRGLRDGDTIKVVNEADQELGKPKTGDLIFSIEEDQRCPKDVQLERKGSNFMTELNIS 288

Query: 362 LVDALTGFS-TIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDS--FGDMYV 418
           L +ALTGF    V +T+D R L +++P GKVIRPGN  K + EGWPL NG++  FGD+Y+
Sbjct: 289 LAEALTGFKDKFVTKTFDGRILNLSIPPGKVIRPGNIIKIEQEGWPL-NGEATKFGDLYI 347

Query: 419 QINIEFPKDNWFNEKSEITALRNILPGLKSKDTK-DPDPLNTEDVLSYSVLHSHDELPDY 477
            +NIEFP DNWF EKS++T ++NILP   S  TK   DPLNTE +L + VL +   LPD 
Sbjct: 348 SVNIEFPPDNWFTEKSDLTQIKNILPRSTSDKTKLSDDPLNTELLLKFEVLET---LPDT 404

Query: 478 LAE 480
           L E
Sbjct: 405 LKE 407

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.264
           YLR090W
          Length = 429

 Score =  332 bits (851), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 179/417 (42%), Positives = 257/417 (61%), Gaps = 26/417 (6%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T Y++LGVE DAT++EI+KAYRK AL++HPDK+ DE+ RE SE  FKE+ AAYE+L D E
Sbjct: 3   TLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDEE 62

Query: 132 LKSRYDMYGDSAFGSGGNGFPEDDHEFDD--FMNFFQQYQRQQHGPHASYSNRHQYGEPE 189
            ++RYD YGD    + G+ F    +EF+D  FMNFF  +      P  +Y +   YGE +
Sbjct: 63  KRARYDKYGD----ADGSDFFNGPNEFEDAAFMNFFHSFGSN---PQNAYDH---YGEQK 112

Query: 190 SKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKH---FQKPEISCTSC 246
             R+ D ++   ++    Y GK+  FQ KR  +C  C G+G R+++      P++ C  C
Sbjct: 113 VDRSADVQVPLNVSMADCYNGKSFKFQSKRTLVCDRCLGSGWRRRNDHVVPPPQVECKKC 172

Query: 247 NGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASD--TCKHCSGKGLINEEKSQT 304
            GQGFK+RI RLA G+   ++  C  C GKG+   K  +D   CK C G G+  E KS T
Sbjct: 173 GGQGFKQRIRRLAPGFATTENITCPTCDGKGKCASKPNNDKNKCKKCVGTGVTTESKSLT 232

Query: 305 VYIPRGSRHGDEFRLPQMADMEYGK-ETGDVIIVIDEDSSKSH---LERKSNDLHTTLNI 360
           V +PRGSR  D+  L   AD E GK +TG+++  I E +       L+R   DL T L +
Sbjct: 233 VSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDLITHLTL 292

Query: 361 SLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQI 420
           SL +A+TGFS  + +T D R L++ +P GKVIRPGN  +   EGWP+    S GD+YV +
Sbjct: 293 SLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTTTS-GDLYVVV 351

Query: 421 NIEFPKDNWFNEKSEITALRNILPGLKSKDTK-DPDPLNTEDVLSYSVLHSHDELPD 476
           +IEFP DNWF+E+S++T ++N+LPG  + +   + DP NTE V + +++   +E+PD
Sbjct: 352 HIEFPPDNWFSERSDLTQVKNVLPGETNNNAAVEDDPGNTETVTNINIV---EEIPD 405

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264
          Length = 433

 Score =  325 bits (834), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 193/454 (42%), Positives = 267/454 (58%), Gaps = 40/454 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y +LGV   AT+ EI+KAYRKLAL+YHPDK++D  +RE +E  FKE+T+AYEILSD E +
Sbjct: 5   YSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEKR 64

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRT 193
           + YD+YGD+      N    ++   +DF NF           + SY+        ++ ++
Sbjct: 65  AHYDLYGDA------NENEYNNQNANDFFNF-----ETDQPDYDSYAF-------DNDKS 106

Query: 194 PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKK---HFQKP-EISCTSCNGQ 249
            D +I  K++ ++LY GKT  FQ KR  +C  C G G R++   +   P EI C  CNG 
Sbjct: 107 KDVKIPLKLSIQELYNGKTFKFQSKRNIICVQCEGLGWRRRKNGNVTIPHEIECKKCNGL 166

Query: 250 GFKERITRLAGGYMVKDHTVCDACKGKGRYRKK--SASDTCKHCSGKGLINEEKSQTVYI 307
           G+KER   L  G++  D   C+ C GKG    K  S  + CK+C GKGL++E K   V +
Sbjct: 167 GYKERTRMLIPGFVTTDKIRCEDCHGKGEVYAKPNSEKNKCKNCHGKGLLSENKQLLVSV 226

Query: 308 PRGSRHGDEFRLPQMADMEYGK-ETGDVIIVIDEDS---SKSHLERKSNDLHTTLNISLV 363
           PRG ++ D  R+   AD E GK +TGD+I+VI+ED+   S  H  RK  D    L++SL 
Sbjct: 227 PRGLQNKDTIRIENEADQEIGKSKTGDIILVIEEDTTMPSDVHFIRKGTDFVMYLSLSLA 286

Query: 364 DALTGF-STIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLS-NGDSFGDMYVQIN 421
           +ALTGF    + ++ D R L ++VP+GKVIRPGN  K K EGWP++     FGD+YV I 
Sbjct: 287 EALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGWPVNPQASKFGDLYVIIK 346

Query: 422 IEFPKDNWFNEKSEITALRNILP-GLKS--KDTKDPDPLNTEDVLSYSVLHSHDELPDYL 478
           IEFP DNWF+EKS+I  LRN+LP G+       K  DPLNTE V ++ +L   +ELPD L
Sbjct: 347 IEFPPDNWFSEKSDIQLLRNVLPSGINGMMNSWKIDDPLNTETVTTFDIL---EELPDTL 403

Query: 479 AEEKEKYNRKQQEEPHASAFDNDYTQMPSECATQ 512
            E     NR   +    S  + D  + P +C+ Q
Sbjct: 404 NESN---NRSAYDTGDQSDANYD-REGPPQCSQQ 433

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
           (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score =  291 bits (745), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 168/423 (39%), Positives = 244/423 (57%), Gaps = 40/423 (9%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++LGV +DAT  EI+K YRKLAL+YHPDK IDE ++  +E  FK++TAAY+ LSD + +
Sbjct: 14  YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRT 193
           + YD                      +F  +F+      H    +Y++R++       R+
Sbjct: 74  NEYD-------------------NKKNFEPYFESDFANNH--DGNYNSRYR------SRS 106

Query: 194 PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKH----FQKPEISCTSCNGQ 249
            D ++   + T +LY GKT+ F   R  +C  C+G G R K     +  PEI C  CNGQ
Sbjct: 107 KDIKVELSLKTSELYNGKTIKFNNSRNRICKTCNGLGWRTKKDGKPYVPPEIECQKCNGQ 166

Query: 250 GFKERITRLAGGYMVKDHTVCDACKGKGRYRKK--SASDTCKHCSGKGLINEEKSQTVYI 307
           G+K    +LA G+    + +C  CKG G+Y KK  S  + CK C+GK LI  +    V I
Sbjct: 167 GYKNMKVQLAPGFYTTQNVLCSYCKGNGKYYKKPNSPKNFCKDCNGKCLIKIDDPIVVSI 226

Query: 308 PRGSRHGDEFRLPQMADMEYGKE-TGDVIIVIDE-DSSKSHLERKSNDLHTTLNISLVDA 365
           PRGS +GD   L   AD E GK+  GD+I  I+E   S + LER  N L    +ISL +A
Sbjct: 227 PRGSSNGDNIILKGEADEELGKKNAGDLIFEINEIIDSNNDLERYGNHLINHTHISLAEA 286

Query: 366 LTGF-STIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSN-GDSFGDMYVQINIE 423
           +TGF +  + +T+D+R L ++ P GKVIRPG+  + K EGWP+   G SFG++YV + IE
Sbjct: 287 ITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWPMDKYGASFGNLYVILEIE 346

Query: 424 FPKDNWFNEKSEITALRNILPGLKSKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAEEKE 483
           FP DNW NEK++I  +RNILP  K+K     DP+N+E + ++ ++ S   LP    EE+ 
Sbjct: 347 FPPDNWINEKNDIIKIRNILPNEKTKRNNIVDPINSEYISTFEIVKS---LPQEEGEEQT 403

Query: 484 KYN 486
           +++
Sbjct: 404 EHD 406

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putative
           chaperone, homolog of E. coli DnaJ, closely related to
           Ydj1p; the authentic, non-tagged protein is detected in
           highly purified mitochondria in high-throughput studies
          Length = 459

 Score =  286 bits (733), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 174/438 (39%), Positives = 247/438 (56%), Gaps = 37/438 (8%)

Query: 68  DMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEIL 127
           D     YDVLGV +DAT  EI+ AYRKLALK+HPDK +D+  +E +E  FKE+TAAYEIL
Sbjct: 5   DRGDRLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEIL 64

Query: 128 SDPELKSRYDMYGD---SAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQ 184
           SDPE KS YD+YGD   +A   G NGF ++D        F        + P         
Sbjct: 65  SDPEKKSHYDLYGDDNGAASSGGANGFGDEDFMNFFNNFFNNGSHDGNNFP----GEYDA 120

Query: 185 YGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGL---RKKHFQKPEI 241
           Y E  S  + D  I   +T + LYMGK + F LKR+ +C  C G+G    RK H    ++
Sbjct: 121 YEEGNSTSSKDIDIDISLTLKDLYMGKKLKFDLKRQVICIKCHGSGWKPKRKIHVTH-DV 179

Query: 242 SCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRY--RKKSASDTCKHCSGKGLINE 299
            C SC G+G KER+ R   G +     VC+ C GKG+Y  R K+  + C  C+G GL+++
Sbjct: 180 ECESCAGKGSKERLKRFGPGLVASQWVVCEKCNGKGKYTKRPKNPKNFCPDCAGLGLLSK 239

Query: 300 EKSQTVYIPRGSRHGDEFRLPQMADMEYGKET-GDVIIVIDEDSSKSHLERK-------- 350
           ++  TV +  G    D   +  MAD E  K T GD+   + E   + +LE+K        
Sbjct: 240 KEIITVNVAPGHHFNDVITVKGMADEEIDKTTCGDLKFHLTE--KQENLEQKQIFLKNFD 297

Query: 351 ---SNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPL 407
                DL+T++ ISL +ALTGF   + +T+D+R L ++V  G+V+RPG+  K   EGWP+
Sbjct: 298 DGAGEDLYTSITISLSEALTGFEKFLTKTFDDRLLTLSVKPGRVVRPGDTIKIANEGWPI 357

Query: 408 SNG--DSFGDMYVQINIEFPKDNWFNEKSEITALRNILPGLKS------KDTKDPDPL-N 458
            +      GD+YV ++IEFP DNWFNEKSE+ A++  LP   S       +T+D   L N
Sbjct: 358 LDNPHGRCGDLYVFVHIEFPPDNWFNEKSELLAIKTNLPSSSSCASHATVNTEDDSNLTN 417

Query: 459 TEDVLSYSVLHSHDELPD 476
            E + ++ ++H+ D+LP+
Sbjct: 418 NETISNFRIIHT-DDLPE 434

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
           (REAL)
          Length = 460

 Score =  285 bits (730), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 176/466 (37%), Positives = 253/466 (54%), Gaps = 66/466 (14%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YDVLGV  DA+  EI+ AYRKLALK+HPDK +D+  +E +E  FKE+TAAYEILSDPE K
Sbjct: 11  YDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPEKK 70

Query: 134 SRYDMYGD---SAFGSGGNGF-------------PEDDHEFDDFMNFFQQYQRQQHGPHA 177
           S YD+YGD   +A  +G +GF                DHE +DF   +  Y+        
Sbjct: 71  SHYDLYGDDYGTAGSTGADGFGDDDFMNFFNNFFNSGDHEGNDFPREYDTYE-------- 122

Query: 178 SYSNRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTG--LRKKH 235
                    E + K + D  I   +T + LYMGK + F+LKR+ +C  C G+G  L+KK 
Sbjct: 123 ---------EDKCKSSKDIDIDIFLTVKDLYMGKKLKFELKRQIVCMVCHGSGWKLKKKI 173

Query: 236 FQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRY--RKKSASDTCKHCSG 293
               E+ C SC G+G KER+ R   G +      C+ C GKG+Y  R K+  + C  C+G
Sbjct: 174 HVTHEVECESCGGKGSKERLKRFGPGLVASQWVTCEKCHGKGKYVKRPKNPKNFCPDCAG 233

Query: 294 KGLINEEKSQTVYIPRGSRHGDEFRLPQMADMEYGKET-GDVIIVIDEDSSKSHLERK-- 350
            GL ++++  TV +  G    D   +  MAD E  K   GD+   + E   + +LE+K  
Sbjct: 234 VGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVE--KQENLEQKQI 291

Query: 351 ---------SNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFK 401
                    + DL+T+  ISL +ALTGF   +  T+D+R L +++  G+VIRPG+  K  
Sbjct: 292 FLKNFDEGSAEDLYTSATISLSEALTGFEKFLTRTFDDRLLTLSIKPGRVIRPGDVIKIT 351

Query: 402 GEGWPLSNG--DSFGDMYVQINIEFPKDNWFNEKSEITALRNILPGLKS--------KDT 451
            EGWP+ +      GD+YV I+IEFP DNWFNEKSE+ A++ +LP   S           
Sbjct: 352 NEGWPIMDDPRGQRGDLYVFIHIEFPPDNWFNEKSELLAIKTMLPSSSSCTFQTTANTGE 411

Query: 452 KDPDPLNTEDVLSYSVLHSHDELPDYLAEEKEKYNRKQQEEPHASA 497
            D +P+N E + ++ +++  +ELP    E  + +N + Q   H  A
Sbjct: 412 DDRNPINNETISNFQIIN-MEELP----EGMKIFNSESQNSAHQKA 452

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.264
           YLR090W
          Length = 432

 Score =  274 bits (701), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 162/418 (38%), Positives = 235/418 (56%), Gaps = 32/418 (7%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132
           PYD+LGV++D+T+ EIRKAYRKLALK+HPDK+ID  E+ ++E  FKE+T AYEILS+ E 
Sbjct: 6   PYDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSNGEY 65

Query: 133 KSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKR 192
               +   +      G GF    +  DDFMNFF +  R  H P   +  R      E+  
Sbjct: 66  VEEMEEEYEGQ----GYGF----NFGDDFMNFFNE-GRNAH-PMGGHPQREDESTNEA-- 113

Query: 193 TPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKH----FQKPEISCTSCNG 248
              ++I  ++T + LY GK V FQL R  +C  C G   R++     +  P +SCT C G
Sbjct: 114 ---TQIEIEVTLKDLYNGKNVKFQLTRNVICTLCDGNCWRRRKNGDLYSPPVLSCTKCKG 170

Query: 249 QGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASD--TCKHCSGKGLINEEKSQTVY 306
            G+ ER+   +  +       C  C GKG Y  K  SD   CK C G+GLI E++   V 
Sbjct: 171 AGYVERLVGDSPFFQYVQRISCRKCFGKGEYTAKPTSDKNKCKLCHGEGLIKEKQQLLVT 230

Query: 307 IPRGSRHGDEFRLPQMADMEY-GKETGDVIIVI---DEDSSKSH---LERKSNDLHTTLN 359
           IPRGS + +     +  D +   +  GD++  +   DE +       + ++  DLH  + 
Sbjct: 231 IPRGSENSNTIIFKEKGDEDLRTRRAGDIVFRLKLHDEPNGGDPDILVTKEGTDLHMNIE 290

Query: 360 ISLVDALTGF-STIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLS-NGDSFGDMY 417
           I L++A++G     + +T+D+R L++ +P GKV+RPG+    KGEGWP + NG  FGDM+
Sbjct: 291 IPLIEAISGTQGRFLTKTFDDRVLKLTMPQGKVLRPGDTIVIKGEGWPKTPNGTEFGDMF 350

Query: 418 VQINIEFPKDNWFNEKSEITALRNILPGLKSKD--TKDPDPLNTEDVLSYSVLHSHDE 473
           V +N+EFP DNW +E+++IT L N+LP  KS D   +  D  N E V  Y +L + DE
Sbjct: 351 VHVNVEFPPDNWISERNDITTLTNVLPAGKSDDGHAQTGDANNAEFVKDYEILKATDE 408

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
           (REAL)
          Length = 456

 Score =  275 bits (702), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 176/460 (38%), Positives = 248/460 (53%), Gaps = 58/460 (12%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YDVLGV ++A+  EI+ AYRKLALK+HPDK +D+  +E +E  FKE+TAAYEILSDPE K
Sbjct: 11  YDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPEKK 70

Query: 134 SRYDMYGDSAFGSGGNGFPEDD-------------HEFDDFMNFFQQYQRQQHGPHASYS 180
           S YD+YGD     GG+ F +DD             HE +DF N  + Y+           
Sbjct: 71  SHYDLYGDDNGTGGGDEFGDDDFMNFFNNFFNNGAHEANDFPNEHEMYEGN--------- 121

Query: 181 NRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGL--RKKHFQK 238
                   E+  + D  I    T + LYMGK + F+LKR+ +C  C G+G   +KK    
Sbjct: 122 --------ETTSSKDIDIDLSFTMKDLYMGKKLKFELKRQIICGKCQGSGWKAKKKVHVT 173

Query: 239 PEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRY--RKKSASDTCKHCSGKGL 296
            E+ C SC G+G KER+ R   G +     VC+ C GKG+Y  R K+  + C  C   GL
Sbjct: 174 HEMECESCGGKGSKERLKRFGPGLVASQWVVCEKCHGKGKYTKRPKNRKNFCPDCESVGL 233

Query: 297 INEEKSQTVYIPRGSRHGDEFRLPQMADMEYGKET-GDVIIVI---DEDSSKSHLERKS- 351
             +++  TV +P G    D   +  MAD E  K   GD+I  +    ED  +  +  K  
Sbjct: 234 QYKKEVITVNVPPGHHFNDVVTVKGMADEEIDKAVCGDLIFHLVEKPEDLQQKQVLMKKF 293

Query: 352 -----NDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWP 406
                 DL+ ++ +SL +ALTGF   +  T+D+R L +++  GKVIRPG+  K   EGWP
Sbjct: 294 GGGNLQDLYVSITVSLSEALTGFEKFLTRTFDDRLLTLSIKPGKVIRPGDIIKITNEGWP 353

Query: 407 LSNG--DSFGDMYVQINIEFPKDNWFNEKSEITALRNILPGLKSKDTK-------DPDPL 457
           + +      GD+YV ++IEFP DNWFNEKSE+ A++  LP   S+ +        D  P+
Sbjct: 354 ILDHPRGQCGDLYVFVDIEFPPDNWFNEKSELLAIKTHLPSSTSRPSNTTVNTGSDNSPI 413

Query: 458 NTEDVLSYSVLHSHDELPDYLAEEKEKYNRKQQEEPHASA 497
           N+E V ++ ++HS D     L E  + +N K Q   H  A
Sbjct: 414 NSETVSNFQIIHSDD-----LPEGMKTFNPKPQTSAHQKA 448

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
           (REAL)
          Length = 455

 Score =  275 bits (702), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 170/449 (37%), Positives = 246/449 (54%), Gaps = 37/449 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y VLGV +DA   EI+ AYRKLALK+HPDK +D+  ++ +E  FKE+TAAYEILSDPE K
Sbjct: 11  YGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILSDPEKK 70

Query: 134 SRYDMYGD---SAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHA--SYSNRHQ-YGE 187
           S YD+YGD   +A G G +GF  D                   G H    +SN ++ Y +
Sbjct: 71  SHYDLYGDDNGTANGGGTDGFGND-------DFMNFFNNFFNDGGHEGNGFSNEYKMYED 123

Query: 188 PESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGL--RKKHFQKPEISCTS 245
            +S  + D  I   +T + LYMGK + F LKR+ +C  C G+G   +K+     E+ C S
Sbjct: 124 NDSASSKDIDIDISLTMKDLYMGKKLRFDLKRQVVCMKCHGSGWKTKKRVHVTHEVECES 183

Query: 246 CNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRK--KSASDTCKHCSGKGLINEEKSQ 303
           C G+G KER+ R   G +     +C+ C GKG+YRK  K+  + C  C+G GL ++++  
Sbjct: 184 CGGKGSKERLKRFGPGLVASQWVMCEKCHGKGKYRKSPKNPKNFCPDCAGVGLQSKKEVI 243

Query: 304 TVYIPRGSRHGDEFRLPQMADMEYGKET-GDVIIVIDEDSS---------KSHLERKSND 353
           TV +  G    D   +  MAD E GK   GD+   ++E            K+  +    D
Sbjct: 244 TVIVAPGHHFNDVITIEGMADEEIGKAACGDLRFHLNERQEDWFAKQVFLKNFGDGNMED 303

Query: 354 LHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNG--D 411
            + ++ ISL +ALTGF   + +T+D+R L +++  G+VIRPG+  K   EGWP+ +    
Sbjct: 304 SYVSVTISLSEALTGFEKFLTKTFDDRLLTLSIKPGRVIRPGDVLKITNEGWPILDDARG 363

Query: 412 SFGDMYVQINIEFPKDNWFNEKSEITALRNILPGLKSKDTKDPDP---LNTEDVLSYSVL 468
             GD+YV I+IEFP DNWFNEKSE+  ++  LP   S      D    +N E V ++ ++
Sbjct: 364 RCGDLYVFIHIEFPPDNWFNEKSELLGIKTNLPSSSSSSCASGDANDLINNETVSNFQII 423

Query: 469 HSHDELPDYLAEEKEKYNRKQQEEPHASA 497
           H+ D+LP    E  + +  K Q   H  A
Sbjct: 424 HT-DDLP----EGVKTFKPKPQNPAHKKA 447

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {ON}
           Anc_8.264 YLR090W
          Length = 439

 Score =  265 bits (678), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 177/476 (37%), Positives = 253/476 (53%), Gaps = 64/476 (13%)

Query: 63  SNVNYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKI--IDEAERETS---EAMF 117
           SN N    +  Y +L V++  T+ E++K YRKLALKYHPDK+   D  E +     E  F
Sbjct: 2   SNENDPSTKDLYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKF 61

Query: 118 KEVTAAYEILSDPELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHA 177
           KE+ +AYEILSD E + +YD+                        NF    Q   +G   
Sbjct: 62  KEIISAYEILSDEEKRKQYDLQ----------------------KNFRDANQGSDYGDGI 99

Query: 178 SYSNRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRK---- 233
           + +    +G   SK   D  I  K+T + LY GK + + +KR  +C  C G G R     
Sbjct: 100 NTA----FGNQTSK---DISIPLKVTIKDLYNGKIIRYDIKRNVICEKCVGLGWRSRKNG 152

Query: 234 KHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSAS--DTCKHC 291
           K +  P   C +C+G G+K+   ++A G+  K + VC  C GKGRY KK AS  + C  C
Sbjct: 153 KQYVPPLTECKTCDGAGYKQVRQQIAPGFFTKQNLVCKNCDGKGRYYKKPASSKNFCLKC 212

Query: 292 SGKGLINEEKSQTVYIPRGSRHGDEFRLPQMADMEYGK-ETGDVIIVIDE-DSSKSHLER 349
           +GKG+I   +S TV IPRGS   D   +   AD E GK +TGD+I V++E D  ++ L+R
Sbjct: 213 NGKGIIEISESITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKR 272

Query: 350 KSN-DLHTTLNISLVDALTGF-STIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPL 407
             + DL T L ISL DA+TGF    + +T D R LR+++P GKVIR G+  K +GEGWPL
Sbjct: 273 YGDKDLITELTISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPL 332

Query: 408 S-NGDSFGDMYVQINIEFPKDNWFNEKSEITALRNILPGLKS----------KDTKDPDP 456
           + N    GD+Y++ NIEFP DNW +E ++I  +RN+LP +            KD      
Sbjct: 333 NKNATRSGDLYIKFNIEFPADNWNSEMNDIIKIRNLLPAISDAKADILGDMPKDDIFNIT 392

Query: 457 LNTEDVLSYSVLHSHDELPDYLAEEKEKYNRKQQEEPHASAFDNDYTQMPSECATQ 512
           +N+ED+ +Y  +    +LPD +    +  +    E  H     N +T+MP EC+ Q
Sbjct: 393 MNSEDISNYDFVK---DLPDII----DTSHNNGAEYGHNGDSAN-FTEMP-ECSQQ 439

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
           similar to uniprot|Q12014 Saccharomyces cerevisiae
           YLR090w
          Length = 452

 Score =  223 bits (569), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 155/437 (35%), Positives = 228/437 (52%), Gaps = 44/437 (10%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKII-DEAERETSEAM----FKEVTAAYEILS 128
           Y +LGV +DA++ EI++AYRKLAL++HPDK   +E   ++S+ +    FKEVTAAY++LS
Sbjct: 4   YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63

Query: 129 DPELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEP 188
           D  L++ YD             F    +  DDFMNFF  +    H  H S  +  +    
Sbjct: 64  DASLRAEYDQK---------LAFEAQPYGDDDFMNFFSGFNGGSHPGHRSGFDSGRGA-- 112

Query: 189 ESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTG-------LRKKHFQKPEI 241
              ++ D  I  K+ T +LY GK V F LKRK  C  C GTG       ++KK  +    
Sbjct: 113 RRYKSDDIEIDLKVKTSELYRGKKVNFNLKRKKKCQRCDGTGWKSHASIVKKKTAKFFWN 172

Query: 242 SCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRK--KSASDTCKHC--SGK-GL 296
            C  C GQG ++R+ +LA G++  +   C  C GKG+ R   KS  + C  C  SG  G+
Sbjct: 173 VCEGCEGQGVRQRLRQLAPGFVTTELIECRQCGGKGKLRNLPKSEKNKCPDCITSGTVGM 232

Query: 297 INEEKSQTVYIPRGSRHGDEFRLPQMADMEY-GKETGDVIIVIDEDSSKSH-LERKSNDL 354
           + E K  T+ I +G+  GD+  L   AD +    E GD++I I E     + + R   DL
Sbjct: 233 VEENKVVTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDL 292

Query: 355 HTTLNISLVDALTGFS-TIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWP----LSN 409
                I L DA+ GF    + ETYD R L+ +   GKVIRP +  + + EGWP     ++
Sbjct: 293 IIKKQIDLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDAND 352

Query: 410 GDSF---GDMYVQINIEFPKDNWFNEKSEITALRNILPGLKSK---DTKDPDPLNTEDVL 463
            ++    GD+YV ++I FP DNW  E ++  A+RNI+P   +K    T     LN E++ 
Sbjct: 353 NNTLLKNGDLYVIVDIVFPPDNWTMEVNDYRAVRNIIPSTINKRESSTSGESILNVENIN 412

Query: 464 SYSVLH---SHDELPDY 477
              ++    + DELP +
Sbjct: 413 VSEIVKEIPNCDELPKF 429

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {ON}
           highly similar to gnl|GLV|CAGL0J09966g Candida glabrata
           CAGL0J09966g and similar to YNL064C uniprot|P25491
           Saccharomyces cerevisiae YNL064C YDJ1 yeast dnaJ homolog
           (nuclear envelope protein) heat shock protein
          Length = 412

 Score =  187 bits (475), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 139/399 (34%), Positives = 185/399 (46%), Gaps = 39/399 (9%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A+E EI+KAYRK ALKYHPDK   E   E     FKE ++AYE+L D E +
Sbjct: 8   YDLLGVSATASETEIKKAYRKTALKYHPDKNPSEEAAEK----FKEASSAYEVLMDAEKR 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEF-------DDFMNFFQQYQRQQHGPHASYSNRHQYG 186
             YD +G+      G                 D F  FF     +  GP      +H+  
Sbjct: 64  EAYDQFGEEGLSGAGAAGGGFGGFGGFGGFGDDLFSQFFGGGASRPRGPQRGRDIKHE-- 121

Query: 187 EPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSC 246
                          +T  +LY G+T    L ++ LC  C G G ++   +K    CTSC
Sbjct: 122 -------------ITVTLEELYKGRTSKLALNKQILCKTCEGRGGKEGAVKK----CTSC 164

Query: 247 NGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVY 306
           NGQG K  ITR  G  + +  T CDAC G G     +  D CK CSGK + NE K   V+
Sbjct: 165 NGQGVK-FITRQMGPMIQRFQTECDACDGTGDII--NPKDRCKACSGKKVANERKILEVH 221

Query: 307 IPRGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDAL 366
           +  G + G +      AD       GDVI V+ E   K H  R S+DL    +I L+ A+
Sbjct: 222 VDPGMKDGQKIVFKGEADQAPDIIPGDVIFVVSERPHK-HFRRDSDDLVYEADIDLLTAI 280

Query: 367 TGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPK 426
            G      E      L+V +  G+VI PG     +G+G P+     FG++ V+ NI FPK
Sbjct: 281 AG-GEFAIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKYGGFGNLLVKFNIVFPK 339

Query: 427 DNWFNEKSEITALRNILPGLKSKDTKDPDPLNTED-VLS 464
           D+ F     +  L  ILP    K T  P   + +D VLS
Sbjct: 340 DH-FTSLENMKKLEEILP--PRKKTSIPSKAHVDDCVLS 375

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {ON}
           Anc_2.243 YNL064C
          Length = 410

 Score =  186 bits (472), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 133/379 (35%), Positives = 180/379 (47%), Gaps = 39/379 (10%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAM--FKEVTAAYEILSDPE 131
           YD+LGV   A+E EI+K YRK ALKYHPDK        T+EA   FKE +AAYE+LSDPE
Sbjct: 8   YDILGVSPTASESEIKKGYRKAALKYHPDK------NPTAEAAEKFKECSAAYEVLSDPE 61

Query: 132 LKSRYDMYGDSAFGSGGNGFPEDDHEF-----DDFMNFFQQYQRQQ-HGPHASYSNRHQY 185
            +  YD YG+    SGG G P     F     D F  FF     Q+  GP      +H+ 
Sbjct: 62  KRDVYDQYGEEGLSSGGPGGPGGFGGFGGFGDDIFSQFFGGGASQRPRGPQKGRDIKHEI 121

Query: 186 GEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTS 245
                            T  +LY G+T    L ++ LC  C G G +    +K    C+S
Sbjct: 122 A---------------ATLEELYKGRTAKLALNKQILCKSCEGRGGKADAVKK----CSS 162

Query: 246 CNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTV 305
           C GQG K  +T+  G  + +  T CD C G G          CK C GK + NE K   V
Sbjct: 163 CGGQGIK-FVTKQMGPMIQRFQTECDVCHGTGDIIDPKGR--CKSCHGKKIANERKILEV 219

Query: 306 YIPRGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDA 365
            I  G + G        +D       GDV+ V++E   K H +R  NDL     I L+ A
Sbjct: 220 KIEPGMKDGQRIVFKGESDQAPDIIPGDVVFVVNEKPHK-HFQRSGNDLVYLAEIDLLTA 278

Query: 366 LTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFP 425
           + G      E      L++ + AG+VI PG     +G+G P+     +G++ +Q NI+FP
Sbjct: 279 IAG-GEFALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILKYGGYGNLIIQFNIKFP 337

Query: 426 KDNWFNEKSEITALRNILP 444
            +N F ++S +  L  ILP
Sbjct: 338 -ENHFTDESNLKKLEEILP 355

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
           YDJ1Type I HSP40 co-chaperone involved in regulation of
           the HSP90 and HSP70 functions; involved in protein
           translocation across membranes; member of the DnaJ
           family
          Length = 409

 Score =  183 bits (465), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 127/371 (34%), Positives = 176/371 (47%), Gaps = 24/371 (6%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   AT+VEI+KAYRK ALKYHPDK   E   E     FKE +AAYEILSDPE +
Sbjct: 8   YDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEK----FKEASAAYEILSDPEKR 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRT 193
             YD +G+      G         F    + F Q+     G   +   R        +R 
Sbjct: 64  DIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQF----FGAGGAQRPRG------PQRG 113

Query: 194 PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKE 253
            D +     +  +LY G+T    L ++ LC  C G G +K   +K    CTSCNGQG K 
Sbjct: 114 KDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKK----CTSCNGQGIK- 168

Query: 254 RITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRH 313
            +TR  G  + +  T CD C G G        D CK C+GK + NE K   V++  G + 
Sbjct: 169 FVTRQMGPMIQRFQTECDVCHGTGDII--DPKDRCKSCNGKKVENERKILEVHVEPGMKD 226

Query: 314 GDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIV 373
           G        AD       GDV+ ++ E   KS  +R  +DL     I L+ A+ G     
Sbjct: 227 GQRIVFKGEADQAPDVIPGDVVFIVSERPHKS-FKRDGDDLVYEAEIDLLTAIAG-GEFA 284

Query: 374 CETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEK 433
            E      L+V +  G+VI PG     +G+G P+     +G++ ++  I+FP +N F  +
Sbjct: 285 LEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKFP-ENHFTSE 343

Query: 434 SEITALRNILP 444
             +  L  ILP
Sbjct: 344 ENLKKLEEILP 354

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064c YDJ1
          Length = 407

 Score =  179 bits (455), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 178/372 (47%), Gaps = 28/372 (7%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD LGV   A++ EI+KAYRK ALKYHPDK   E   E     FKEV++AYEILSD + +
Sbjct: 8   YDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSEEAAEK----FKEVSSAYEILSDSQKR 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPES-KR 192
             YD +G+      G         F +  + F Q+     G           G P   +R
Sbjct: 64  EVYDQFGEEGLSGNGGAGFPGGFGFGE--DIFSQFFGGATG-----------GRPRGPQR 110

Query: 193 TPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFK 252
             D +     +  +LY G+T    L ++ LC  C G G ++   +K    C+SCNGQG K
Sbjct: 111 GRDIKHEMAASLEELYKGRTAKLALNKQILCKSCEGRGGKEGAVKK----CSSCNGQGIK 166

Query: 253 ERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGSR 312
             +TR  G  + +  T CD C G G      A D CK C+GK + NE K   V I  G +
Sbjct: 167 -FVTRQMGPMIQRFQTECDVCHGTGDII--DAKDRCKSCNGKKVDNERKILEVRIEPGMK 223

Query: 313 HGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTI 372
            G +      AD       GDV+ VI E   K H +R  +DL     I L+ AL G    
Sbjct: 224 DGQKIVFKGEADQAPDVIPGDVVFVISEKPHK-HFQRAGDDLIYEAEIDLLTALAG-GQF 281

Query: 373 VCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNE 432
             E      L+V++  G+VI PG     +G+G P+     +G++ ++ NI+FP +N F  
Sbjct: 282 ALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKYGGYGNLLIKFNIKFP-ENHFTS 340

Query: 433 KSEITALRNILP 444
           +  +  L  ILP
Sbjct: 341 EENLKKLEEILP 352

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL064C
           (YDJ1)
          Length = 410

 Score =  179 bits (455), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 126/376 (33%), Positives = 179/376 (47%), Gaps = 33/376 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV  DA + +I+KAYRK ALKYHPDK       E +   FK++T AYEILSD + +
Sbjct: 8   YDLLGVSPDANDAQIKKAYRKSALKYHPDK----NPSEEAADKFKQITGAYEILSDSQKR 63

Query: 134 SRYDM-----YGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEP 188
             YD            G  G          D F  FF        G  AS     Q G  
Sbjct: 64  EMYDQFGEEGLNGGGQGGPGGFGGFGGFGEDIFSQFF-------GGGGASRPRGPQKGR- 115

Query: 189 ESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNG 248
                 D R     T   LY G+     L +  LC  C G G +    +K    CTSCNG
Sbjct: 116 ------DIRHDISCTLENLYKGRAAKLALNKTVLCKRCEGRGGKAGSVKK----CTSCNG 165

Query: 249 QGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIP 308
           QG K  +TR  G  + +  T C+ C G+G      A+D CK C GK + +E K   V I 
Sbjct: 166 QGVK-FVTRHMGPMIQRFQTTCEVCNGEGDV--IPAADRCKDCDGKKIASERKILEVNIQ 222

Query: 309 RGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTG 368
            G +HG +      AD + G+  GDV+ V++E      + R  ++LH    I L+ A+ G
Sbjct: 223 PGMKHGQKIVFQGEADQQPGQIPGDVVFVVNEQEHPRFV-RNGDNLHYEAEIDLLTAIAG 281

Query: 369 FSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDN 428
                 E      L++++  G+VI PG     +G+G P+    S+GD+ ++ N++FPK +
Sbjct: 282 -GQFALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKYGSYGDLLIKFNVKFPKSH 340

Query: 429 WFNEKSEITALRNILP 444
           + +E++ +  L  ILP
Sbjct: 341 FADEEA-LKKLEAILP 355

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  178 bits (452), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 123/376 (32%), Positives = 176/376 (46%), Gaps = 34/376 (9%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   AT+VEI+KAYRK ALK+HPDK   E   E     FKE ++AYE+LSD E +
Sbjct: 8   YDILGVSVTATDVEIKKAYRKCALKFHPDKNPSEEAAEK----FKEASSAYEVLSDSEKR 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQY-----QRQQHGPHASYSNRHQYGEP 188
             YD +G+      G         F    + F Q+      ++  GP      +H+    
Sbjct: 64  EVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPKGPQRGRDIKHE---- 119

Query: 189 ESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNG 248
                         +  +LY G+T    L ++ LC  C G G +K   +K    CT CNG
Sbjct: 120 -----------ISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKK----CTGCNG 164

Query: 249 QGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIP 308
           QG K  +TR  G  + +  T CDAC G G        D CK C+GK + NE K   V++ 
Sbjct: 165 QGIK-FVTRQMGPMIQRFQTECDACHGTGDIV--DPKDRCKSCNGKKIENERKILEVHVE 221

Query: 309 RGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTG 368
            G + G +      AD       GDV+ ++ E   K H +R  +DL     I L+ A+ G
Sbjct: 222 PGMKDGQKIVFKGEADQAPDVIPGDVVFLVSERPHK-HFKRDGDDLVYEAEIDLLTAIAG 280

Query: 369 FSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDN 428
                 E      L+V +  G+VI PG     +G+G P+     +G++ V+  I+FP +N
Sbjct: 281 -GEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGGYGNLIVKFTIKFP-EN 338

Query: 429 WFNEKSEITALRNILP 444
            F  +  +  L  ILP
Sbjct: 339 HFTTEENLKKLEEILP 354

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  176 bits (447), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 133/394 (33%), Positives = 184/394 (46%), Gaps = 31/394 (7%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A++ EI+KAYRK ALKYHPDK   E   E     FKE ++AYE+LSD E +
Sbjct: 8   YDILGVSPTASDSEIKKAYRKQALKYHPDKNPSEEAAEK----FKEASSAYEVLSDSEKR 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEF---DDFMNFFQQYQRQQHGPHASYSNRHQYGEPES 190
             YD +G       G             D F  FF        G  AS     Q G    
Sbjct: 64  DIYDQFGQDGLSGNGGMPGGAGGFGFGEDLFSQFF-------GGAGASRPRGPQRGR--- 113

Query: 191 KRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQG 250
               D +    ++  +LY GKT    L ++ LC  C G G +K   +K    C+SCNGQG
Sbjct: 114 ----DIKHEISVSLEELYKGKTSKLALNKQILCKTCEGRGGKKGAVKK----CSSCNGQG 165

Query: 251 FKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRG 310
            K  +TR  G  + +  T CD C G G      A D CK C GK + NE K   V +  G
Sbjct: 166 IK-FVTRQMGPMIQRFQTECDVCHGTGDII--DAKDRCKDCHGKKIANERKILQVNVDPG 222

Query: 311 SRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFS 370
            ++G +      AD       GDVI VI E   K H +R  +DL     I L+ A+ G  
Sbjct: 223 MKNGQKVVFKGEADQAPDIIPGDVIFVISEKPHK-HFQRVGDDLIYEAEIDLLTAVAG-G 280

Query: 371 TIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWF 430
               E      L+V++  G+VI P      +G+G P+     +G++ ++ +I+FP +N F
Sbjct: 281 EFALEHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQKYGGYGNLIIKFSIKFP-ENHF 339

Query: 431 NEKSEITALRNILPGLKSKDTKDPDPLNTEDVLS 464
            ++  +  L  ILP  K   T   + +  + VLS
Sbjct: 340 ADEDTLKKLEEILPARKPLPTFPKNAIVDDCVLS 373

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 409

 Score =  176 bits (445), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 122/373 (32%), Positives = 178/373 (47%), Gaps = 31/373 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A + +I+KAYRK ALK+HPDK   E   E     FKE+T+AYEILSD + +
Sbjct: 8   YDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSEEAAEK----FKEITSAYEILSDSQKR 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEF--DDFMNFFQQYQRQQHGPHASYSNRHQYGEPESK 191
             YD +G       G G P     F  D F  FF     +  GP      RH+       
Sbjct: 64  EVYDQFGLEGLSGQGAGGPGGFGGFGEDLFSQFFGGGSSRPRGPQKGRDIRHE------- 116

Query: 192 RTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGF 251
                      T  QL+ G+T    L ++ +C  C G G ++   +K    CT+C+GQGF
Sbjct: 117 --------IPATLEQLFKGRTAKLALNKQLICKSCEGRGGKEGSVKK----CTACSGQGF 164

Query: 252 KERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGS 311
           K  +TR  G  + +    C++C G G          CK CSGK ++NE K   V I  G 
Sbjct: 165 K-FVTRQMGPMIQRFQVECESCHGAGEIIDPKG--RCKVCSGKKVVNERKVLEVNIEPGM 221

Query: 312 RHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFST 371
           + G        AD   G   GDV+ V+ E       +R  NDLH    I L+ A+ G   
Sbjct: 222 KDGQRIVFQGEADQSPGIIPGDVVFVVSEQPHPV-FKRDGNDLHYDAEIDLLSAIAG-GQ 279

Query: 372 IVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFN 431
              +      L+V +  G+VI PG+    +G+G P+     +G++ ++ NI+FP  ++ +
Sbjct: 280 FAVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPIPKYGGYGNLLIKFNIKFPPAHFTD 339

Query: 432 EKSEITALRNILP 444
           +++ +  L  ILP
Sbjct: 340 DET-LKKLEEILP 351

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {ON}
           YNL064C (REAL)
          Length = 409

 Score =  176 bits (445), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 123/371 (33%), Positives = 175/371 (47%), Gaps = 24/371 (6%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   AT+VEI+KAYRK ALKYHPDK   E   E     FKE ++AYEILSD E +
Sbjct: 8   YDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAEK----FKEASSAYEILSDSEKR 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRT 193
             YD +G+      G         F    + F Q+     G   +   R        +R 
Sbjct: 64  EVYDQFGEEGLSGAGGAGGFPGGGFGFGDDIFSQF----FGAGGAQRPRG------PQRG 113

Query: 194 PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKE 253
            D +     +  +LY G+T    L ++ LC  C G G +K   +K    C+SCNGQG K 
Sbjct: 114 KDIKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAVKK----CSSCNGQGIK- 168

Query: 254 RITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRH 313
            +TR  G  + +  T CD C G G        D CK C+GK + NE K   V++  G + 
Sbjct: 169 FVTRQMGPMIQRFQTECDVCHGTGDII--DPKDRCKSCNGKKVENERKILEVHVEPGMKD 226

Query: 314 GDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIV 373
           G        AD       GDV+ ++ E   K + +R  +DL     I L+ A+ G     
Sbjct: 227 GQRIVFKGEADQAPDVIPGDVVFIVSERPHK-NFKRDGDDLVYEAEIDLLTAIAG-GEFA 284

Query: 374 CETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEK 433
            E      L+V +  G+VI PG     +G+G P+     +G++ ++  I+FP +N F  +
Sbjct: 285 LEHVSGDWLKVGIVPGEVISPGMRKVIEGKGMPIPKYGGYGNLVIKFTIKFP-ENHFTTE 343

Query: 434 SEITALRNILP 444
             +  L  ILP
Sbjct: 344 ENLKKLEEILP 354

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.243
           YNL064C
          Length = 409

 Score =  175 bits (444), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 122/375 (32%), Positives = 180/375 (48%), Gaps = 33/375 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YDVLGV   AT+VEI+KAYRK+ALK+HPDK   E   E     FKE ++AYE+LSD + +
Sbjct: 8   YDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSEEAAEK----FKEASSAYEVLSDADKR 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEF---DDFMNFFQQYQRQQ-HGPHASYSNRHQYGEPE 189
             YD +G       G             D F  FF     Q+  GP      +H+     
Sbjct: 64  DTYDQFGLEGLSGAGGMGGAGGGFGFGDDIFSQFFGGAGAQRPRGPQRGRDIKHE----- 118

Query: 190 SKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQ 249
                       +T  +LY GKT    L ++ LC  C G G +K   +K    C+SCNGQ
Sbjct: 119 ----------INVTLEELYRGKTSKLALNKQILCKTCEGRGGKKGAVKK----CSSCNGQ 164

Query: 250 GFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPR 309
           G K  +TR  G  + +  T CD C G G        D CK C+GK + +E K   V++  
Sbjct: 165 GIK-FVTRQMGPMIQRFQTECDVCHGAGDIV--DPKDRCKSCNGKKVASERKILEVHVDP 221

Query: 310 GSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGF 369
           G ++G +      AD       GDV+ VI+E   K H +R  ++L     + L+ A+ G 
Sbjct: 222 GMKNGQKVVFKGEADQAPDVIPGDVVFVINEKPHK-HFQRSGDNLVYEAEVDLLTAIAG- 279

Query: 370 STIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNW 429
                E      L+V +  G+VI PG      G+G P++    +G++ ++  ++FP+ ++
Sbjct: 280 GEFAIEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPVAKYGGYGNLIIKFTVKFPEPHF 339

Query: 430 FNEKSEITALRNILP 444
             E++ +  L  ILP
Sbjct: 340 TTEEN-LKKLEEILP 353

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {ON}
           YNL064C (REAL)
          Length = 410

 Score =  175 bits (444), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 122/371 (32%), Positives = 173/371 (46%), Gaps = 23/371 (6%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   AT+VEI+KAYRK ALKYHPDK   E   E     FKE ++AYEILSD E +
Sbjct: 8   YDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAEK----FKEASSAYEILSDSEKR 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRT 193
             YD +G+      G         F    + F Q+     G                +R 
Sbjct: 64  DVYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGGAGGAQRPRG---------PQRG 114

Query: 194 PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKE 253
            D +     +  +LY G+T    L ++ LC  C G G +K   +K    C+SCNGQG K 
Sbjct: 115 KDIKHEISASLEELYKGRTAKLALNKQILCKGCEGRGGKKGAVKK----CSSCNGQGIK- 169

Query: 254 RITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRH 313
            +TR  G  + +  T CD C G G        D CK C+GK + NE K   V++  G + 
Sbjct: 170 FVTRQMGPMIQRFQTECDVCHGTGDIV--DPKDRCKSCNGKKVENERKILEVHVEPGMKD 227

Query: 314 GDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIV 373
           G        AD       GDV+ ++ E   KS  +R  +DL     I L+ A+ G     
Sbjct: 228 GQRIVFKGEADQAPDVIPGDVVFLVSERPHKS-FKRDGDDLVYEAEIDLLTAIAG-GEFA 285

Query: 374 CETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEK 433
            E      L+V +  G+VI PG     +G+G P+     +G++ ++  ++FP +N F  +
Sbjct: 286 LEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKYGGYGNLIIKFTVKFP-ENHFTAE 344

Query: 434 SEITALRNILP 444
             +  L  ILP
Sbjct: 345 ENLKKLEEILP 355

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL257C
          Length = 409

 Score =  175 bits (443), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 126/373 (33%), Positives = 183/373 (49%), Gaps = 28/373 (7%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAM--FKEVTAAYEILSDPE 131
           YD+LGV  DA + +I+KAYRK ALKYHPDK        +SEA   FK++TAAYEILSD +
Sbjct: 8   YDLLGVSADANDAQIKKAYRKAALKYHPDK------NPSSEAADKFKQMTAAYEILSDSQ 61

Query: 132 LKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESK 191
            +  YD +G+     GG G            + F Q+     G  AS     Q G     
Sbjct: 62  KREVYDQFGEEGLNGGGGGPGGFGGFGGFGEDIFSQF---FGGGGASRPRGPQKGR---- 114

Query: 192 RTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGF 251
              D +     T   LY G+T    L +  LC  C G G +    +K    C+SC G G 
Sbjct: 115 ---DIKHDISCTLENLYKGRTAKLALNKTVLCKSCEGRGGKSGSVKK----CSSCGGHGV 167

Query: 252 KERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGS 311
           K  +TR  G  + +  T C+AC G+G        D C+ CSGK + NE K   V I  G 
Sbjct: 168 K-FVTRQMGPMIQRFQTTCEACNGEGDVI--DPKDRCRECSGKKISNERKILEVNIEPGM 224

Query: 312 RHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFST 371
           ++G +      AD + G+  GDV+ V++E      + R  ++LH    I L+ A+ G   
Sbjct: 225 KNGQKVVFQGEADQQPGQIPGDVVFVVNEQEHPKFV-RNGDNLHYEAQIDLLTAVAG-GQ 282

Query: 372 IVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFN 431
              E      L+V++  G+VI PG     +G+G P+    S+G++ ++ N++FPK + F 
Sbjct: 283 FALEHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKYGSYGNLLIKFNVKFPKSH-FA 341

Query: 432 EKSEITALRNILP 444
             +++  L  ILP
Sbjct: 342 SDADLKKLEEILP 354

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P25491 Saccharomyces
           cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
           envelope protein) heat shock protein
          Length = 411

 Score =  174 bits (442), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 125/378 (33%), Positives = 175/378 (46%), Gaps = 38/378 (10%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAM--FKEVTAAYEILSDPE 131
           YD+LGV  DA + +I+K YRK ALK+HPDK        ++EA   FKE+T AYE+LSD +
Sbjct: 8   YDLLGVPVDANDAQIKKGYRKQALKFHPDK------NPSAEAADKFKELTVAYEVLSDSQ 61

Query: 132 LKSRYDM-----YGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYG 186
            +  YD            G  G          D F  FF     +  GP      +H+  
Sbjct: 62  KRDIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGASRPRGPQKGRDIKHE-- 119

Query: 187 EPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSC 246
                           +  +LY G+T    L ++ LC  C G G ++   +K    C SC
Sbjct: 120 -------------MSASLEELYKGRTAKLALNKQVLCKTCEGRGGKEGAVKK----CASC 162

Query: 247 NGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVY 306
           NGQG K  ITR  G  + +    CDAC G G        D CK C+GK + NE K   V+
Sbjct: 163 NGQGVK-FITRQMGPMIQRFQAECDACNGTGDIV--DPKDRCKTCNGKKIDNERKILEVH 219

Query: 307 IPRGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDAL 366
           I  G + G +      AD   G   GDVI VI +   K H ERK ++L+    + L+ A+
Sbjct: 220 IEPGMKDGQKIVFQGEADQAPGVIPGDVIFVISQRPHK-HFERKGDNLYYQAEVDLLSAI 278

Query: 367 TGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPK 426
            G      E      L+V +  G+VI PG     +G+G P+     FGD+ V   + FP 
Sbjct: 279 AG-GEFAIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKYGGFGDLIVTFKVNFPT 337

Query: 427 DNWFNEKSEITALRNILP 444
           +++ +E+S +  L  ILP
Sbjct: 338 NHFADEES-LKKLEEILP 354

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {ON}
           complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  174 bits (441), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 129/375 (34%), Positives = 179/375 (47%), Gaps = 33/375 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDK-IIDEAERETSEAMFKEVTAAYEILSDPEL 132
           YD+LGV  +A+E EI+K YRK ALKYHPDK   DEA  +     FKE + AYE+LSD + 
Sbjct: 8   YDLLGVSPNASESEIKKGYRKAALKYHPDKNPTDEAAEK-----FKECSGAYEVLSDSQK 62

Query: 133 KSRYDMYGDSAFGSGGNGFPEDDHEF---DDFMNFFQQYQRQQHGPHASYSNRHQYGEPE 189
           +  YD YG+     GG G           D F  FF        G  AS     Q G+  
Sbjct: 63  REIYDQYGEEGLSGGGPGAGFGGFGGFGDDIFSQFF-------GGAGASRPRGPQRGK-- 113

Query: 190 SKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQ 249
                D R   + T  +LY G+T    L ++ LC  C G G ++   +K    C+SC GQ
Sbjct: 114 -----DIRHEIQNTLEELYKGRTAKLALNKQILCKGCEGRGGKEGAVKK----CSSCGGQ 164

Query: 250 GFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPR 309
           G K  +TR  G  + +  T CD C G G        D CK C G  + NE K   V++  
Sbjct: 165 GVK-FVTRQMGPMIQRFQTECDVCHGSGDII--DPKDRCKECKGNKVANERKVLEVHVEP 221

Query: 310 GSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGF 369
           G R G +      AD       GDVI V+ E   K H +R  +DL     + L+ A+ G 
Sbjct: 222 GMREGQKVTFKGEADQAPDIIPGDVIFVVTEKPHK-HFKRSGDDLLYEAEVDLLTAIAG- 279

Query: 370 STIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNW 429
                E      L+V +  G+VI PG      G+G P+     +G++ +   I+FP +N 
Sbjct: 280 GDFAIEHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPVQKYGGYGNLIITFKIKFP-ENH 338

Query: 430 FNEKSEITALRNILP 444
           F +++++ AL +ILP
Sbjct: 339 FADEAKLKALEDILP 353

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {ON}
           Anc_2.243 YNL064C
          Length = 407

 Score =  172 bits (436), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 129/375 (34%), Positives = 176/375 (46%), Gaps = 33/375 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV  +A+E EI+K YRK ALKYHPDK   E   E     FKE +AAYE+LSD + +
Sbjct: 8   YDLLGVSPNASETEIKKGYRKQALKYHPDKNPSEEAAEK----FKECSAAYEVLSDSQKR 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEF---DDFMNFFQQYQRQQ-HGPHASYSNRHQYGEPE 189
             YD YG+     GG G           D F  FF     Q+  GP      +H+     
Sbjct: 64  EVYDQYGEEGLNGGGAGGFPGGGFGFGDDIFSQFFGGAGAQRPSGPQRGRDIKHE----- 118

Query: 190 SKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQ 249
                      + T  +LY G+T    L ++ LC  C G G +    +K    CTSCNGQ
Sbjct: 119 ----------IQNTLEELYKGRTAKLALNKQILCKTCEGRGGKAGAVKK----CTSCNGQ 164

Query: 250 GFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPR 309
           G K  +TR  G  + +  T CD C G G        D CK C GK + NE K   V++  
Sbjct: 165 GIK-FVTRQMGPMIQRFQTECDVCHGSGDII--DPKDRCKDCKGKKIANERKVLEVHVEP 221

Query: 310 GSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGF 369
           G R G +      AD       GDVI V+ E   K H +R  +DL     I L+ A+ G 
Sbjct: 222 GMREGQKIVFKGEADQAPDVIPGDVIFVVVEKPHK-HFKRAGDDLLYEAEIDLLTAIAG- 279

Query: 370 STIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNW 429
                +      L+V+   G+VI  G     +G+G P+     +G++ V   I+FP++N+
Sbjct: 280 GEFAIQHVSGDWLKVSTVPGEVISSGMKKVIEGKGMPVPKYGGYGNLIVTFKIKFPENNF 339

Query: 430 FNEKSEITALRNILP 444
             E  ++  L NILP
Sbjct: 340 ATE-DKLKELENILP 353

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {ON}
           YNL064C (YDJ1) - yeast dnaJ homolog (nuclear envelope
           protein); heat shock protein [contig 5] FULL
          Length = 411

 Score =  171 bits (434), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 125/377 (33%), Positives = 174/377 (46%), Gaps = 35/377 (9%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV  DA + +I+KAYRK ALK+HPDK       E +   FKE+T AYEILSD + +
Sbjct: 8   YDLLGVSPDANDAQIKKAYRKQALKFHPDK----NPSEEAADKFKELTVAYEILSDSQKR 63

Query: 134 SRYDM-----YGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQ-HGPHASYSNRHQYGE 187
             YD            G  G          D F  FF     Q+  GP      +H+   
Sbjct: 64  DIYDQLGEEGLSGGGAGGAGGFGGFGGFGEDIFSQFFGGGGSQRPRGPQKGRDIKHE--- 120

Query: 188 PESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCN 247
                          +  +LY G+T    L ++ LC  C G G +    +K    C+SCN
Sbjct: 121 ------------MSASLEELYKGRTAKLALNKQILCKTCEGRGGKAGAVKK----CSSCN 164

Query: 248 GQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYI 307
           GQG K  ITR  G  + +    CD C G G        D CK C+GK + NE K   V+I
Sbjct: 165 GQGIK-FITRQMGPMIQRFQAECDVCSGTGDII--DPKDRCKSCNGKKIDNERKILEVHI 221

Query: 308 PRGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALT 367
             G + G +      AD   G   GDV+ VI +   K H ERK +DL     + L+ A+ 
Sbjct: 222 EPGMKDGQKIVFQGEADQAPGIIPGDVVFVISQRPHK-HFERKGDDLLYQAEVDLLSAIA 280

Query: 368 GFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKD 427
           G      E      L+V++  G+VI PG     +G+G P+     +G++ V   I FP +
Sbjct: 281 G-GEFAIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQKYGGYGNLIVTFKINFPTN 339

Query: 428 NWFNEKSEITALRNILP 444
           ++ +E+S +  L  ILP
Sbjct: 340 HFADEES-LKKLEEILP 355

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {ON}
           Anc_2.243 YNL064C
          Length = 411

 Score =  167 bits (424), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 132/392 (33%), Positives = 185/392 (47%), Gaps = 26/392 (6%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   ATE+EI+KAYRK ALKYHPDK       E +E  FKEV++AYE+LSD E +
Sbjct: 8   YDLLGVSVSATEIEIKKAYRKSALKYHPDK---NPSAEAAEK-FKEVSSAYEVLSDSEKR 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRT 193
             YD +G+     G  G            + F Q+     G                +R 
Sbjct: 64  QVYDQFGEEGLSGGAGGAGGFGGFGGYGDDIFSQFFGGAPGGGRPRG---------PQRG 114

Query: 194 PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKE 253
            D +    +T  +LY G+T    L ++ LC  C+G G ++   +K    C+SCNGQG+K 
Sbjct: 115 RDIKHEIAVTLEELYKGRTAKLALNKQILCKGCNGRGGKEGAVKK----CSSCNGQGYK- 169

Query: 254 RITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRH 313
            +TR  G  + +  T C+AC G G        D CK C+GK + NE K   V++  G + 
Sbjct: 170 FVTRQMGPMIQRFQTECEACAGTGDII--DPKDRCKSCNGKKVANERKILEVHVDPGMKD 227

Query: 314 GDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIV 373
           G +      AD       GDVI V+ E   K + +R  +DL     I L+ A+ G     
Sbjct: 228 GQKIVFKGEADQAPDVIPGDVIFVVSEKPHK-NFQRVGDDLVYEAEIDLLTAVAG-GEFS 285

Query: 374 CETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEK 433
            E      L+V +  G+VI PG     +G+G P++    +G++ V   I FP  N F   
Sbjct: 286 LEHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPIAKFGGYGNLLVTFKINFPP-NHFTSD 344

Query: 434 SEITALRNILPGLKSKDTKDPDPLNTED-VLS 464
             +  L  ILP      T  P   + ED VLS
Sbjct: 345 ENLKKLEEILP--PRAKTTIPSKAHVEDCVLS 374

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {ON}
           Anc_2.243
          Length = 411

 Score =  163 bits (413), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 119/371 (32%), Positives = 171/371 (46%), Gaps = 22/371 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A+  EI+KAYRK ALKYHPDK   E   E     FKE +AAYE+LSD E +
Sbjct: 8   YDILGVSPSASSSEIKKAYRKFALKYHPDKNPSEEAAEK----FKEASAAYEVLSDDEKR 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRT 193
             YD +G      G  G            + F Q+           +          +R 
Sbjct: 64  EMYDQFGPEGMNGGPGGPGGFGGFGGFGDDIFSQF--------FGGAGAGAGRPRGPQRG 115

Query: 194 PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKE 253
            D +     T  +LY G+T    L ++ LC  C G G +K   +K    C+SCNGQG K 
Sbjct: 116 RDIKHELSATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVKK----CSSCNGQGVK- 170

Query: 254 RITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRH 313
            +TR  G  + +    C+ C G G        D CK C+ K + NE K   V+I  G + 
Sbjct: 171 FVTRQMGPMLQRFQAECEVCHGTGDII--DPKDRCKTCNAKKVTNERKILEVHIEPGMKD 228

Query: 314 GDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIV 373
           G +      AD       GDVI V+ +   + H +R  +DL     I L+ A+ G     
Sbjct: 229 GQKVVFKGEADQAPDIIPGDVIFVVSQKPHE-HFQRAGDDLVYEAEIDLLTAIAG-GEFA 286

Query: 374 CETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEK 433
            +      L+V +  G+VI PG       +G P+     +G++ V+ NI+FP +++ +E+
Sbjct: 287 IKHVSGEWLKVAIVPGEVISPGARKIISDKGMPIPKYGGYGNLIVKFNIKFPPNHFTDEE 346

Query: 434 SEITALRNILP 444
           S +  L  ILP
Sbjct: 347 S-LKKLEEILP 356

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
           to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
           yeast dnaJ homolog (nuclear envelope protein) heat shock
           protein
          Length = 411

 Score =  162 bits (411), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 128/371 (34%), Positives = 179/371 (48%), Gaps = 23/371 (6%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD++GV   A + +I+KAYRK ALKYHPDK   E   E     FKE+++AYEILSD + +
Sbjct: 8   YDLIGVSPGADDAQIKKAYRKAALKYHPDKNPTEEAAEK----FKEISSAYEILSDSQKR 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRT 193
             YD +G+     GG G            + F Q+     G   S   R     P+  R 
Sbjct: 64  EMYDQFGEEGLNGGGAGAGGFGGFGGFGDDIFSQF---FGGAGGSSRPRG----PQKGR- 115

Query: 194 PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKE 253
            D R     T  +LY G+T    L ++ LC  C G G +    +K    C+SCNGQGFK 
Sbjct: 116 -DIRHEISATLEELYKGRTAKLALNKQILCKSCEGRGGKAGAVKK----CSSCNGQGFK- 169

Query: 254 RITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRH 313
            ITR  G  + +    CDAC G G      A D CK C+GK + NE K   V+I  G + 
Sbjct: 170 FITRQMGPMIQRFQAECDACNGTGDII--DAKDRCKACNGKKIANERKILEVHIEPGMKD 227

Query: 314 GDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIV 373
           G +      AD       GDV+ V+ E        RK +DL+    + L+ A+ G     
Sbjct: 228 GQKIVFQGEADQAPDVVPGDVVFVVSE-RPHERFNRKGDDLYYEAEVDLLTAIAG-GEFA 285

Query: 374 CETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEK 433
            +      L+V +  G+VI PG     +G+G P+     FG++ V+  I+FP  N F ++
Sbjct: 286 VQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPVQKYGGFGNLIVKFKIKFPP-NHFADE 344

Query: 434 SEITALRNILP 444
           + +  L NILP
Sbjct: 345 ASLKQLENILP 355

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {ON}
           Anc_2.243
          Length = 410

 Score =  162 bits (410), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 130/376 (34%), Positives = 174/376 (46%), Gaps = 31/376 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YDVLGV   A + EI+KAYRK ALKYHPDK   E   E     FKEV+AAYEILSD E +
Sbjct: 8   YDVLGVSPTAGDSEIKKAYRKSALKYHPDKNPTEEGAEK----FKEVSAAYEILSDSEKR 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEF-----DDFMNFFQQYQRQQHGPHASYSNRHQYGEP 188
             YD +G+     GG G P     F     D F  FF         P      R      
Sbjct: 64  EIYDQFGEEGLNGGGPGGPGGFGGFGGFGDDIFSQFFGGAGAGAGRPRGPQRGR------ 117

Query: 189 ESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNG 248
                 D +     T  +LY G+T    L ++ LC  C G G +K   +K    C+SCNG
Sbjct: 118 ------DIKHEIAATLEELYKGRTAKLALNKQILCKTCEGRGGKKGAVKK----CSSCNG 167

Query: 249 QGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIP 308
           QG K  +TR  G  + +    CD C G G        D CK C+ K + NE K   V+I 
Sbjct: 168 QGVK-FVTRQMGPMIQRFQAECDVCSGTGDII--DPKDRCKTCNAKKVTNERKILEVHIE 224

Query: 309 RGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTG 368
            G + G        AD       GDVI V+ +   K H +R  +DL     I L+ A+ G
Sbjct: 225 PGMKDGQNIVFKGEADQAPDVIPGDVIFVVAQKPHK-HFQRSGDDLVYEAEIDLLTAIAG 283

Query: 369 FSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDN 428
                 E      L+V++  G+VI PG+    +G+G P+      G++ V   ++FP+ +
Sbjct: 284 -GEFALEHVSGDWLKVSILPGEVISPGSKKVIEGKGMPIPKYGGHGNLIVHFTVKFPQKH 342

Query: 429 WFNEKSEITALRNILP 444
           + +E S +  L  ILP
Sbjct: 343 FADEDS-LKKLEEILP 357

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {ON}
           similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and weakly similar to YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 495

 Score =  159 bits (402), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 146/498 (29%), Positives = 217/498 (43%), Gaps = 78/498 (15%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+L V   ATE EI+KAYRK ALK+HPDK    AE   S  +F++++ AYE LS+   +
Sbjct: 8   YDILEVNTTATEQEIKKAYRKKALKHHPDKNNHSAE---SIKLFQDISHAYETLSNSNKR 64

Query: 134 SRYDMYGD---------------SAFGSGGNGFPEDDHEFDD-FMNFFQQ---------- 167
             YD YG                   GS GN  P   H   D F  FF            
Sbjct: 65  ELYDQYGTVDEGEISEIIAKQNMGNTGSNGNSHPFSAHTAGDLFAQFFGGRGSSGTGASG 124

Query: 168 ---YQRQQHGPHASYSNRHQY---------GEPESKRTPDSRISYKMTTRQLYMGKTVTF 215
               +   +GP  S+S+             G  E    P  R + K     L+ GK    
Sbjct: 125 FGFMRGMVNGPFQSFSHDFNMNSMADFEDDGSHEMASGPGIRHNLKCNLYDLFHGKRAKL 184

Query: 216 QLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKD-HTVCDACK 274
            L R  LC  C G G +K         C  C G G      R+  G MV+   T C  C 
Sbjct: 185 ALNRTRLCQRCQGYGGKKA------TQCRGCQGTGLFTTTKRM--GPMVQTWQTTCKECS 236

Query: 275 GKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQMAD----MEYGKE 330
           G G+Y +  + D C  CSG G I E K   V +  G R+G+E  LP  AD     EYGKE
Sbjct: 237 GTGKYIR--SKDACTECSGNGFIKERKFFDVEVLPGMRNGNEIILPGEADEVINTEYGKE 294

Query: 331 T---GDVIIVI----DEDSSK--SHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRR 381
               GDVII I    +E+S+    +L    + +     + L  +L G + I+ +      
Sbjct: 295 RVIPGDVIITIQLTRNEESNMRYKYLVHDHDLILDNFEVDLKTSLCGGTIIIEDHPSGNP 354

Query: 382 LRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFP---KDNWFNEKSEITA 438
            ++ V +G++++PG     + +G P+ +  +FG++Y++  ++FP   K +  N+ SEI  
Sbjct: 355 FKIEVLSGELLKPGCIKCVENKGMPVDSNGNFGNLYIRFRVKFPEQLKSDTINKLSEILV 414

Query: 439 L-RNILPGLKSKDTKDPDPLNTEDVLSYSVLH---SHDELPDYLAEEKEKYNRKQQEE-- 492
              NI   L          +N+ D+    VL    + D    +   +++  N+++  +  
Sbjct: 415 QDENISSILSDSINNKSYKINSSDIAEEQVLSTFTTEDLQSKFKNAKRDSPNKRKHADRD 474

Query: 493 -PH-ASAFDNDYTQMPSE 508
            PH  + +D DY   P+E
Sbjct: 475 GPHYNTTYDYDYN--PTE 490

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.218
           YNL077W
          Length = 462

 Score =  155 bits (391), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 135/449 (30%), Positives = 203/449 (45%), Gaps = 47/449 (10%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YDVL V  +A+ VEIRKAYR LALK+HPDK       E S++ F EV  AYEIL D + +
Sbjct: 8   YDVLNVSPEASAVEIRKAYRLLALKHHPDK---NNHSEESKSKFLEVNEAYEILIDEKKR 64

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPH----ASYSNRH---QYG 186
           S YD YG     +     P++D     F N                 AS+ ++     +G
Sbjct: 65  SLYDQYGTIDENAIQQSMPQEDPVMSSFFNTGSPMGMGMGMSAGDLFASFFDKMSSPSFG 124

Query: 187 EPESKRT----PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEIS 242
             ++K++    PD +   K T   LY GK     L R+ +C  C G G  K        +
Sbjct: 125 GKKTKKSMDHGPDIKHDLKCTLSSLYEGKNTKLGLNRRRVCKACKGRGSMKVR------T 178

Query: 243 CTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKS 302
           C +C G+G + R +R  G  M      C  C G G + K   SD C+ C G+G I E K 
Sbjct: 179 CKACRGRGQQSR-SRQMGPMMQTWTQTCSDCNGMGTFTKD--SDVCRDCEGEGCIRERKI 235

Query: 303 QTVYIPRGSRHGDEFRLPQMAD----MEYGKET---GDVIIVIDE--DSSKSHLERKSND 353
             V +  G   G +  LP  AD      +G ET   GDVII I +  D     + R   D
Sbjct: 236 FDVEVKPGMCQGQQIILPGEADEVIKTRFGNETVIPGDVIITIIQIKDPKFQRVNRNGCD 295

Query: 354 LHT-TLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPL----S 408
           L      I LV +L G    +    + + + V +  G++I+P ++   +  G P      
Sbjct: 296 LMVRNCKIPLVTSLCGGKLSIDGHPNGKLINVTILPGELIKPNHFKSIENLGMPRYEEKR 355

Query: 409 NGDSFGDMYVQINIEFPKDNWFNEKSEITALRNIL---PGLKSKDTKDPDPL--NTEDVL 463
             + +G++Y+Q  +EFP +   +E   +T L+ +L   P +K + T +   +    +D +
Sbjct: 356 APEGYGNLYIQFQVEFP-ETLASET--VTKLKQVLDEDPNVKKQVTAEDKDVCERVDDCI 412

Query: 464 SYSVLHSHDELPDY--LAEEKEKYNRKQQ 490
                   + LPD+  L   +E  NR ++
Sbjct: 413 EMEEHVLSNLLPDFDDLMRNEETGNRSKK 441

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 462

 Score =  154 bits (388), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 123/409 (30%), Positives = 187/409 (45%), Gaps = 61/409 (14%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A+  +I+KAYR  ALK+HPDK       E S+  F+++  AYEIL D   +
Sbjct: 10  YDILGVSASASRQDIKKAYRVNALKHHPDK---NGHSEESKLKFQQICKAYEILKDERKR 66

Query: 134 SRYDMYG---------------DSAFGSGGNGFPE-------DDHEFDDFMNFFQQYQRQ 171
             YD +G               + +  S G+ F +           F+D M+FF + Q  
Sbjct: 67  EMYDRFGTADESQWHTESTSYQEQSGMSAGDLFAQFFGGGSTTGSFFNDDMSFFGKRQ-- 124

Query: 172 QHGPHASYSNRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGL 231
             G H + S R      E  R PD +   K T  ++Y GK     LKR  LC  C G G 
Sbjct: 125 --GAHTAPSRR------ELPRGPDIKHYLKCTLEEVYHGKRAKLALKRTRLCKKCKGEGG 176

Query: 232 RKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKD-HTVCDACKGKGRYRKKSASDTCKH 290
            K         C +C G+G +    R   G MV+   + C  C G+G + K+   D C+ 
Sbjct: 177 LKAS------QCYTCGGRGIRTETKRH--GPMVQTWSSTCSDCAGRGSFMKQ--KDICRD 226

Query: 291 CSGKGLINEEKSQTVYIPRGSRHGDEFRLPQMADMEYGKET-------GDVIIVIDEDSS 343
           C+G+G I E +   + + +G  +G E  LP  AD   G E        GDVII++++   
Sbjct: 227 CNGQGCIRERRIFDIEVHKGMENGQEVVLPGEADEVVGSELGSEHVIPGDVIIILEQLPH 286

Query: 344 KSHLERKSNDLHTT-LNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKG 402
           K+    +   L      + L  +L G    V      + L+++V  G++++PG     +G
Sbjct: 287 KAFWRHRDASLVLDHCKVDLKTSLCGGPVWVDSHPSGKLLKIDVLPGEILKPGAIKCVEG 346

Query: 403 EGWPLSNGDSFGDMYVQINIEFPKDNWFNEKSEITALRNIL---PGLKS 448
            G P S G  FG++Y++ ++ FP+     +   + ALR  L   PG  S
Sbjct: 347 MGMPKSGG-RFGNLYIRFDVAFPES---LKPETVEALRAALGQEPGANS 391

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {ON}
           similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
           family overexpression interferes with propagation of the
           [Psi ] prion
          Length = 461

 Score =  150 bits (379), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 135/482 (28%), Positives = 194/482 (40%), Gaps = 75/482 (15%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD L +  DAT  EI+KAYR  ALK HPDK       E S+  F+E+  AYEIL D + K
Sbjct: 10  YDTLNISVDATPQEIKKAYRLAALKSHPDK---NNHSEDSKRKFQEICKAYEILGDAKKK 66

Query: 134 SRYDMYGD---------------------------SAFGSGGNGFPEDDHEFDDFMNFFQ 166
             YD YG                            S F  GG+         DD M F  
Sbjct: 67  LLYDRYGTVDESVIQEQQQEGVYYGSSGMSAGDLFSQFFGGGSTTSASSFFNDDTMFFTG 126

Query: 167 QYQRQQHGPHASYSNRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHC 226
           +   Q+                   R PD + + + +  +LY GK    +L R  LC  C
Sbjct: 127 KKNSQRR----------------VSRGPDIKHNLRCSLEELYHGKKSKLRLDRTRLCKTC 170

Query: 227 SGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASD 286
            G G           +C +CNGQGF  + TR  G  +    T C  C G G + ++   D
Sbjct: 171 KGNG------GTSSSACRACNGQGFYTQ-TRRHGPMVQTWSTTCQDCGGSGTFVRR--KD 221

Query: 287 TCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQMAD----MEYGKET---GDVIIVID 339
            C  C G+G I E K   + +  G  HG E  LP+ AD      YGKE    GDVII++ 
Sbjct: 222 VCSECKGQGCIKERKIFEIEVQPGMHHGQEIVLPEEADEIVYTTYGKEQVNPGDVIIIVQ 281

Query: 340 EDSSKSHLERKSNDLHTTLN---ISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGN 396
           +   K  L +  ND    +N   + L  +L G   ++        L++ V  G++++PG 
Sbjct: 282 Q--VKHPLFQIHNDTDLVMNDCHVDLKTSLCGGEVLIENHPCGSALKIEVLPGEILKPGC 339

Query: 397 YFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEKSEITAL----RNILPGLKSKDTK 452
               +  G P      FG++Y++  ++FP        ++++ L     N L   +  +  
Sbjct: 340 VKCVESMGMPHPQSQGFGNLYIRFQVDFPDKLQLETINKVSELLGKDENCLSLQEKVELP 399

Query: 453 DPDPLNTEDVLSYSVL---HSHDELPDYLAEEKEKYNRKQQEEPHASAFDNDYTQMPSEC 509
           +  P+  E VLS  V    H       Y A      NRK+      +  D +  Q    C
Sbjct: 400 EGTPVE-EHVLSNFVPEFDHEKSRKRSYSASNAANKNRKKHRSDETADSDQEELQEGENC 458

Query: 510 AT 511
             
Sbjct: 459 TV 460

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score =  144 bits (362), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 107/363 (29%), Positives = 165/363 (45%), Gaps = 21/363 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y +LG+ K+A+E  I+ AYR+L+ KYHPDK       E +   F E+  AYE+LSDPE +
Sbjct: 31  YKILGIPKEASEKAIKSAYRQLSKKYHPDK---NQNDEEAHNHFIEIGEAYEVLSDPEKR 87

Query: 134 SRYDMYGDSAFGS-----GGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEP 188
             YD +G  AF +     GG G P     F D  + F Q      G    +      G  
Sbjct: 88  RTYDQFGSDAFQNGGQGQGGPGGPGGPGGFHDPFDLFNQMFGGNKGNFGGFGGFGGGGFA 147

Query: 189 ESKR--TPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSC 246
           + +R      +++Y ++ R+ + G  V FQ+  K  C HC G+G       K    C  C
Sbjct: 148 DDRRRKAQSIQVTYPLSLREYFTGANVNFQMDFKDTCDHCKGSGSEDGKVDK----CKEC 203

Query: 247 NGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVY 306
            G GF  ++ R+ G    + HT C  C G G     +  + CK C G+ L+ + K   V 
Sbjct: 204 GGNGFVVQVIRM-GPVTQQMHTQCPKCHGAG----STIKNHCKKCHGQKLVTKSKEINVK 258

Query: 307 IPRGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKS-HLERKSNDLHTTLNISLVDA 365
           +P G+       +    D E   E GD+++   E +  +    R+ NDL  T  +   DA
Sbjct: 259 VPAGAPRDFLKIVENGGDKELNAEAGDLLVQFQEIAQNNLGYRRRGNDLFRTEALVFKDA 318

Query: 366 LTGFSTIVCETYDNRR-LRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEF 424
           + G        +D +R ++++   G  +      K  G G P+   D FGD+Y+   I  
Sbjct: 319 MEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGMPIQGSDRFGDLYIDYVIIV 378

Query: 425 PKD 427
           P++
Sbjct: 379 PQN 381

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score =  144 bits (364), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 117/402 (29%), Positives = 183/402 (45%), Gaps = 41/402 (10%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YDVLGV+   +  E++K+Y+  AL+YHPDK       E S+  F+++  AY +L D  L+
Sbjct: 8   YDVLGVQPGVSAAELKKSYKLAALRYHPDK---NGHSEASKQRFQQIADAYRVLGDERLR 64

Query: 134 SRYDMYGDSAFGS-GGNGFPEDDHE-----FDDFMNFFQQYQRQQHGPHASYSNRHQYGE 187
             YD YG    G        E  H       D F +FF   Q        S++   + G 
Sbjct: 65  KIYDRYGTVDEGEVAAMAAAERRHAGGITPGDLFAHFFGDGQGL-----GSFAIFGESGA 119

Query: 188 PESK-----RTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEIS 242
             ++     R PD +   + T  +LY GK V   L R  LC  C+G G  +        +
Sbjct: 120 SSARCSRVSRGPDIKHKLRCTLEELYGGKVVRLALTRTRLCTLCAGRGGSRAS------T 173

Query: 243 CTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKS 302
           CT+C+GQG   + T+  G  +    + C  C G G   K    DTC  C G G + E K 
Sbjct: 174 CTACSGQGICSQ-TKRQGSLVQTWSSTCRVCSGSGTIVKD--CDTCTSCGGAGYLRERKV 230

Query: 303 QTVYIPRGSRHGDEFRLPQMAD----MEYGKET---GDVIIVIDEDSSKSHLERK--SND 353
             V I  G R G E   P  AD      YGKE    GD+ I I+E +  +  + +  +N 
Sbjct: 231 FEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEATPATRYQCRGDANL 290

Query: 354 LHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDS- 412
           L T L++ L  +L G +  + +    + +++ +  G+++ PG     +  G P  +  S 
Sbjct: 291 LLTELHVDLRTSLCGGTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLGMPHPDDPSQ 350

Query: 413 FGDMYVQINIEFPKDNWFNEKSEITALRNILPGLKSKDTKDP 454
           +G ++++ +++FPK       S ITA+   L    +  T+ P
Sbjct: 351 YGHLFIKFHVDFPKT---LADSTITAIAQALDADTNVRTRTP 389

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {ON}
           YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score =  144 bits (363), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 122/425 (28%), Positives = 194/425 (45%), Gaps = 58/425 (13%)

Query: 62  NSNVNYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVT 121
            S +N D+    YD LGV  +A+  EI+KAYR  ALK+HPDK       E S+  F+++ 
Sbjct: 2   GSAMNNDL----YDTLGVAANASRQEIKKAYRLKALKHHPDK---NGHSEQSKLKFQQIC 54

Query: 122 AAYEILSDPELKSRYDMYGDS---------------AFGSGGNGFPE-------DDHEFD 159
            AYEIL D + +  YD +G +               +  S G+ F +           F 
Sbjct: 55  KAYEILGDDKKREMYDRFGTADETQWHTEATNYEEPSGMSAGDLFSQFFGGGSTTGGFFS 114

Query: 160 DFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKR 219
           + M+FF        G  A  S R        +R PD +   K T  ++Y GK     LKR
Sbjct: 115 EGMDFFG----SSRGFRAQGSRRS-----APQRGPDIKHYLKCTLEEMYNGKRAKLALKR 165

Query: 220 KCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRY 279
             LC  C G G +K        SC +C G+G + + T+  G  M    + C  C G G  
Sbjct: 166 TRLCQTCQGEGSKK------ATSCYACRGKGMQTQ-TKRQGPIMQTWSSTCGTCGGSGTI 218

Query: 280 RKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQMAD----MEYGKE---TG 332
            K   SD C  C G+G + E K   + + +G  +G    +P  AD     +YG E    G
Sbjct: 219 VK--PSDICNGCHGQGWVRERKIFEIEVQKGMENGQTVVVPAEADEVVISKYGSERVIPG 276

Query: 333 DVIIVIDEDSSKSHLER--KSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGK 390
           DVII++++   +S L+R   S+ L +   + L  +L G +  V      + L+++V  G+
Sbjct: 277 DVIIILEQLPHRS-LKRGHDSSLLLSECQVDLKTSLCGGTVWVDSHPSGKVLKIDVIPGE 335

Query: 391 VIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEKSEITALRNILPGLKSKD 450
           +++PG     +  G P S G  +GD++++  + FP +   +    + A  +  P +++  
Sbjct: 336 LLKPGAIKCVQSMGMPKSKG-GYGDLFIKFKVIFPDNLKPDTIQTMQAALDKEPSMQTSA 394

Query: 451 TKDPD 455
           T  P+
Sbjct: 395 TTQPE 399

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score =  141 bits (356), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 108/362 (29%), Positives = 173/362 (47%), Gaps = 19/362 (5%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
           +AQ  Y +LG+ KDA++ +++ AYR+L+ KYHPDK       E++   F EV  AYE+LS
Sbjct: 16  LAQDYYSILGLNKDASDKDVKSAYRQLSKKYHPDK---NPGDESAHQRFIEVGEAYEVLS 72

Query: 129 DPELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEP 188
           DPE +  +D YG     +G  G       F  F + F  +++  +           +G  
Sbjct: 73  DPEKRGIFDQYGADGLKNGAGGGGGPGGGFGGFHDPFDIFEQMFNRGGGGGGFGGGFGGM 132

Query: 189 ESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNG 248
              + P  R+  +++ +  Y G  V F+L    +C HC G+G      +    +C  C G
Sbjct: 133 HRGKGPSLRVHEELSLKDYYSGTGVEFELMLNDICDHCEGSGSEDGKVE----TCPDCGG 188

Query: 249 QGFKERITRLAGGYMV-KDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYI 307
           QG   +I R+  G M  +    C  C G+G   K    + CK C G  ++ + KS  V +
Sbjct: 189 QGILIQIIRM--GIMTQRIQQPCGRCSGRGHIIK----NQCKACGGHKVVKKPKSFQVEV 242

Query: 308 PRGS-RHGDEFRLPQMADMEYGKETGDVIIVIDE-DSSKSHLERKSNDLHTTLNISLVDA 365
           P G+ R   E R  Q AD     E GD+ +   E D +     R+ + L  T  +S  +A
Sbjct: 243 PAGAPRDHVEVR-HQEADQSTDMEAGDIFVEFTESDKNNMGYRRRGDHLFRTEVLSAREA 301

Query: 366 LTGFSTIVCETYDN-RRLRVNVPAGKVIRPGNYFKFKGEGWPL-SNGDSFGDMYVQINIE 423
           L G  +   E  D+ +++++  P G ++  G   +  G G P  S+G SFGD++V+  + 
Sbjct: 302 LAGGWSREIEFLDDAKKVKLQRPKGNIVHHGEIEQIPGFGMPKGSSGKSFGDLFVEYAVV 361

Query: 424 FP 425
            P
Sbjct: 362 MP 363

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score =  136 bits (343), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 112/379 (29%), Positives = 178/379 (46%), Gaps = 38/379 (10%)

Query: 70  AQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSD 129
           AQ  Y +LG+ KDAT+ EI+ AYR+L+ K+HPDK       E +   F EV  AYE+LSD
Sbjct: 19  AQDYYQILGIAKDATDKEIKSAYRQLSKKFHPDK---NPGNEDAHQKFIEVGEAYEVLSD 75

Query: 130 PELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPE 189
           P+ +  +D +G  A  +GG G P    +F D  + F+Q    Q G    +  + Q     
Sbjct: 76  PQKRQTFDQFGADAVKNGGQGQPGGGAQFHDPFDIFEQMFGGQGGGGNPFGGQRQ----- 130

Query: 190 SKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQ 249
             R P+     +++ +  Y G  + F L    LC HC GTG            C  C G+
Sbjct: 131 KPRGPNIMAREEISLKDYYTGYELNFTLNVNDLCDHCHGTGSDDGKL----TPCPDCQGR 186

Query: 250 GFKERITRLAGGYMVKD-HTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIP 308
           G   ++ R+  G M +    +C  C GKG+  KK     C+ C G  ++ ++K   V +P
Sbjct: 187 GVIIQLIRM--GMMTQQIQQMCGRCGGKGQLFKKQ----CRKCHGNKVMPQKKEFQVKLP 240

Query: 309 RGS-------RHGDEFRLPQMADMEYGKETGDVIIVIDE-DSSKSHLERKSNDLHTTLNI 360
           +G+       +HG+  + P +       E GD++I  +E D S     R+  +L+ T  +
Sbjct: 241 KGAKRHYMDVKHGEADKNPDL-------EAGDLLIEFNENDKSNMGYRRRGQNLYRTEVL 293

Query: 361 SLVDALTGFSTIVCETYD-NRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNG--DSFGDMY 417
           ++ +AL G         D  ++L+V   +  V+  G   +  G G P   G  ++FGD++
Sbjct: 294 NVTEALYGGWQREIPFLDPKKKLQVGRESNIVVSHGEVERIPGFGMPTGKGKKETFGDLF 353

Query: 418 VQINIEFPKDNWFNEKSEI 436
           +   +  PK  W    S I
Sbjct: 354 IDYVVIMPK-QWNKVSSSI 371

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
           {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
           YNL077w
          Length = 479

 Score =  137 bits (346), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 124/433 (28%), Positives = 187/433 (43%), Gaps = 74/433 (17%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+L VE DA++V I+KA+   AL+ HPDK       E S+  F+E++ AYE+LSDP+ +
Sbjct: 8   YDLLNVECDASQVTIKKAFHAAALRCHPDK---NNHSEESKKQFQEISKAYEVLSDPKSR 64

Query: 134 SRYDMYGDS---------------AFGSGGNGFPEDDHEF-----DDFMNFFQQYQRQQH 173
             YD YG +               +F SGGN      H F     D F  FF        
Sbjct: 65  EMYDRYGTTDESAIASQEPFGEGMSFYSGGNPM----HMFGTSAGDLFAQFFN--SSGDA 118

Query: 174 GPHASYSNR----------HQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLC 223
           GP   + +R          H   +   +  PD +   K     LY GK     L R  +C
Sbjct: 119 GPSFGFGSRFDGFGNSAQAHGARDGHMRTGPDIKHYLKCNLSDLYQGKKTKLGLNRMRVC 178

Query: 224 PHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKS 283
             C G G  +        SC +C GQG   + TR  G  +    + C++C G G + K  
Sbjct: 179 SSCDGKGGMRV------ASCRTCKGQGEVVK-TRRVGPMVQTMSSTCNSCHGTGTFIKD- 230

Query: 284 ASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQMAD----MEYG---KETGDVII 336
            SD C  C G G+  E K   V +  G  H     LP  AD      +G    + GDV+I
Sbjct: 231 -SDLCFVCKGSGVSKERKIFDVEVKAGMTHNQVIVLPGEADEVIETSHGLIKVQPGDVVI 289

Query: 337 VIDEDSSKSHLERKSNDLHT-TLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPG 395
           VID   +        +DL      + L   L G   ++      + +++++   ++++P 
Sbjct: 290 VIDLVKNTQFQVVNDHDLVLKNCEVPLKTCLCGGEIMIEGHPSGKIIKLSIIPNELLKPS 349

Query: 396 NYFKFKGEGWP--LSNG----------DSFGDMYVQINIEFPKDNWFNEKSEITALRNIL 443
            +   +G G P  ++N           D +G++YVQ  ++FP+     E + IT L+ IL
Sbjct: 350 CFKTVEGLGMPKVIANSDHANIAGTDIDGYGNLYVQFQVKFPER---LEDTTITKLQEIL 406

Query: 444 ---PGLKSKDTKD 453
              P +K +D  D
Sbjct: 407 EQDPNVKKEDESD 419

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {ON}
           Anc_2.218 YNL077W
          Length = 460

 Score =  135 bits (340), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 118/386 (30%), Positives = 175/386 (45%), Gaps = 44/386 (11%)

Query: 71  QTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDP 130
           ++ YDVLGV  DA++ EI+KAYRKLAL+YHPDK  +  + +  EA F++++ AY +L D 
Sbjct: 2   ESLYDVLGVASDASQSEIKKAYRKLALRYHPDK--NNGDEKCHEA-FQKISHAYGVLGDV 58

Query: 131 ELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPES 190
             + RYD  GD       +  P   +  D F +FF        G + S S+         
Sbjct: 59  AQRQRYDQSGD----ENESLQPTGSNAADLFSSFF-----NGGGVYPSGSSGGPGPSRGP 109

Query: 191 KRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQG 250
            R P+     K T + LY GK +   L+R   C  CS               C+SCNG G
Sbjct: 110 SRGPNIIHELKCTLQDLYRGKVIKLALRRTAPCERCSLGAAN---------VCSSCNGSG 160

Query: 251 FKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRG 310
              RI R+ G       + C+AC+G+GR      S  C  C G   +NE     V++  G
Sbjct: 161 NITRIERV-GPLTQTWSSTCNACQGQGRM-----SVDCSQCGGAQYLNERVVFKVHVKPG 214

Query: 311 SRHGDEFRLPQMADM----EYG----KETGDVIIVI----DEDSSKSHLERKSNDLHTTL 358
              G    L   AD       G     E+GDV+IVI    D    +S L ++ N     +
Sbjct: 215 MHDGQTIVLDGEADQCVRDRLGHLTVAESGDVVIVIRELADAKFKRSALNKRENLFVDQV 274

Query: 359 NISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFK-FKGEGWPLSNGDSFGDMY 417
            + L  ALTG + ++ +      +++N+  G+ + P N  K  +G G P+ +    GD+Y
Sbjct: 275 KVDLTTALTGGNVLLEDHPSGNLMKINILPGEFL-PENCIKCVEGLGMPIDDTGQRGDLY 333

Query: 418 VQINIEFPKDNWFNEKSEITALRNIL 443
           ++     P      E   I  LR +L
Sbjct: 334 IRFCTHSPLQ---LEPETIDKLREVL 356

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
           (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score =  136 bits (342), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 115/415 (27%), Positives = 181/415 (43%), Gaps = 71/415 (17%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
           M+   YD+L +  +A   +I+KAYR LALKYHPDK       E S+ MF++++ AYE+L 
Sbjct: 3   MSSELYDILNISSNADAKDIKKAYRVLALKYHPDK---NNHSEESKVMFQKISEAYEVLI 59

Query: 129 DPELKSRYDMYG----------------------------DSAFGSGGNGFPED--DHEF 158
           D E +  YD YG                               FG+    F  D      
Sbjct: 60  DVEKRKLYDQYGTVDESVIEQMKERKRKSEFMQQRQGMYPSDPFGNVNPLFGSDLAASAG 119

Query: 159 DDFMNFFQQYQRQ--QHGPHAS----YSNRHQYGE----PESKRTPDSRISYKMTTRQLY 208
           D F  FF    +   +  P  +    +SN +   E     E +R PD + + + + + LY
Sbjct: 120 DLFAQFFGNSNKNSSRFNPFGNMKPNFSNFNNTFENTASVELERGPDIKHTLRCSLKDLY 179

Query: 209 MGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHT 268
            GK    +L R  LC  C G G  KK        C +CNG G   +  R+  G M++  +
Sbjct: 180 YGKKTKLRLDRTRLCVLCMGQGSMKKS------KCFTCNGLGSLTQTRRM--GPMIQTFS 231

Query: 269 -VCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQMAD--- 324
             C  C+G G + K+S  DTC+ CSG G + E K   V I  G  +G    LP  AD   
Sbjct: 232 QSCPDCQGSGMFVKRS--DTCQSCSGNGYVEERKIFDVEIQPGMVNGQVIILPGEADEVV 289

Query: 325 -MEYGKE---TGDVIIVIDE-DSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDN 379
              +GK+    GD+++ I++   +   +    + L    +++L  AL G +  +      
Sbjct: 290 NTSFGKQKVIAGDIVLTINQLKDNNFEVINDCDLLLDNFSVNLSKALCGGTIFISNHPSG 349

Query: 380 RRLRVNVPAGKVIRPGNYFKFKGEGWPLSN---------GDSFGDMYVQINIEFP 425
             +++++  G+++ PG        G P              S G++YV+ +I+FP
Sbjct: 350 NLIKIDIIPGEILSPGVIKTVANLGMPKEEKRDPDVSIINISKGNLYVKFDIKFP 404

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
           (REAL)
          Length = 532

 Score =  134 bits (336), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 113/423 (26%), Positives = 170/423 (40%), Gaps = 84/423 (19%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD L V   A+  EI+KAYR  ALKYHPDK       E S+  F+E+  AYE L D  L+
Sbjct: 8   YDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYETLKDNHLR 64

Query: 134 SRYDMYG----------------------------DSAFGSGGNGFPEDDHEFDDFMNFF 165
           S YD YG                             + FG+GG  FP D    D F  FF
Sbjct: 65  SLYDQYGTTDEVLIQEQQAQTQSQRQRQQASVFSPSAGFGTGGMSFP-DLSPGDLFAQFF 123

Query: 166 QQYQRQQHG------------------PHASYSNRHQYGEPESK-----------RTPDS 196
                                      P  S    +    P S+           R PD 
Sbjct: 124 NSSASASSNGSKDNFNFSFDGSTTPNFPFGSGGGMNNLYSPPSRYNSEGEGRHLNRGPDI 183

Query: 197 RISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERIT 256
           + + K T ++LYMGKT    L R  +C  C G G  KK+      +C +C GQG + +  
Sbjct: 184 KHNLKCTLKELYMGKTAKLGLNRTRICQVCDGHGGLKKY------ACKTCKGQGVQTQTN 237

Query: 257 RLAGGYMVKDHT-VCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRHGD 315
           R+  G +V+  +  C  C G G + +  + D C+ C G G + + K   V +  GS H  
Sbjct: 238 RM--GPLVQSWSQTCADCGGAGIFVE--SKDICQQCQGLGFVKQRKILQVAVQPGSCHNQ 293

Query: 316 EFRLPQMADMEYGKETGD---------VIIVIDEDSSKSHLERKSNDLHTTLNISLVDAL 366
              L    D     + G          VI ++     +  +    N ++    + L+ +L
Sbjct: 294 LIVLTGEGDEVISSKGGGHEKIIPGDVVITILRLKDPRFQIVDDYNLIYKKCKVDLMTSL 353

Query: 367 TGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWP-LSNG--DSFGDMYVQINIE 423
            G    +      + +++++  G+V++PG +   +  G P   NG    FG MYV+  + 
Sbjct: 354 CGGVVYIEGHPSGKLIKLDIIPGEVLKPGCFKTVENMGMPKFINGVRSGFGHMYVKFEVT 413

Query: 424 FPK 426
           +P+
Sbjct: 414 YPR 416

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
           {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
           CAGL0J10296g and some similarites with YNL077W
           uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
           Putative chaperone of the HSP40 (DNAJ) family
           overexpression interferes with propagation of the [Psi ]
           prion
          Length = 491

 Score =  133 bits (334), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 122/409 (29%), Positives = 172/409 (42%), Gaps = 77/409 (18%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD L V  DAT  EI++AY+ +ALKYHPDK       E ++  F+EV  AYEIL+D + +
Sbjct: 8   YDTLKVSPDATISEIKRAYKVMALKYHPDK---NHHSEDAKNKFQEVCKAYEILADEDKR 64

Query: 134 SRYDMYG-------------DSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYS 180
             YD YG               A  +  + F       D F  FF  +      P  S  
Sbjct: 65  VMYDRYGTVDEYALQEQEESQGAPTTSSSFFGSSMSPGDLFAQFFDNF------PGHSSF 118

Query: 181 NRHQYGEPES-------------------------------KRTPDSRISYKMTTRQLYM 209
            R  +G                                    R PD + + K T  +LY 
Sbjct: 119 GRSPFGSAFGGGSPFGGGFPFGSSFSHHSGGGRSSYGGGRPSRGPDIKHNLKCTLAELYD 178

Query: 210 GKTVTFQLKRKCLCPHCSGTG-LRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHT 268
           GK     L R+ +C  C G G LR++       +C +C GQG +    R   G MV+  T
Sbjct: 179 GKITKLGLNRRRMCQSCQGQGSLRRR-------TCKTCRGQGQQTETRRT--GPMVQTWT 229

Query: 269 -VCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQMAD--- 324
             C  C G G Y K+  +D C  C G+  I E K   V + +G  HG    LP  AD   
Sbjct: 230 QTCPDCNGLGTYTKQ--ADVCHECRGESYIKERKIFDVEVSKGMCHGQTIVLPGEADELI 287

Query: 325 -MEYGKET---GDVIIVIDE--DSSKSHLERKSNDL-HTTLNISLVDALTGFSTIVCETY 377
              +G E    GDV+I ID+  DS    + R   DL   + +I L  +L G    +    
Sbjct: 288 KTSFGVEKVIPGDVVITIDQVKDSKFHRVNRYGCDLVMGSCSIDLSTSLCGGDIYIDGHP 347

Query: 378 DNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSF-GDMYVQINIEFP 425
             + L+V++  G++I P      +G G P    D   G++Y+Q  +E+P
Sbjct: 348 SGKLLKVSIVPGELIGPNCLKSIEGMGMPKYGHDGGKGNLYIQFQLEYP 396

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {ON}
           Anc_8.730 YMR214W
          Length = 373

 Score =  130 bits (327), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 108/364 (29%), Positives = 174/364 (47%), Gaps = 27/364 (7%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
           +AQ  Y +LG+ KDA++ EI+ +YR+L+ K+HPDK       E +   F E+  AYE+LS
Sbjct: 18  LAQDYYAILGLNKDASDKEIKSSYRQLSKKFHPDK---NPGDEEAHHKFIEIGEAYEVLS 74

Query: 129 DPELKSRYDMYGDSAF-GSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGE 187
           DPE +  +D YG  A    G  G       F+D  + F+Q   +  G       R Q   
Sbjct: 75  DPEKRKIFDQYGADALKNGGPGGPGGGGGGFNDPFDIFEQMFNRGGGGGGGGFGRMQ--- 131

Query: 188 PESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCN 247
               R  + ++  +++ ++ Y G T+ F L    +C HC GTG       K    C+ C 
Sbjct: 132 --RPRGHNLKVREQLSLKEYYTGATLEFTLALNDICDHCDGTGSADGKVAK----CSDCQ 185

Query: 248 GQGFKERITRLAGGYMVKD-HTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVY 306
           G+G   ++ R+  G M +    +C  C GKG   K    + CK C G  ++ ++K   V 
Sbjct: 186 GRGVVIQVIRM--GMMTQQIQQMCGRCGGKGSVIK----NHCKTCHGSKVVKKQKPFHVE 239

Query: 307 IPRG-SRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKS-HLERKSNDLHTTLNISLVD 364
           +P G +RH  E R  + +D     + GDV I  +E ++ +    R+   L+ T  +S  +
Sbjct: 240 VPPGAARHYTETRSGE-SDKGADFDAGDVFIEFNEKTTNNLGYRRRGPHLYRTEVLSARE 298

Query: 365 ALTGFSTIVCETYDNRRLRVNVPAGK--VIRPGNYFKFKGEGWPLSNGD-SFGDMYVQIN 421
           AL G      E  D ++ +V +   K  V+  G   +  G G P  NG  +FGD++++  
Sbjct: 299 ALKGDWQREVEFLDEKK-KVKIARAKNVVVHNGEVERIPGFGMPQPNGKHAFGDLFIEYV 357

Query: 422 IEFP 425
           +  P
Sbjct: 358 VVMP 361

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
           several homologs of bacterial chaperone DnaJ, located in
           the ER lumen where it cooperates with Kar2p to mediate
           maturation of proteins
          Length = 377

 Score =  130 bits (327), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 108/362 (29%), Positives = 171/362 (47%), Gaps = 23/362 (6%)

Query: 70  AQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSD 129
           AQ  Y +L ++KDATE EI+ AYR+L+ KYHPDK    A  E +   F EV  AY++LSD
Sbjct: 21  AQDYYAILEIDKDATEKEIKSAYRQLSKKYHPDK---NAGSEEAHQKFIEVGEAYDVLSD 77

Query: 130 PELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPE 189
           PE K  YD +G  A  +GG G          F + F  ++R              +G+ +
Sbjct: 78  PEKKKIYDQFGADAVKNGGGGGGPGGPGAGGFHDPFDIFERMFQ--GGHGGPGGGFGQRQ 135

Query: 190 SKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQ 249
            +R P  ++  K++ +Q Y G ++ F L     C  C G+G       +    C  C G+
Sbjct: 136 RQRGPMIKVQEKLSLKQFYSGSSIEFTLNLNDECDACHGSGSADGKLAQ----CPDCQGR 191

Query: 250 GFKERITRLAGGYMVKD-HTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIP 308
           G   ++ R+  G M +    +C  C G G+  K    + CK C GK +  + K   V +P
Sbjct: 192 GVIIQVLRM--GIMTQQIQQMCGRCGGTGQIIK----NECKTCHGKKVTKKNKFFHVDVP 245

Query: 309 RGSRHGDEFRLPQMADMEYGK--ETGDVIIVIDE-DSSKSHLERKSNDLHTTLNISLVDA 365
            G+     +   ++ + E G   + GD++I   E D+      R+ ++L+ T  +S  +A
Sbjct: 246 PGAPR--NYMDTRVGEAEKGPDFDAGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSAAEA 303

Query: 366 LTGFSTIVCETYD-NRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEF 424
           L G      E  D N+ ++++ PA  V+  G     KG G P      +GD+Y+   +  
Sbjct: 304 LYGGWQRTIEFLDENKPVKLSRPAHVVVSNGEVEVVKGFGMP-KGSKGYGDLYIDYVVVM 362

Query: 425 PK 426
           PK
Sbjct: 363 PK 364

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214w SCJ1
          Length = 361

 Score =  128 bits (321), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 101/372 (27%), Positives = 180/372 (48%), Gaps = 43/372 (11%)

Query: 65  VNYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAY 124
           + + ++Q  Y +LG+ KDA++ EI+ AYR+L+ KYHPDK       E +   F EV  AY
Sbjct: 13  IQHVLSQDYYAILGLSKDASDKEIKSAYRQLSKKYHPDK---NPGDEEAHHKFIEVGEAY 69

Query: 125 EILSDPELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQ 184
           +IL DPE +  YD++G  AF +   G  +    F D  + F+Q   +Q G          
Sbjct: 70  DILGDPEKRKTYDVHGADAFKN--GGQGQRGGGFHDPFDMFEQMFGRQGG---------- 117

Query: 185 YGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCT 244
            G  +++R+ + ++  +++ ++ Y G  V F++    +C  C G+G      +     C 
Sbjct: 118 -GFRQTQRSQNYQVRNQVSLKEFYSGGEVEFEIPLNDICDSCHGSGSADGKVK----VCP 172

Query: 245 SCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQT 304
           +C G+G   ++ R+  G + +              + K+  + CK C G  ++ + K   
Sbjct: 173 ACQGRGVVVQVIRM--GPITQQIQQQCGQC---GGKGKTIENPCKTCKGHKVVRKNKPFH 227

Query: 305 VYIPRG-------SRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHL--ERKSNDLH 355
              P G        + G+  + P M       E+GD+II  +E S K +L   R+ N+L+
Sbjct: 228 FEFPGGIPRNHIDKKSGESDKSPDM-------ESGDIIIEYNE-SEKENLGYRRRGNNLY 279

Query: 356 TTLNISLVDALTGFSTIVCETYD-NRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFG 414
            T  I+  +A+ G  T   E  D  ++++++ P G ++  G+  + KG G P+    +FG
Sbjct: 280 RTEIITANEAINGGWTREIEFLDEKKKVKLSRPKGSIVNNGDIERIKGFGMPIMGSKNFG 339

Query: 415 DMYVQINIEFPK 426
           D+Y+   +  PK
Sbjct: 340 DLYIDYVVLVPK 351

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
           (REAL)
          Length = 378

 Score =  127 bits (320), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 117/392 (29%), Positives = 180/392 (45%), Gaps = 52/392 (13%)

Query: 70  AQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSD 129
           AQ  Y +L V+KDA+E EI+ AYR+L+ KYHPDK    +  E +   F EV  AY++LSD
Sbjct: 21  AQDYYAILEVDKDASEKEIKSAYRQLSKKYHPDK---NSGSEEAHHKFIEVGEAYDVLSD 77

Query: 130 PELKSRYDMYGDSAFGSGGNGFPEDDHE--------FDDFMNFFQQYQRQQHGPHASYSN 181
           PE K  YD +G  A  +GG G               FD F + FQ               
Sbjct: 78  PEKKKIYDQFGADAVKNGGGGGGGAGGPGGGGFHDPFDIFEHMFQG---------GHGGP 128

Query: 182 RHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEI 241
              +G+ + +R P  ++  K++ +Q Y G ++ F L     C  C G+G       +   
Sbjct: 129 GGGFGQRQRQRGPMIKVQEKLSLKQFYSGTSIEFTLSLNDECDVCHGSGSADGKLAQ--- 185

Query: 242 SCTSCNGQGFKERITRLAGGYMVKD-HTVCDACKGKGRYRKKSASDTCKHCSGKGLINEE 300
            C  C G+G   ++ R+  G M +    +C  C G G+  K    + CK C GK +I + 
Sbjct: 186 -CPDCQGRGVIIQVLRM--GIMTQQIQQMCGRCGGTGQIIK----NQCKTCHGKKVIKKN 238

Query: 301 KSQTVYIPRGS-------RHGDEFRLPQMADMEYGKETGDVIIVIDE-DSSKSHLERKSN 352
           K   V +P G+       R G+  + P         + GD++I   E D+      R+ +
Sbjct: 239 KFFHVDVPPGAPRNYLDTRAGEAEKGPDF-------DAGDLVIEFKEKDTENMGYRRRGD 291

Query: 353 DLHTTLNISLVDALTGFSTIVCETYD-NRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGD 411
           +L+ T  +S  +AL G      E +D N+ ++++ PA  V+  G     KG G P S G 
Sbjct: 292 NLYRTEVLSAEEALYGGWQRTIEFFDENKPVKLSRPAHVVVSNGEIEVLKGFGMPKS-GK 350

Query: 412 SFGDMYVQINIEFPKDNWFNEKSEITALRNIL 443
             GD+Y+   +  P       K E T+L++ L
Sbjct: 351 GHGDLYIDYVVIMPN----KLKREPTSLKDEL 378

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
           (REAL)
          Length = 533

 Score =  129 bits (325), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 119/426 (27%), Positives = 170/426 (39%), Gaps = 87/426 (20%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD L V   A+  EI+KAYR  ALKYHPDK       E S+  F+E+  AYE+L D  L+
Sbjct: 8   YDSLNVTATASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEVLKDNHLR 64

Query: 134 SRYDMYG-------------------------------DSAFGSGGNGFPEDDHEFDDFM 162
           S YD YG                                + F + G  FP D    D F 
Sbjct: 65  SLYDQYGTTDEALIQEQYQQQAYPQTQTQRQQSSVFNPSAGFDTEGMSFP-DLSPGDLFA 123

Query: 163 NFFQQYQRQQHG------------------PHASYSNRHQYGEPESK-----------RT 193
            FF                           P  + S  +    P SK           R 
Sbjct: 124 QFFSSSASSSSNGAKNSFNFSFNGSSTPNFPFGNGSGMNSLYSPSSKYNTTGEEHHLNRG 183

Query: 194 PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKE 253
           PD + + K T ++LYMGKT    L R  +C  C G G  +K+      +C  C GQG + 
Sbjct: 184 PDIKHNLKCTLKELYMGKTAKLGLNRTRICHVCDGHGGLRKY------TCKPCKGQGIQT 237

Query: 254 RITRLAGGYMVKDHT-VCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGSR 312
           +  R+  G +V+  +  C  C G G + K    D C+ C G G I + K   V +  GS 
Sbjct: 238 QTKRM--GPLVQSWSQTCADCGGAGTFVKN--KDICEQCQGLGFIKQRKILQVTVQPGSC 293

Query: 313 HGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISL------VDAL 366
           H     L    D     + G    VI  D   + L  K      T N  L      VD +
Sbjct: 294 HNQLIVLTGEGDEVISTKGGGREKVIPGDVVITILRLKDPKFQITDNCDLICKKCEVDLM 353

Query: 367 TGF--STIVCETYDNRRL-RVNVPAGKVIRPGNYFKFKGEGWP-LSNG--DSFGDMYVQI 420
           T      +  E + + +L ++++  G+V++PG +   +  G P   NG    FG +YV+ 
Sbjct: 354 TSLCGGIVYIEGHPSGKLIKIDIIPGEVLKPGCFKTVENMGMPKFINGVRSGFGHLYVKF 413

Query: 421 NIEFPK 426
           ++ +P+
Sbjct: 414 DVTYPE 419

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  126 bits (317), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 105/369 (28%), Positives = 171/369 (46%), Gaps = 37/369 (10%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
           +AQ  Y +LGV K A + +I+ AYR+L+ KYHPDK  D+   +++   F EV  AYE+LS
Sbjct: 17  LAQDYYSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDD---DSAHNKFIEVGEAYEVLS 73

Query: 129 DPELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEP 188
           DPE +  YD YG  A  + G            F + F  ++ Q  G       + +    
Sbjct: 74  DPEKRKIYDQYGAEALKNNGGQGGGQGPRGGGFHDPFDIFE-QMFGGGGGGQRQRRRARG 132

Query: 189 ESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNG 248
            +  T +     ++T ++ Y G ++ F L     C HC G+G +     K    C  C G
Sbjct: 133 HNLETRE-----ELTLKEYYRGTSIDFNLNLNDFCEHCEGSGSQDGKVTK----CPDCKG 183

Query: 249 QGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIP 308
            G   +I R+ G    +   +C  C+G+G     +  + CKHC G+ ++ + KS  V +P
Sbjct: 184 HGVVVQIVRM-GPVTQQIQQMCGKCQGRG----STIKNKCKHCHGEKVVRKPKSFHVDVP 238

Query: 309 RGS-------RHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHL--ERKSNDLHTTLN 359
            G+       + G+  + P         + GD+ I   E +S+ +L   R+ +DL  T  
Sbjct: 239 PGAPRNFVEVKQGESDKGPDF-------DAGDLFIKFSE-TSRDNLGYRRRGDDLFRTEA 290

Query: 360 ISLVDALTGFSTIVCETYD-NRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYV 418
           +SL +AL G      E  D  R++++   +  V   G   +  G G P  + + FGD+Y+
Sbjct: 291 LSLREALKGGWEREIEFLDAKRKVKIKRASSMVTNNGEIERIPGFGMPKEH-NKFGDLYI 349

Query: 419 QINIEFPKD 427
              +  P D
Sbjct: 350 DYVVIVPDD 358

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putative
           chaperone of the HSP40 (DNAJ) family; overexpression
           interferes with propagation of the [Psi+] prion; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 528

 Score =  128 bits (321), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 115/419 (27%), Positives = 171/419 (40%), Gaps = 80/419 (19%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD L V   A+  EI+KAYR  ALKYHPDK       E S+  F+E+  AYEIL D  L+
Sbjct: 8   YDSLNVTAAASTSEIKKAYRNAALKYHPDK---NNHTEESKRKFQEICQAYEILKDNRLR 64

Query: 134 SRYDMYGDS------------------AFGSGGNGFPEDDHEFDDFM--NFFQQYQRQQH 173
           + YD YG +                   F S  N F  +   F D    + F Q+     
Sbjct: 65  ALYDQYGTTDEVLIQEQQAQAQRQQAGPFSSSSN-FDTEAMSFPDLSPGDLFAQFFNSSA 123

Query: 174 GPHAS-----------------------------YSNRHQYGEPESK----RTPDSRISY 200
            P ++                             YS+  +Y   +      R PD + + 
Sbjct: 124 TPSSNGSKSSFNFSFNNSSTPSFSFVNGSGVNNLYSSSAKYNSNDEDHHLDRGPDIKHNL 183

Query: 201 KMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAG 260
           K T ++LYMGKT    L R  +C  C G G  KK       +C +C GQG + +  R+  
Sbjct: 184 KCTLKELYMGKTAKLGLNRTRICSVCDGHGGLKK------CTCKTCKGQGIQTQTRRM-- 235

Query: 261 GYMVKDHT-VCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRL 319
           G +V+  +  C  C G G + K    D C+ C G G I E K   V +  GS H     L
Sbjct: 236 GPLVQSWSQTCADCGGAGVFVKN--KDICQQCQGLGFIKERKILQVTVQPGSCHNQLIVL 293

Query: 320 PQMADMEYGKETGDVIIVIDEDSSKSHLERK---------SNDLHTTLNISLVDALTGFS 370
               D     + G    VI  D   + L  K         SN +     I  + +L G  
Sbjct: 294 TGEGDEVISTKGGGHEKVIPGDVVITILRLKDPNFQVINYSNLICKKCKIDFMTSLCGGV 353

Query: 371 TIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWP-LSNG--DSFGDMYVQINIEFPK 426
             +      + +++++  G++++PG +   +  G P   NG    FG +YV+ ++ +P+
Sbjct: 354 VYIEGHPSGKLIKLDIIPGEILKPGCFKTVEDMGMPKFINGVRSGFGHLYVKFDVTYPE 412

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
           Ashbya gossypii AER346W
          Length = 374

 Score =  124 bits (311), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 101/362 (27%), Positives = 163/362 (45%), Gaps = 22/362 (6%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
            AQ  Y +LGV + A++ +I+ AYR+L+ KYHPDK       E +   F EV  AYE LS
Sbjct: 18  FAQDYYAILGVGRGASDKDIKSAYRQLSKKYHPDK---NPGDEDAHNRFIEVGEAYEALS 74

Query: 129 DPELKSRYDMYGDSAFGS--GGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYG 186
           DPE +  YD +G  A  +     G       F D  + F     Q  G  A        G
Sbjct: 75  DPEKRKIYDQFGAEALKNGGDRAGGGGAGGGFHDPFDIFD----QMFGGGAGSRFHGGGG 130

Query: 187 EPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSC 246
           +   +R    ++  ++  ++ Y G ++ F +     C  C G+G +    +K    C  C
Sbjct: 131 QRRKQRGQSLQVQDELNLKKFYHGTSIEFTMSLNDFCDACDGSGSQDGKVEK----CGQC 186

Query: 247 NGQGFKERITRLAGGYMVKD-HTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTV 305
            G+G   ++ R   G++ +    +C  C+G+G   K    + CK C G  ++ + KS  V
Sbjct: 187 GGRGMVVQVIRQ--GFITQQIQQMCQKCEGRGEVIK----NKCKTCHGSKVVKKNKSFHV 240

Query: 306 YIPRGSRHGDEFRLPQMADMEYGKETGDVII-VIDEDSSKSHLERKSNDLHTTLNISLVD 364
            +P G+       +   A+     E GD+ + V++         R+  DL  T  +SL +
Sbjct: 241 DVPAGAPRDFVAVIRGEAEKSPDTEPGDIYVKVVESPVQNMGYRRRGPDLFRTEVLSLTE 300

Query: 365 ALTGFSTIVCETYDN-RRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIE 423
           AL G      E  D+ +++ ++   G  ++ G     KG G PL +G  +GD+YV   I 
Sbjct: 301 ALKGGWVRELEFLDSKKKVVLSRSKGTPVQHGEVECIKGFGMPLESGTKYGDLYVDYVIV 360

Query: 424 FP 425
            P
Sbjct: 361 MP 362

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
           (REAL)
          Length = 536

 Score =  125 bits (314), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 110/428 (25%), Positives = 169/428 (39%), Gaps = 88/428 (20%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD L V   A+  EI+KAYR  AL+YHPDK       E S+  F+E+  AYE+L D  L+
Sbjct: 8   YDSLNVTTTASTSEIKKAYRNAALRYHPDK---NNHTEESKRKFQEICQAYEVLKDNHLR 64

Query: 134 SRYDMYG-----------------------------------DSAFGSGGNGFPEDDHEF 158
           S YD YG                                    + F +GG  FP D    
Sbjct: 65  SLYDQYGTTDEVLIQEQHQAQAQAQAQQQQQQQQQQAGIFSSSAGFDTGGVTFP-DLSPG 123

Query: 159 DDFMNFFQQYQRQQHG------------------PHASYSNRHQYGEPESK--------- 191
             F  FF                           P  +    +    P SK         
Sbjct: 124 SLFAQFFNSSASASSNGSKNNFSFSFNGSSTPNFPFGNGGGMNNLQSPPSKYGSDDDEHH 183

Query: 192 --RTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQ 249
             R PD + + K T R+LYMGKT    L R  +C  C G G  +K+      +C +C GQ
Sbjct: 184 LNRGPDIKHTLKCTLRELYMGKTAKLGLNRTRICHVCEGHGGLQKY------TCKTCKGQ 237

Query: 250 GFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPR 309
           G + + T+  G  +      C  C G G + +  + D C+ C G G I + K   V +  
Sbjct: 238 GVQTQ-TKCMGPLVQSWSQTCADCGGAGIFVE--SKDICQQCQGLGFIKQRKILQVTVQP 294

Query: 310 GSRHGDEFRLPQMADMEYGKE-------TGDVII-VIDEDSSKSHLERKSNDLHTTLNIS 361
           G+ H     L    D    K         GDV+I ++     K  +    + ++    + 
Sbjct: 295 GTSHNQLIVLTGEGDEVISKGGGHEKVIPGDVVITILRLKDPKFQVTDNCSLIYKKCKVD 354

Query: 362 LVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWP-LSNG--DSFGDMYV 418
           L+ +L G    +      + +++++  G+V++P  +   +G G P   NG    FG +YV
Sbjct: 355 LMTSLCGGIVYIEGHPSGKLIKLDIIPGEVLKPSCFKTIEGMGMPKFINGVRSGFGHLYV 414

Query: 419 QINIEFPK 426
           + ++ +P+
Sbjct: 415 KFDVSYPE 422

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  122 bits (307), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 106/368 (28%), Positives = 169/368 (45%), Gaps = 37/368 (10%)

Query: 70  AQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSD 129
           AQ  Y +L + KDA+E EI+ AYR+L+ KYHPDK    A  + +   F E+  AYE+LSD
Sbjct: 21  AQDYYAILDIGKDASEKEIKSAYRQLSKKYHPDK---NAGSDEAHHKFIEIGEAYEVLSD 77

Query: 130 PELKSRYDMYG-DSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEP 188
           PE K  YD +G D+    GG         F D  + F++  +              +G+ 
Sbjct: 78  PEKKKIYDQFGADAVKNGGGGAGGPGGGGFHDPFDIFERMFQG-----GQGGPGGGFGQR 132

Query: 189 ESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNG 248
           + +R P  ++   ++ +Q Y G ++ F L     C  C G+G       +    C  C G
Sbjct: 133 QRQRGPTIKVHENLSLKQFYSGTSIEFTLSLNDECDGCHGSGSADGKLAQ----CPDCQG 188

Query: 249 QGFKERITRLAGGYMVKD-HTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYI 307
           +G   ++ R+  G M +    +C  C G G+  K    + CK C GK +  + K   V +
Sbjct: 189 RGIIVQVVRM--GIMTQQIQQICGRCAGTGQVIK----NQCKTCHGKKVTKKNKFFHVDV 242

Query: 308 PRGS-------RHGDEFRLPQMADMEYGKETGDVIIVIDE-DSSKSHLERKSNDLHTTLN 359
           P G+       R G+  + P         + GD++I   E D+      R+ ++L+ T  
Sbjct: 243 PPGAPRNYMDTRAGEAEKGPDF-------DAGDLVIEFREMDTENMGYRRRGHNLYRTEV 295

Query: 360 ISLVDALTGFSTIVCETYD-NRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYV 418
           +S  +AL G      E  D N+ ++++ PA  V+  G     KG G P  + D  GD+Y+
Sbjct: 296 LSAAEALYGGWERTIEFLDENKPVKLSRPAHAVVSTGEIEVVKGFGMPKGSRDH-GDLYI 354

Query: 419 QINIEFPK 426
              +  PK
Sbjct: 355 DYVVVMPK 362

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {ON}
           Anc_8.730
          Length = 376

 Score =  122 bits (306), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 106/365 (29%), Positives = 156/365 (42%), Gaps = 27/365 (7%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
            AQ  Y +L ++KDAT+ +IR AYR+L+ KYHPDK       E +   F EV  AYEILS
Sbjct: 19  FAQDYYKILELDKDATDKDIRSAYRQLSKKYHPDK---NPNDEDAHHKFIEVGQAYEILS 75

Query: 129 DPELKSRYDMYGDSAFGSGGNGFPEDDH---EFDDFMNFFQQYQRQQHGPHASYSNRHQY 185
           DPE + RYD +G         G P        FD F   F             +  + Q 
Sbjct: 76  DPEKRQRYDQFGPEGVNGQNGGGPGGAGFHDPFDIFEQMFGGGGGMGGHGGNPFQQQRQR 135

Query: 186 GEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTS 245
           G+    R   S  +Y       Y G  + F +    +C HC G+G       K    C  
Sbjct: 136 GQNVVARESTSLKNY-------YNGYVLKFSINLNDICDHCHGSGSNDGKSTK----CPD 184

Query: 246 CNGQGFKERITRLAGGYMVKD-HTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQT 304
           C G+G   ++ R+  G M +    VC  C GKG+  K    + CK C G  ++ + K   
Sbjct: 185 CQGRGVTVQVIRM--GMMTQQIQQVCGKCGGKGQIIK----NPCKTCHGSKVVQKPKDFE 238

Query: 305 VYIPRGSRHGDEFRLPQMADMEYGKETGDVIIVIDE-DSSKSHLERKSNDLHTTLNISLV 363
           + +P G+           AD     ++GDV I   E D       R+   L+ T  ++  
Sbjct: 239 IELPAGAPRKFVHAEHGAADKHPDYDSGDVYIEFTENDKDNMGYRRRGPHLYRTEVLNAT 298

Query: 364 DALTGFSTIVCETYDNRRL-RVNVPAGKVIRPGNYFKFKGEGWPLSNG-DSFGDMYVQIN 421
           +AL G         D+ ++  +     K+I+ G   +  G G PL NG   FGD+++   
Sbjct: 299 EALYGGWERQLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMPLGNGRKGFGDLFIDYV 358

Query: 422 IEFPK 426
           +  P+
Sbjct: 359 VVMPE 363

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
           (REAL)
          Length = 375

 Score =  121 bits (303), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 111/386 (28%), Positives = 174/386 (45%), Gaps = 43/386 (11%)

Query: 70  AQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSD 129
           AQ  Y +L ++K A+E EI+ AYR+L+ K+HPDK    A  E +   F EV  AY++LSD
Sbjct: 21  AQDYYAILEIDKGASEKEIKSAYRQLSKKFHPDK---NAGSEEAHQKFIEVGEAYDVLSD 77

Query: 130 PELKSRYDMYGDSAF-GSGGNGFPEDDHEFDDFMNFFQQ-YQRQQHGPHASYSNRHQYGE 187
           PE K  YD +G  A    G          F D  + F++ +Q    G    +  R +   
Sbjct: 78  PEKKKIYDQFGAEAVKNGGDGAGGPGAGGFHDPFDIFERMFQGGHGGTGGGFGQRQR--- 134

Query: 188 PESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCN 247
              +R P  ++  K++ +Q Y G ++ F L     C  C G+G       +    C  C 
Sbjct: 135 ---QRGPMIKVQEKLSLKQFYSGSSIEFTLSLNDECDVCHGSGSADGKLAQ----CPDCQ 187

Query: 248 GQGFKERITRLAGGYMVKD-HTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVY 306
           G+G   ++ R+  G M +    +C  C G G+  K    + CK C G  +    K   V 
Sbjct: 188 GRGVIIQVLRM--GIMTQQIQQMCGRCGGTGQVIK----NECKTCHGNKVTKRNKFFHVD 241

Query: 307 IPRGS-------RHGDEFRLPQMADMEYGKETGDVIIVIDE-DSSKSHLERKSNDLHTTL 358
           +P G+       R G+  + P         + GD++I   E DS      R+ ++L+ T 
Sbjct: 242 VPPGAPRNYMDTRAGEAEKGPDF-------DAGDLVIEFKEKDSENMGYRRRGDNLYRTE 294

Query: 359 NISLVDALTGFSTIVCETYD-NRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMY 417
            +S+ +AL G      E  D N+ ++++ PA   +  G     KG G P   G  +GD+Y
Sbjct: 295 VLSIEEALYGGWERTIEFLDENKPVKLSRPAYVGVSNGEIEVMKGFGMP-KGGKGYGDLY 353

Query: 418 VQINIEFPKDNWFNEKSEITALRNIL 443
           +   +  PK      K E T L++ L
Sbjct: 354 IDYVVIMPK----TLKREQTLLKDEL 375

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {ON}
           similar to uniprot|P25303 Saccharomyces cerevisiae
           YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score =  120 bits (300), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 104/371 (28%), Positives = 165/371 (44%), Gaps = 25/371 (6%)

Query: 58  TRLTNSNVNYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMF 117
           T L+   + + +AQ  Y +LGV+K A+E EI+ AYR+L+ KYHPDK       + +   F
Sbjct: 6   TLLSLVWLPFVIAQDYYAILGVDKQASEKEIKSAYRQLSKKYHPDK---NPGNDEAHHHF 62

Query: 118 KEVTAAYEILSDPELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHA 177
            EV  AY++LSDPE +  YD +G  A  +G  G P   + F D  + F+Q          
Sbjct: 63  IEVGEAYDVLSDPEKRQIYDRHGADALKNGHPGGPGGGNGFHDPFDLFEQM-------FG 115

Query: 178 SYSNRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQ 237
           S       G+P   R  + ++++ ++ +  Y+G    F L    +C  C G+G      +
Sbjct: 116 SNMYNRARGKP---RGQNLQVNHDISLKTFYLGTEFEFTLNLNDICDACDGSGSEDGKTE 172

Query: 238 KPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLI 297
               +C  C G G   ++ R AG    +    C  C+G+G+  K      CK C G  ++
Sbjct: 173 ----TCPDCGGSGQIMKVFR-AGPIEQRVRQPCSRCQGRGQLIKH----VCKKCKGVKVV 223

Query: 298 NEEKSQTVYIPRGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSH-LERKSNDLHT 356
            + K  T  +  G        +   ++     E GD+     E    S    R+ N L+ 
Sbjct: 224 QKSKVFTAKVEPGMERNHIHVMQGQSEKHPDIEPGDLYQYFRESEKDSMGYRRRGNTLYR 283

Query: 357 TLNISLVDALTGFSTIVCETYDNRR-LRVNVPAGKVIRPGNYFKFKGEGWPL-SNGDSFG 414
           T  +S  +AL G      E +D  + L ++ P G  ++ G     K  G P+ S  D FG
Sbjct: 284 TEILSFKEALQGGWERNIEFFDKEKSLVLSRPVGHTVQNGETEVIKSFGMPIPSATDKFG 343

Query: 415 DMYVQINIEFP 425
           D+ +   I  P
Sbjct: 344 DLIIDYVILLP 354

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} similar
           to uniprot|P25303 Saccharomyces cerevisiae YMR214W SCJ1
           dnaJ homolog
          Length = 375

 Score =  119 bits (299), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 113/375 (30%), Positives = 175/375 (46%), Gaps = 50/375 (13%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
           +AQ  Y +LGV KDA+E EI+ AYR+L+ KYHPDK       ET+   F EV  AYE+LS
Sbjct: 21  VAQDYYAILGVSKDASEKEIKSAYRQLSKKYHPDK---NPGDETAHHKFIEVGEAYEVLS 77

Query: 129 DPELKSRYDMYGDSAFGSGGNGFPEDDHEFD-------DFMNFFQQ-YQRQQHGPHASYS 180
           D + +  Y+ YG  A  +GG G                D M+ F+Q +  Q+ G      
Sbjct: 78  DDQKRQIYNQYGAEALKNGGPGGSGGPGGPGGFGGGFHDPMDIFEQMFGAQRGGGGRGRP 137

Query: 181 NRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPE 240
             H     E           ++T ++ Y G ++ F L     C +C GTG +     +  
Sbjct: 138 RGHNLEARE-----------EITLKEYYQGTSLDFTLNLNDFCDNCKGTGSQDGKTTR-- 184

Query: 241 ISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEE 300
             C+ C GQG   +I R+ G    +   +C AC+GKG+  K    + CK C G  +  + 
Sbjct: 185 --CSDCQGQGVVIQIIRM-GPITQQIQQMCGACQGKGQIIK----NKCKQCHGAKVERKT 237

Query: 301 KSQTVYIPRGS-------RHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHL--ERKS 351
           K   V +P G+       ++G+  + P         + GDV I   E SS+ ++   R+ 
Sbjct: 238 KHFHVDVPAGAPRDFVDVKNGEADKGPDF-------DAGDVYIKFSE-SSRDNMGYRRRG 289

Query: 352 NDLHTTLNISLVDALTGFSTIVCETYDN-RRLRVNVPAGKVIRPGNYFKFKGEGWPLSNG 410
             LH T  ++L +AL G      E  D+ ++++++  AG  +R G   +  G G P  +G
Sbjct: 290 VHLHRTEVLTLKEALQGGWKREIEFLDHTKKVKLHRDAGVPVRHGETERVPGFGMP-KDG 348

Query: 411 DSFGDMYVQINIEFP 425
             FGD++V   +  P
Sbjct: 349 RHFGDLFVDYVVLTP 363

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.218
           YNL077W
          Length = 448

 Score =  120 bits (301), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 114/424 (26%), Positives = 181/424 (42%), Gaps = 57/424 (13%)

Query: 69  MAQTP--YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEI 126
           M + P  Y+ L +   A++ +I+KAYR  AL+YHPDK     E E S+  F++++ AY I
Sbjct: 1   MVKDPRLYNALNIPPTASQSDIKKAYRVQALRYHPDK---NNESEESKKKFQDISEAYSI 57

Query: 127 LSDPELKSRYDMYG-----DSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSN 181
           L D   +  YD YG     +    +     P  D       + F Q+   Q+      ++
Sbjct: 58  LRDENQRKMYDKYGTVNPTEIQQQNQRTNVPFTDPFGMSAADLFSQFFDTQNHNSGQSNS 117

Query: 182 RHQYGEP----------------------------ESKRTPDSRISYKMTTRQLYMGKTV 213
              +G P                              ++ PD   + K T + LY GK  
Sbjct: 118 SPPFGFPFNSSRNGNGNNNRAADGVFGDFFNTKSRPLQKGPDINHNLKCTIKDLYRGKRS 177

Query: 214 TFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDAC 273
             +L+R  LC  C G G  K+        C  C+G G     TRL        HT C+ C
Sbjct: 178 KLRLERSKLCSICKGDGGVKRSM------CNQCHGDGNITETTRLGPMLQTFTHT-CNIC 230

Query: 274 KGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQMADMEYGKE--- 330
            G G      + +TC+ C+G G  NE K   V I  G + G +       D    K    
Sbjct: 231 NGNGWV--IISQETCQGCNGVGFYNEMKIFDVEIYPGMKDGTQIVFNNEGDEIVNKRRVI 288

Query: 331 TGDVIIVIDE-DSSKSHLERKSNDL-HTTLNISLVDALTGFSTIVCETYDNRRLRVNVPA 388
            G+VII I+E + +K        DL +    I L  +L G    +    +N+ ++V++  
Sbjct: 289 PGNVIIHINEIEDNKFKRVNDGQDLYYWNYEIDLFTSLCGGVIYIKGHPNNKLIKVDILP 348

Query: 389 GKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEKSEITALRNILPGLKS 448
           G++I  G+    +  G P + G+ +G +Y+Q  +++P+    N +S I A+  IL  LK 
Sbjct: 349 GEIIESGSVKGVESLGMPKNKGNEYGILYIQFQVKYPEK--LNMES-IKAIEKIL--LKD 403

Query: 449 KDTK 452
           ++ K
Sbjct: 404 ENVK 407

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218
          Length = 494

 Score =  120 bits (302), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 134/474 (28%), Positives = 215/474 (45%), Gaps = 70/474 (14%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y+ L V   AT ++I+KAY+KLALKYHPDK       E S+  F+ V  AYEIL+D + +
Sbjct: 8   YETLNVPITATTLDIKKAYKKLALKYHPDK---NNHSEDSKTKFQAVCQAYEILNDKQSR 64

Query: 134 SRYDMYG--DSAF-------------GSGGNGFPEDDHEFDD-FMNFFQQYQRQQHGPHA 177
           + YD  G  D A                GG  FP       D F  FF         P  
Sbjct: 65  AIYDALGITDEALIEQQKKQQQQQHQQQGGMEFPPMGMSPGDLFAQFFDNNNNAAKQP-- 122

Query: 178 SYSNRHQYGEPESK-------------RTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCP 224
           S S  H Y   +S+             R PD +   K T R+LY GK     L R  LC 
Sbjct: 123 SQSQMHAYPNFKSESHVTNGKADHPLHRGPDIKHVLKCTLRELYNGKMAKLALNRTRLCL 182

Query: 225 HCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHT-VCDACKGKGRYRKKS 283
            C+G G  ++       +C SC G GF+ +  R+  G MV+  T  C +C G G + K  
Sbjct: 183 PCNGFGGLQR------TTCESCQGDGFQTQTRRM--GPMVQTWTQTCASCDGAGCFIK-- 232

Query: 284 ASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQMAD-------MEYGKETGDVII 336
            +D C HC G+G I E K   V +  G + G +  +   AD       ++     GDV+I
Sbjct: 233 PNDVCPHCHGEGFIRERKIFHVEVKPGFQDGKDVIMQGEADEIMLNNLVKEKVIPGDVVI 292

Query: 337 VIDEDSSKSHLERKSNDLHTTLN---ISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIR 393
            I +   +++  +  N+    +N   + LV +L G    +      + +++++  G++++
Sbjct: 293 TIKQSRDENNCFQMINNKDLLMNGCPVDLVTSLCGGEVYIDNHPSGKLIKLDIIPGEILK 352

Query: 394 PGNYFKFKGEGWP-LSNG--DSF---GDMYVQINIEFPK----DNWFNEKSEITALRNIL 443
           P  +   +G G P L +G  D+    GD+Y+Q  I++P+    +     K+++   + + 
Sbjct: 353 PNCFKIIEGLGMPYLEDGKDDTMLRRGDLYIQFKIQYPEQLENETMTQLKAQLNKDKYVK 412

Query: 444 PGLKSK----DTKDPDPLNTED-VLSYSVLHSHDELPDYLAEEKEKYNRKQQEE 492
             L+ +    D +  D +  E+ VLS  +    + L  Y A+ + + N  Q++E
Sbjct: 413 EDLRREKEAIDQRLDDCVEVEECVLSSFIAPDAETLRKYKADYRRRRNAMQEDE 466

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR214W
           (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score =  118 bits (295), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 109/367 (29%), Positives = 169/367 (46%), Gaps = 35/367 (9%)

Query: 70  AQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSD 129
           AQ  Y +LGV KDA++ EI+ AYR+L+ K+HPDK       E +   F EV  AYE+LSD
Sbjct: 23  AQDYYGILGVSKDASDKEIKSAYRQLSKKFHPDK---NPGDEDAHHKFIEVGEAYEVLSD 79

Query: 130 PELKSRYDMYGDSAFGSGGNGFPEDDHEFD-----DFMNFFQQYQRQQHGPHASYSNRHQ 184
            + +  YD +G  A  +GG G P            D M+ F+Q           +     
Sbjct: 80  DQKRQIYDQHGAEALKNGGPGGPGGPGGGFGGGFHDPMDIFEQM----------FGGHRG 129

Query: 185 YGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCT 244
            G     R  +     ++T +Q Y G ++ F L     C +C G+G +          C+
Sbjct: 130 GGGRGRPRGHNLEAREELTLKQYYQGTSLDFTLNLNDFCENCHGSGSQ----DGKTTHCS 185

Query: 245 SCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQT 304
            C GQG   ++ R+ G    K   +C AC+GKG+  K    + CK C G  +  + K   
Sbjct: 186 ECRGQGVVIQVVRM-GPLTQKIQQMCGACQGKGQVIK----NKCKRCHGAKVERKAKHFH 240

Query: 305 VYIPRGSRHGDEFRLPQMADMEYGK--ETGDVIIVIDEDSSKSHL--ERKSNDLHTTLNI 360
           V +P G+    +F   +  + + G   ++GDV I   E SS+ ++   R+   L+ T  +
Sbjct: 241 VDVPAGAPR--DFVDVKAGEADKGPDFDSGDVFIKFSE-SSRDNMGYRRRGPHLYRTEVL 297

Query: 361 SLVDALTGFSTIVCETYD-NRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQ 419
           SL +AL G      E +D N++L++    G  +R G   +  G G P       GD++V 
Sbjct: 298 SLKEALLGGWKREIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGMPTGGHGKHGDLFVD 357

Query: 420 INIEFPK 426
             +  PK
Sbjct: 358 YVVVIPK 364

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score =  117 bits (294), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 104/362 (28%), Positives = 164/362 (45%), Gaps = 38/362 (10%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y +LGV+++ATE +I+ AYR+L+ KYHPDK   +    T+   F EV  AYE LSDPE +
Sbjct: 23  YAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDT---TAHHNFIEVGEAYEALSDPEKR 79

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRT 193
             YD YG  A  +GG         F D  + F+Q                       +R+
Sbjct: 80  RIYDQYGAEALKNGGGAE-GGHGGFHDPFDIFEQMFGGGARFGGGQRR--------RQRS 130

Query: 194 PDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKE 253
              ++  ++T RQ Y G  V F L     C HC  TG +    ++    CT C+ +G   
Sbjct: 131 QSLQVQEELTLRQYYHGTAVEFTLSLNDHCDHCGATGSQDGKVER----CTQCSVRGVIV 186

Query: 254 RITRLAGGYMVKD-HTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGS- 311
           ++ R   G+M +    VC    G      K+    CK C G   I + KS  V +P G+ 
Sbjct: 187 QVGRQ--GFMTQQFQQVCPRLLGPW---PKALPKKCKVCQGHKAIKKNKSFRVEVPPGAP 241

Query: 312 ------RHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSH-LERKSNDLHTTLNISLVD 364
                 + G+  ++P M       + GD+ + + E++  +    R+  +L  T  +SL +
Sbjct: 242 RDFVAVQQGEAEKVPDM-------DPGDIYVKVFENTRDNMGYRRQGANLFRTEVLSLKE 294

Query: 365 ALTGFSTIVCETYD-NRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIE 423
           AL G      E  D ++++  +   G+ ++ G   +  G G PL +   FGD+YV   + 
Sbjct: 295 ALHGDWKRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGMPLPDSAGFGDLYVDYVVI 354

Query: 424 FP 425
            P
Sbjct: 355 LP 356

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  117 bits (293), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 102/370 (27%), Positives = 169/370 (45%), Gaps = 33/370 (8%)

Query: 70  AQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSD 129
           AQ  Y +LGV KDA + EI+ AYR+L+ KYHPDK       E +   F EV  AY++LSD
Sbjct: 20  AQDYYKILGVNKDANDKEIKSAYRQLSKKYHPDK---NPGDEEAHNKFIEVGEAYDVLSD 76

Query: 130 PELKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPE 189
            E ++ YD YG  A    G            F + F+ +++  +G     + R   G   
Sbjct: 77  SEKRNIYDQYGADAI-KNGGNGQRPGGGGSPFHDPFEMFEKMFNGNPFGGAARGGPGGRG 135

Query: 190 SKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQ 249
             R  +  +  +++    Y G+   + L+    C  C GTG +     +    C  C G+
Sbjct: 136 RPRGQNLLLREEVSLMDFYNGREFKYNLQLNDFCEKCHGTGSKDGKVTR----CPDCQGR 191

Query: 250 GFKERITRLAGGYMVKD-HTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIP 308
           G   ++ ++  G M +    VCD C G G   K    + C HC G  +   +K  TV +P
Sbjct: 192 GVIVQVIQM--GIMTQQIQHVCDRCSGSGEIIK----NPCPHCHGHKVAKMDKEFTVKLP 245

Query: 309 RGSRHGDEFRLPQMADMEYGK-------ETGDVIIVIDEDSSKSHLERKSND-LHTTLNI 360
            G++           D+++G+       + GD++    E+S  +   R+  D L+ T  +
Sbjct: 246 NGAQR-------NYVDIKHGEAEKGADFDAGDLMFEFRENSMNNMGYRRRGDHLYRTEVL 298

Query: 361 SLVDALTGFSTIVCETYD-NRRLRVNVPAGKVIRPGNYFKFKGEGWPLSN--GDSFGDMY 417
           S+ +AL G      E +D ++ +++   A +V+  G      G G P+ N  G  FGD++
Sbjct: 299 SVQEALKGGWERELEFFDKDKNVKLKRDANQVVITGEIECVPGFGMPILNSQGRKFGDLF 358

Query: 418 VQINIEFPKD 427
           +   I  P++
Sbjct: 359 IDYVILMPQE 368

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score =  117 bits (292), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 114/389 (29%), Positives = 166/389 (42%), Gaps = 50/389 (12%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132
           PY  LGV +DA+  +I++AY KLA KYHPD   +    +T    F  +  AYEILSD + 
Sbjct: 49  PYKTLGVSRDASPSDIKRAYYKLAKKYHPDINKEPGADKT----FHNLQNAYEILSDEKK 104

Query: 133 KSRYDMYGDSAFGSGGN----------GFPEDDHEFDDF--MNF-------FQQYQRQQH 173
           K +YD YG SAF   GN          G       F DF  +NF       F +   +  
Sbjct: 105 KLQYDQYGSSAFDQNGNANGAGGFNPFGGGASASGFADFGGLNFEDLFGAAFGRSGFRNG 164

Query: 174 GPHASYSNRHQYGEPESKRTPDSRISYKMTTRQLYMG-KTVTFQLKRKCLCPHCSGTGLR 232
           G    ++ R         +     I + ++ +    G   V+ + K    C  C G+GL+
Sbjct: 165 GDAGGFNGRANI--VREYQGDSIEIQHVVSFKDAVFGLNNVSLKYKSLDPCGTCHGSGLK 222

Query: 233 KKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCS 292
               Q    +C+ CNG G +  +     G+ +   + C  C G+G    +   DTC  C 
Sbjct: 223 NGE-QHKRKTCSYCNGTGTQVHVKS---GFQMA--STCMHCHGEGTTIARE--DTCSACD 274

Query: 293 GKGL-INEEKSQTVYIPRGSRHGDEFRL------PQMADMEYGKET----GDVIIVIDED 341
           G G+ IN +KS  V  P G   GD  R+      P +A  E  K      GD+++ I   
Sbjct: 275 GDGVKINSKKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKSIKLSRGDLLVRIRVK 334

Query: 342 SSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFK 401
           S      +   D+ T   I +  A  G  T+  ET D + +R+ V +G   +        
Sbjct: 335 SDPKFFVKNKYDIWTIKEIPITTAALG-GTVEIETVDGKNIRLKVISG--TQHDQVTSIP 391

Query: 402 GEGWPLSNGDSFGDMYVQ--INIEFPKDN 428
             G P  NG   G+M VQ  I I+ P+ N
Sbjct: 392 NMGIPYRNGTGRGNMNVQYKIVIKKPQSN 420

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {ON}
           Anc_8.730 YMR214W
          Length = 384

 Score =  115 bits (287), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 108/364 (29%), Positives = 163/364 (44%), Gaps = 25/364 (6%)

Query: 74  YDVLGVEKD-ATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132
           Y +LG+ K+   E EI+ AYRKL+ KYHPDK  ++ + + +   F +V  AY++L DP+ 
Sbjct: 26  YKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKNDKDAQQN---FIKVGEAYDVLGDPDK 82

Query: 133 KSRYDMYGDSAFGSGGN----GFPEDDHEFDDFMNFFQQ-YQRQQHGPHASYSNRHQYGE 187
           K +YD  G  AF +               F D  + F++ +     G    +      G 
Sbjct: 83  KRQYDQMGHDAFVNNAQHGGPEGGPGGQPFHDPFDMFEKMFHGGGPGGGNPFGGNPFGGG 142

Query: 188 PESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCN 247
              +R P  ++  +++ +Q Y G    F L     C HC GTG      +     C  C 
Sbjct: 143 GGQRRGPSLKVEQQLSLKQYYQGFDFQFALNLHDDCDHCHGTGSEDGKTK----VCPDCK 198

Query: 248 GQGFKERITRLAGGYMVKD-HTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVY 306
           G G   +I R+  G M +     C  C+G+G   K    + CK C+G  +  + K   VY
Sbjct: 199 GSGIIIQIIRM--GMMTQQIQQPCGRCRGQGHLIK----NFCKVCNGAKVQQKLKDFKVY 252

Query: 307 IPRGS-RHGDEFRLPQMADMEYGKETGDVIIVIDE-DSSKSHLERKSNDLHTTLNISLVD 364
           +P GS R+  E +  Q A+     E GDVII  +E         R+ N+L  T  ISL +
Sbjct: 253 VPPGSPRNHVEVKAGQ-AEKNPNYEPGDVIIEFNELPLDNLGYRRRGNNLFRTEYISLNE 311

Query: 365 ALTGFSTIVCETYD-NRRLRVNVPAGKVIRPGNYFKFKGEGWPLSN-GDSFGDMYVQINI 422
           AL G      +  D  +R+ +       I  G     KG G P+ N  + FGD+Y+   +
Sbjct: 312 ALYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGMPIPNKKNKFGDLYIDYKV 371

Query: 423 EFPK 426
             PK
Sbjct: 372 IIPK 375

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.730
           YMR214W
          Length = 378

 Score =  114 bits (285), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 98/371 (26%), Positives = 170/371 (45%), Gaps = 37/371 (9%)

Query: 70  AQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSD 129
           AQ  Y +LGV KDA+E +I+ AYR+++ K+HPDK    A  + +   F E+  AYE+LSD
Sbjct: 17  AQDYYAILGVAKDASEKDIKSAYRQMSKKWHPDK---NAGDDEAHHKFIEIGEAYEVLSD 73

Query: 130 PELKSRYDMYGDSAFGS-----GGNGFPEDDHEFDDFMNFFQQYQRQQHGPHASYSNRHQ 184
            E ++ YD +G  A  +     GG+        F D  + F Q           + + H 
Sbjct: 74  SEKRATYDRFGADALKNGGGGGGGHPGGFGGGGFHDPFDLFNQM----------FGDSHP 123

Query: 185 YGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCT 244
            G+   ++  +  +   +T    Y G      L     C HC G+G     F     +C 
Sbjct: 124 GGQ-NVRKGSNLIVKDSVTLNGFYHGFYANLTLDLNDDCEHCHGSGAEDNQFA----TCE 178

Query: 245 SCNGQGFKERITRLAGGYMVKD-HTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQ 303
           +C G+G   ++ ++  G+M +    VC AC+GKG    K+    CK C G  ++   K+ 
Sbjct: 179 TCQGRGVIIQVIQM--GFMTQQIQQVCGACQGKG----KTIKHVCKICRGARVVKTPKTF 232

Query: 304 TVYIPRGSRHGDEFRLPQMADMEYGKETGDVIIVIDEDSSKSHLERKSND-LHTTLNISL 362
            + +P G++          A+     ++GD++ V +E+S ++   R+  D L+ T  +  
Sbjct: 233 EISVPAGAQRNYNVVKSGQAEKVPDMQSGDLVFVFEENSHENLGYRRRGDHLYRTEVLHW 292

Query: 363 VDALT-GFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNG-----DSFGDM 416
            +AL  G+   +    D +++ V      V  PG   +    G P  N      +++GD+
Sbjct: 293 KEALLGGWERRIAFFDDQKQVVVKRDKNVVTAPGEIERVPNLGMPKLNSKGKSTNAYGDL 352

Query: 417 YVQINIEFPKD 427
           +++  I  PK+
Sbjct: 353 FIEYVIVSPKE 363

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {ON}
           Anc_2.218
          Length = 530

 Score =  115 bits (288), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 128/476 (26%), Positives = 195/476 (40%), Gaps = 94/476 (19%)

Query: 62  NSNVNYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVT 121
           NS VN +  +  Y +L V   AT  EI+ AY+KLALKYHPDK       E S+  F+E+ 
Sbjct: 4   NSVVNNNNTRL-YSILQVPTAATLFEIKNAYKKLALKYHPDK---NNHSEESKLKFQEIC 59

Query: 122 AAYEILSDPELKSRYDMYG--DSAF--GSGGNGFPEDDHEF------DDFMNFFQQYQRQ 171
            AYE+L D + K  YD YG  D +      GN   +DD +       D F  FF +  R 
Sbjct: 60  KAYEVLHDKDKKLLYDTYGTLDESLIDKQRGNNDQKDDFDTTELSPGDLFAKFFDKSSRV 119

Query: 172 QHGPH-----------ASYSNRHQYG------------------EPESKRTPDSRISYKM 202
            +  +           ++ +N +  G                  E    R PD +     
Sbjct: 120 NNNNYNSNSSPFNNVPSTNTNTNSAGNRFMTQALNSPSTTGTLFEKGLSRGPDIKHVLNC 179

Query: 203 TTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGY 262
           T ++LY GK     L R   C  C+G G          I C  C G+G     T++ G  
Sbjct: 180 TLKELYQGKKCKLGLNRTRSCHSCNGMGGMNT------IICNECQGKGINTE-TKMLGPM 232

Query: 263 MVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQM 322
           +    + C  C G G +    +   CK C G+G + E    TV +  G R+  +  L   
Sbjct: 233 VQSWSSTCFNCSGMGYFIDSQSG--CKECQGEGYLRERTIFTVTVKPGMRNNQKIVLKGE 290

Query: 323 AD--MEYGKET------GDVIIVID----------------EDSSKSHLE--RKSNDLHT 356
           AD  M  GK        GDVIIVI+                E+ +K H E   + + L  
Sbjct: 291 ADQVMLVGKLNKEKVIPGDVIIVINQIEGKSWKNDSNIDQGENKNKFHFEIINEKDLLLR 350

Query: 357 TLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWP------LSNG 410
              I L+ +L G    +      + +++++   ++++P      +  G P       +NG
Sbjct: 351 NCQIDLITSLCGGEIYIKNHPSGKLIKLDIIPSEILKPDCLKCVENLGMPRYIEDETNNG 410

Query: 411 DSF---GDMYVQINIEFPKDNWFNEKSEITALRNILPGLKSKDTKDPDPLNTEDVL 463
           + +   GD+Y+Q  +++P      E   I  LR+IL    S+D    + L  E V+
Sbjct: 411 EEYLPNGDLYIQFKVKYPTK---LENETIDKLRSIL----SEDIHMKNELQKEKVI 459

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
           (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score =  108 bits (270), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 98/363 (26%), Positives = 157/363 (43%), Gaps = 23/363 (6%)

Query: 67  YDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEI 126
           + +AQ  Y +LG+ K+  E EI+ AYR+L+ K+HPDK       E +   F E+  AYE+
Sbjct: 18  FILAQDYYKILGLSKNCNEKEIKSAYRQLSKKFHPDK---NPNDEDAHNKFIEIGEAYEV 74

Query: 127 LSDPELKSRYDMYGDSAFGS---GGNGFPEDDHEFDDFMNFFQQY-----QRQQHGPHAS 178
           LSDPE +  YD +G  A  +   GG G P     F D  + F+Q           G    
Sbjct: 75  LSDPEKRRMYDQFGADAVKNGGPGGPGGPGGPGGFHDPFDLFEQMFGGGHGGGFGGFGGF 134

Query: 179 YSNRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQK 238
                       +R    ++ + +T +  Y G +++F L     C HC G+G      +K
Sbjct: 135 GGFGGGQQHQGKQRGQSIKVRHALTLKDYYNGGSISFSLLLNDNCDHCHGSGSEDGKVKK 194

Query: 239 PEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLIN 298
               C  C G+G   ++ R+ G    +    C+ C G G        + CK CSG  +  
Sbjct: 195 ----CPDCGGRGVVIQVIRM-GIVTQQVQQRCNRCAGSGEI----IQNKCKVCSGAKVQK 245

Query: 299 EEKSQTVYIPRGSRHGDEFRLPQMADMEYGKETGDVII-VIDEDSSKSHLERKSNDLHTT 357
           +EK  +V    G            A+   G E GD+I+   +   +     R+  DL  T
Sbjct: 246 KEKDISVSFDSGIERNHISVQQGEAEKGPGIEPGDLIVEFFEVPEANMGYRRRGKDLFRT 305

Query: 358 LNISLVDALTGFSTIVCETYD-NRRLRVNVPAGKVIRPGNYFKFKGEGWP-LSNGDSFGD 415
             ++L +A+ G  +   +  D  ++L++      ++  G   K  G G P L +   FGD
Sbjct: 306 EVLTLQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGMPILGSKGKFGD 365

Query: 416 MYV 418
           +Y+
Sbjct: 366 LYI 368

>KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {ON}
           Anc_8.61 YFL016C
          Length = 498

 Score =  103 bits (258), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 110/346 (31%), Positives = 162/346 (46%), Gaps = 51/346 (14%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132
           PY  LG+  +A++ +I+KAY KLA KYHPD      + E +EA F ++  AYEILSD + 
Sbjct: 48  PYKTLGINSNASQSDIKKAYYKLAKKYHPDI----NKEENAEAKFHDLQNAYEILSDEQK 103

Query: 133 KSRYDMYGDSAF----GSGGN---------GFPEDDHEFDDF--MNF---FQQYQRQQHG 174
           + +YD +G SAF     + GN         GF   ++ F DF  +NF   F    +QQH 
Sbjct: 104 RKQYDQFGPSAFDPNINTSGNSNPFTSDPFGFGTTNNPFSDFGGINFEDLFGNAFKQQHS 163

Query: 175 PHASYSNRHQYGEPESKRTPDSRISYKMTTRQLYMG-KTVTFQLKRKCLCPHCSGTGLRK 233
            + S SNR+ + E +        ++Y +  +    G K V         C  C+G+GL+ 
Sbjct: 164 NNTSNSNRNFFREFKGDTI---HLNYNLNFKDSVFGKKNVKLNFNSFDPCNTCNGSGLKH 220

Query: 234 KHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSG 293
              +    +C +CNG G +  I    GG+ +   + C+ C G+G   K   +D C HC G
Sbjct: 221 NAHKS---TCQTCNGTGTRVHI---RGGFQM--MSTCNDCNGEG--TKIDPNDYCNHCHG 270

Query: 294 KGL-INEEKSQTVYIPRGSRHGDEFRL------PQMA---DMEYGKET----GDVIIVID 339
            G+     K  TV +P   + GD  R+      PQMA   D+          GD++I I+
Sbjct: 271 DGVEFKRNKEITVDLPNALQDGDVIRVSNKGSYPQMAMDPDLINNNNVRMTRGDILIKIN 330

Query: 340 EDSSKSHLERKSNDLHTTLNISLVD-ALTGFSTIVCETYDNRRLRV 384
             +      R   D+  T+ I +   AL G  TI      N RLRV
Sbjct: 331 VINDTKFKIRDKYDIWYTMEIPITTAALGGIVTIPSIDGTNVRLRV 376

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
           YFL016C
          Length = 500

 Score =  100 bits (250), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 118/422 (27%), Positives = 176/422 (41%), Gaps = 76/422 (18%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132
           PY VLGV+  A++ EI+KAY KLA +YHPD I  EA    +E  F ++  AYEILSD   
Sbjct: 36  PYGVLGVKSSASQGEIKKAYYKLAKQYHPD-INKEA---GAEKKFHDLQNAYEILSDESK 91

Query: 133 KSRYDMYGDSAF---------------GSGGNGFPE----DDHEFDDF--MNFFQQY--- 168
           + ++D +G +AF               G G N F          F DF  +NF   +   
Sbjct: 92  RKQFDQFGPAAFGAGAGAGGPGSGYPQGQGFNPFASYTSSSSSPFGDFGGINFEDLFGAA 151

Query: 169 --------------QRQQHGPHASYSNRHQYGEPESKRTPDSRISYKMTTRQLYMGKT-V 213
                               P +S   R   G+          +SY M+ +    GK+ V
Sbjct: 152 FSGSGGAGGAKAGGAGASRNPFSSSGYRQYKGD-------SVHVSYNMSFKDAVFGKSGV 204

Query: 214 TFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDAC 273
             +      C  CSG+G++K   +     C  C G G K     + GG+ +   + C+ C
Sbjct: 205 KLKFNVFDPCDTCSGSGIKKGASRH---QCPGCQGSGTK---IHVRGGFQM--MSTCNEC 256

Query: 274 KGKGRYRKKSASDTCKHCSGKGL-INEEKSQTVYIPRGSRHGDEFRLPQMA-------DM 325
           +G+G     ++SD C  C G+G+  +  K  TV +P G + GD  R+P          D 
Sbjct: 257 QGEG--TTVNSSDLCGACHGEGVHFHRGKEITVDLPHGLQDGDVIRIPGQGSYPEVALDP 314

Query: 326 EYGKET----GDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRR 381
                     GDV++ +  +   +   R  +D+  T+ I +  A  G  T+   T D   
Sbjct: 315 SLAGSVKLTRGDVLVNVRVEEDPTFTIRDKSDIWYTMEIPITTAALG-GTVQVPTVDGSH 373

Query: 382 LRVNVPAGKVIRPGNYFKFKGEGWPLSN-GDSFGDMYVQINIEFPKDNWFNEKSEITALR 440
           +R+ V  G   + G+       G P SN   S G M VQ  I   K +   EK    AL 
Sbjct: 374 IRLKVAPG--TQSGDVITVPNMGVPRSNLTRSRGAMKVQYRIVIKKPSSEVEKCLWEALA 431

Query: 441 NI 442
           ++
Sbjct: 432 DV 433

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
           Ashbya gossypii AER427W
          Length = 503

 Score = 99.0 bits (245), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 85/301 (28%), Positives = 133/301 (44%), Gaps = 28/301 (9%)

Query: 192 RTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGF 251
           R PD + + K   ++LY GK     L R  LC  CSG G            C  C GQG 
Sbjct: 151 RGPDIKHNLKCELKELYSGKVAKLGLTRTRLCHRCSGHGSMTSSV------CGECRGQGV 204

Query: 252 KERITRLAGGYMVKDHTVCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIPRGS 311
             + TR  G  +    + C  C G G + K  ++D C+ C G G I E K   V I  G 
Sbjct: 205 YSQ-TRRHGPLVQTWSSSCRNCSGAGTFVK--SNDVCQTCRGTGYIRERKIFEVEIKPGL 261

Query: 312 RHGDEFRLPQMADM----EYGKET---GDVIIVIDEDSSKSHLE--RKSNDLHTTLNISL 362
            +  E  LP  AD      YGK+    GDVII++ E  S       R+S+ + T   + L
Sbjct: 262 SNKSEIILPGEADQVISTVYGKQQVIPGDVIIIVQEQCSTGRYRRFRESDLVLTRCVVDL 321

Query: 363 VDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWP-LSNGDSFGDMYVQIN 421
             +L G S  + +    R +++ V  G+++ PG+    +  G P   N   +GD+Y++  
Sbjct: 322 RTSLCGGSIYIDDHPSGRPIKLEVIPGELLNPGSIKCVENLGMPKRDNPSQYGDLYIKFC 381

Query: 422 IEFPK----DNWFNEKSEITALRNILPGLKSKDTKDPDPLNTEDVLSYS--VLHSHDELP 475
           + FP+    +      S + +  NI   ++ ++  +P    T +   Y   V  + +E+P
Sbjct: 382 VNFPERLEPETMNVISSALASDSNI---IRQENITEPSSAQTRNPDCYEEHVFSNFNEIP 438

Query: 476 D 476
           D
Sbjct: 439 D 439

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+L V    +  E++K+Y+  AL+YHPDK       E+++  F+++T AY ILSD   +
Sbjct: 8   YDLLNVSPTVSPQELKKSYKLAALRYHPDK---NGHSESAKQAFQQITEAYGILSDERKR 64

Query: 134 SRYDMYGDS 142
             YD YG S
Sbjct: 65  KIYDRYGVS 73

>TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {ON}
           Anc_8.61 YFL016C
          Length = 510

 Score = 97.1 bits (240), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 115/407 (28%), Positives = 171/407 (42%), Gaps = 64/407 (15%)

Query: 67  YDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEI 126
           Y+  + PY VLG+ KDA   EI+KAY KLA KYHPD   D+     S+  F ++T AYEI
Sbjct: 42  YNSFKDPYKVLGLNKDAKASEIKKAYYKLAKKYHPDINKDKG----SDKKFHDITNAYEI 97

Query: 127 LSDPELKSRYDMYGDSAF-------------------------GSGGNGFPEDDHEFDDF 161
           LSD + K +YD +G +AF                          +GGN F      F+D 
Sbjct: 98  LSDEKKKMQYDQFGSAAFDNSQGGGSGGFSGGNPFAGGANPFANAGGNPFGFGGINFEDL 157

Query: 162 MNFFQQYQRQQHGPHASYSNRHQYGEP-----ESKRTPDSRISYKMTTRQLYMG-KTVTF 215
                       G     S+    G P        R  +  + + ++ +    G + VT 
Sbjct: 158 FGAAFSKANGAAGRGGGRSSGRGNGSPFGGFYSEVRGDNVEVIHTLSFKDAVFGSRNVTL 217

Query: 216 QLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKG 275
            +     C  C+G+G++    +     C+SC+G G    +   AG  M    + C +C G
Sbjct: 218 NVSSIEQCKTCTGSGMKPGSHRS---ECSSCHGTGTTVHVR--AGFQMA---STCMSCGG 269

Query: 276 KGRYRKKSASDTCKHCSGKGLINEEKSQTVYI--PRGSRHGDEFRL------PQMADMEY 327
            G    +   D C++C G+G       +TV +  P G   GD  R+      P +A    
Sbjct: 270 TGENIARE--DVCRNCDGEGTEPRPVQRTVQVELPPGLVDGDVIRVAGQGGYPNIAIAPE 327

Query: 328 GKET-----GDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRL 382
            ++      GD+++ I     K    R  N+L  T  I +  A+ G   +V  T D  +L
Sbjct: 328 QRDQVKVTRGDLLVRIRVKQDKVFSIRNGNELWQTREIPVTTAVLG-GNVVIPTLDGNQL 386

Query: 383 RVNVPAGKVIRPGNYFKFKGEGWPLSNGD-SFGDMYVQ--INIEFPK 426
           R+ V +G   R G      G+G P   G  S GDM VQ  + +  PK
Sbjct: 387 RLRVRSG--TRDGETVSVPGQGVPRGRGGLSRGDMKVQWRVPVRTPK 431

>NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {ON}
           Anc_8.61
          Length = 519

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 132/429 (30%), Positives = 185/429 (43%), Gaps = 77/429 (17%)

Query: 63  SNVNYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTA 122
           S + +   + PY VLG+ K AT  EI+KAY KLA KYHPD      +  T+E  F ++  
Sbjct: 42  SAITHQEIKDPYKVLGINKSATSSEIKKAYYKLAKKYHPDI----NKEPTAEKKFHDLQN 97

Query: 123 AYEILSDPELKSRYDMYGDSAF---GSGG-----NGFPEDD--------HEFDDF-MNFF 165
           AYEILSD   KS+YD +G +AF   GSGG     N F            + F DF +NF 
Sbjct: 98  AYEILSDETKKSQYDTFGSAAFNQDGSGGASSANNPFAGGFSSSGGPGGNPFTDFGINFE 157

Query: 166 QQYQR-------------QQHGPHASYSNRHQYGEPESKRTPDSRISYKMTTRQLYMG-K 211
             +               +  G   S   R   G+P         I++++  +    G  
Sbjct: 158 DLFGAAFGGGAGTGPGGARSGGARRSNMYREFKGDPL-------EITHRIPFKDAVFGLA 210

Query: 212 TVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCD 271
            V+ +      C  C G+G+ K+  QK +  C SC+G G K  I   +G  MV   + C+
Sbjct: 211 NVSLKYNVMDPCHTCHGSGI-KQGAQKHQ--CPSCHGSGQKVHIR--SGFQMV---STCN 262

Query: 272 ACKGKGRYRKKSASDTCKHCSGKGL-INEEKSQTVYIPRGSRHGDEFRL------PQMA- 323
            C G+G     +ASD C  C G  +    + S  V +P G + GD  R+      PQMA 
Sbjct: 263 ECHGEGTIL--NASDYCGTCHGDAVEFTRDHSINVNLPNGLQDGDVIRIPGQGNYPQMAL 320

Query: 324 DMEYGKET----GDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDN 379
           D E         GDV++ I  D       +   D+  T +I +  A  G   +   T D 
Sbjct: 321 DPELKNSVKLTRGDVLVRIRVDKDNRFSIKDKYDIWFTKDIPITTAALG-GIVTIPTVDG 379

Query: 380 RRLRVNVPAG----KVIRPGNYFKFKGEGWPLS--NGDSFGDMYVQINIEFPKDNWFNEK 433
             LR+ V AG    +VI   N       G P S  N ++ G+M VQ  I   K     EK
Sbjct: 380 TTLRLKVQAGTQHDQVISIPNL------GVPRSSINKENRGNMKVQYRIVIRKPQSQAEK 433

Query: 434 SEITALRNI 442
               AL ++
Sbjct: 434 CLWEALADV 442

>NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {ON}
           Anc_8.61
          Length = 552

 Score = 94.7 bits (234), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 120/433 (27%), Positives = 179/433 (41%), Gaps = 71/433 (16%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132
           PY VLGV   A+  EI+KAY KLA KYHPD      ++  +E  F ++  AYEILSD   
Sbjct: 80  PYSVLGVNNSASTSEIKKAYYKLAKKYHPDI----NKQPDAEKKFHDLQNAYEILSDENK 135

Query: 133 KSRYDMYGDSAF--------------------------GSGGNGFPEDDHEFDDF-MNFF 165
           + +YD +G SAF                           S G+G P     F DF +NF 
Sbjct: 136 RKQYDTFGPSAFQDAQQGGAGGPGGGPGGFPGGYPFGQTSSGSGNP-----FADFGINFE 190

Query: 166 QQYQRQ-QHGPHASYSNRHQYGEP---ESKRTPDSRISYKMTTRQLYMG-KTVTFQLKRK 220
             +     +GPHA+   R +       E K  P   I + +  +    G + V  +    
Sbjct: 191 DLFGAAFGNGPHATGGGRARRQSNIYREFKGDP-IEIVHNLNFKDAVFGVQNVNLKFNSM 249

Query: 221 CLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYR 280
             C  CSG+GL +        +C SC+G G K  I   +G  MV   + C+ C G+G   
Sbjct: 250 DPCNKCSGSGLNR---NAKRTTCPSCHGSGQKVHIR--SGFQMV---STCNHCHGEGTI- 300

Query: 281 KKSASDTCKHCSGKGL-INEEKSQTVYIPRGSRHGDEFRLPQMADMEYGKET-------- 331
              + D C  C G G+ +N  KS  V +P G + GD  R+P   +      +        
Sbjct: 301 -IDSKDICSSCHGDGVELNHNKSIDVNLPNGLQDGDVIRVPGQGNYPQTGASIDPAMMNS 359

Query: 332 -----GDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNV 386
                GD+++ +  +   +   R   D+  T  I +  A+ G   +   T D  ++R+ V
Sbjct: 360 IKLSRGDLLVRVRVNKDPNFSIRDKYDIWFTKQIPITTAILG-GVVKIPTVDGTQIRLKV 418

Query: 387 PAGKVIRPGNYFKFKGEGWPLS--NGDSFGDMYVQINIEFPKDNWFNEKSEITALRNILP 444
             G   +          G P S  N D+ G+M VQ  I         EK    AL ++  
Sbjct: 419 SPG--TKHDQIISIPNLGVPRSSINKDNRGNMKVQYKIIMKTPQSQAEKCLWEALADVTN 476

Query: 445 GLKSKDTKDPDPL 457
              +K T + +P+
Sbjct: 477 DTMAKRTIEHNPI 489

>Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON}
           YFL016C (REAL)
          Length = 507

 Score = 94.0 bits (232), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 118/421 (28%), Positives = 169/421 (40%), Gaps = 58/421 (13%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132
           PYD LG++K AT  EI+KAY KLA KYHPD I  E +   +E  F ++  AYEILSD   
Sbjct: 62  PYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEPD---AEKKFHDLQNAYEILSDDTK 117

Query: 133 KSRYD-------------------------MYGDSAFGSGGNGFPEDDHEFDDFMNFFQQ 167
           + ++D                          +  S F +   G P     F+D       
Sbjct: 118 RQQFDQFGPAAFGGGGGGGAGGAGSPFGSQFHDFSGFTNASGGSPFGGINFEDLFGAAFG 177

Query: 168 YQRQQHGPHASYSNRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQLKRKCL--CPH 225
                 G     S           R     I +K++ +    G     QLK   L  C  
Sbjct: 178 GGGAGAGAGRGGSGGRSSPMYRQYRGDPIEIVHKVSFKDAVFGAK-NVQLKFSALDPCGT 236

Query: 226 CSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSAS 285
           CSGTG++    +   +SCT+C+G G       + GG+ +   + C  C G+G  ++    
Sbjct: 237 CSGTGMKPNTHK---VSCTTCHGSG---STVHVRGGFQMM--STCPTCNGEGTMKR--PQ 286

Query: 286 DTCKHCSGKGL-INEEKSQTVYIPRGSRHGDEFRLPQM---------ADME--YGKETGD 333
           D C  C G+G+  N  KS TV +P G + GD  R+P           AD++       GD
Sbjct: 287 DNCTSCHGEGVQANRGKSITVDLPHGLQDGDVVRIPGQGSYPDIAVEADLQDSIKLSRGD 346

Query: 334 VIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIR 393
           +++ I  D   S   R   D+     I +  A  G  TI   T D +++R+ V  G   +
Sbjct: 347 ILVRIRVDKDPSFSIRNKYDIWYDKEIPITTAALG-GTITIPTVDGQKIRIKVAPG--TQ 403

Query: 394 PGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEKSEITALRNILPGLKSKDTKD 453
                     G P +     GDM VQ  I   K     EK    AL ++     +K T  
Sbjct: 404 YNQVISIPNMGVPRT-ATLRGDMKVQYKIVVKKPQSLAEKCLWEALADVTNDDMAKKTMH 462

Query: 454 P 454
           P
Sbjct: 463 P 463

>Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}
           YFL016C (REAL)
          Length = 510

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 117/431 (27%), Positives = 183/431 (42%), Gaps = 69/431 (16%)

Query: 66  NYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYE 125
           N +  + PYD LG++K AT  EI+KAY KLA KYHPD I  E +   +E  F ++  AYE
Sbjct: 55  NNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEVD---AEKKFHDLQNAYE 110

Query: 126 ILSDPELKSRYD--------------------------MYGDSAFGSGGNGFPEDDHEFD 159
           ILSD   + +YD                           +  S F + G G P     F+
Sbjct: 111 ILSDENKRQQYDQFGPAAFGGGGAAGGPGSGGSPFGSQFHDFSGFTNAG-GSPFGGINFE 169

Query: 160 DFMN--FFQQYQRQQHGPHASYSNRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVTFQL 217
           D     F    +    GP +S   R   G+P         I +K++ +    G     QL
Sbjct: 170 DLFGAAFGGAGRSSGGGPRSSSMFRQYRGDP-------IEIVHKVSFKDAVFGSN-NVQL 221

Query: 218 KRKCL--CPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKG 275
           K   L  C  CSGTG++    +   ++C++C+G G       + GG+ +   + C  C G
Sbjct: 222 KFSALDPCSTCSGTGMKPNTHK---VNCSTCHGTG---TTVHIRGGFQMM--STCPTCNG 273

Query: 276 KGRYRKKSASDTCKHCSGKGL-INEEKSQTVYIPRGSRHGDEFRLPQM---------ADM 325
           +G  ++    D+C  C G+G+ +N  K+ TV +P G + GD  R+P           AD+
Sbjct: 274 EGTMKR--PQDSCTKCHGEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIAVEADL 331

Query: 326 E--YGKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLR 383
           +       GD+++ I  D   +   +   D+     I +  A  G  T+   T + +++R
Sbjct: 332 KDTVKLSRGDILVRIRVDKDPNFSIKNKYDIWYDKEIPITTAALG-GTVTIPTVEGQKIR 390

Query: 384 VNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEKSEITALRNIL 443
           + V  G   +          G P +     GDM +Q  I   K     EK    AL ++ 
Sbjct: 391 IKVAPG--TQYNQVISIPNMGVPKTTTIR-GDMKIQYKIVVKKPQSLAEKCLWEALADVT 447

Query: 444 PGLKSKDTKDP 454
               +K T +P
Sbjct: 448 NDDMAKKTMEP 458

>Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}
           YFL016C (REAL)
          Length = 517

 Score = 91.3 bits (225), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 122/481 (25%), Positives = 192/481 (39%), Gaps = 75/481 (15%)

Query: 61  TNSNVNYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEV 120
           T++  N +  + PYD LG++K AT  EI+KAY KLA KYHPD I  E +   +E  F ++
Sbjct: 50  TSAIRNDEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEPD---AEKKFHDL 105

Query: 121 TAAYEILSDPELKSRYDMYGD--------------------------SAFGSGGNGFPED 154
             AYEILSD   + +YD +G                           S F + G   P  
Sbjct: 106 QNAYEILSDESKRQQYDQFGPAAFGGGDAAGGPSGGGSPFGSQFHDFSGFSNAGGSSPFG 165

Query: 155 DHEFDDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRTPDSRISYKMTTRQLYMGKTVT 214
              F+D          +         +          R     I + ++ +    G    
Sbjct: 166 GINFEDLFGAAFGGAGRGSSSSGGGGSTRSSSMFRQYRGDPIEIVHNVSFKDAVFGSN-N 224

Query: 215 FQLKRKCL--CPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDA 272
            QLK   L  C  CSGTG++    +   ++C +C+G G       + GG+ +   + C  
Sbjct: 225 VQLKFSALDPCGTCSGTGMKPNTHK---VNCGTCHGTG---TTVHIRGGFQM--MSTCPT 276

Query: 273 CKGKGRYRKKSASDTCKHCSGKGL-INEEKSQTVYIPRGSRHGDEFRL------PQMADM 325
           C G+G  ++    D+C  C G+G+ +N  K+ TV +P G + GD  R+      P +A  
Sbjct: 277 CNGEGTMKR--PQDSCSKCHGEGVQVNRGKTITVDLPHGLQDGDVVRIPGQGSYPDIAVE 334

Query: 326 EYGKET-----GDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNR 380
           E  K++     GD+++ I  D   +   +   D+     I +  A  G  T+   T + +
Sbjct: 335 EDLKDSVKLSRGDILVRIRVDKDPNFSIKNKYDIWYNKEIPITTAALG-GTVTIPTVEGQ 393

Query: 381 RLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEKSEITALR 440
           ++R+ V  G   +          G P       GDM VQ  I   K     EK    AL 
Sbjct: 394 KIRIKVAPG--TQYNQVISIPNMGVP-KTPTIRGDMKVQYKIVVKKPQSLAEKCLWEALA 450

Query: 441 NILPGLKSKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAEEKEKYNRKQQEEPHASAFDN 500
           ++     +K T  P        +S  +L                  +KQ+EE HA   D+
Sbjct: 451 DVTNDDMAKKTMQPGAAAGATTISEEMLKK----------------QKQEEEKHAKKDDD 494

Query: 501 D 501
           +
Sbjct: 495 N 495

>YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}
           MDJ1Co-chaperone that stimulates the ATPase activity of
           the HSP70 protein Ssc1p; involved in protein
           folding/refolding in the mitochodrial matrix; required
           for proteolysis of misfolded proteins; member of the
           HSP40 (DnaJ) family of chaperones
          Length = 511

 Score = 90.9 bits (224), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 126/483 (26%), Positives = 200/483 (41%), Gaps = 85/483 (17%)

Query: 61  TNSNVNYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEV 120
           T++  N +  + PYD LG++K AT  EI+KAY KLA KYHPD I  E +   +E  F ++
Sbjct: 50  TSAIRNNEAFKDPYDTLGLKKSATGAEIKKAYYKLAKKYHPD-INKEPD---AEKKFHDL 105

Query: 121 TAAYEILSDPELKSRYD---------------------------MYGDSAFGSGGNGFPE 153
             AYEILSD   + +YD                            +  S F S G G P 
Sbjct: 106 QNAYEILSDETKRQQYDQFGPAAFGGGGAAGGAGGGSGSPFGSQFHDFSGFTSAG-GSPF 164

Query: 154 DDHEFDDFMNFFQQYQRQQHGPHASYSN--RHQYGEPESKRTPDSRISYKMTTRQLYMG- 210
               F+D          +  G  +  S+  R   G+P         I +K++ +    G 
Sbjct: 165 GGINFEDLFGAAFGGGGRGSGGASRSSSMFRQYRGDP-------IEIVHKVSFKDAVFGS 217

Query: 211 KTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVC 270
           K V  +      C  CSGTG++    +   +SC++C+G G       + GG+ +   + C
Sbjct: 218 KNVQLRFSALDPCSTCSGTGMKPNTHK---VSCSTCHGTG---TTVHIRGGFQM--MSTC 269

Query: 271 DACKGKGRYRKKSASDTCKHCSGKGL-INEEKSQTVYIPRGSRHGDEFRLPQM------- 322
             C G+G  ++    D C  C G+G+ +N  K+ TV +P G + GD  R+P         
Sbjct: 270 PTCNGEGTMKR--PQDNCTKCHGEGVQVNRAKTITVDLPHGLQDGDVVRIPGQGSYPDIA 327

Query: 323 --ADMEYGKET--GDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYD 378
             AD++   +   GD+++ I  D   +   +   D+     I +  A  G  T+   T +
Sbjct: 328 VEADLKDSVKLSRGDILVRIRVDKDPNFSIKNKYDIWYDKEIPITTAALG-GTVTIPTVE 386

Query: 379 NRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEKSEITA 438
            +++R+ V  G   +          G P ++    GDM VQ  I   K     EK    A
Sbjct: 387 GQKIRIKVAPG--TQYNQVISIPNMGVPKTSTIR-GDMKVQYKIVVKKPQSLAEKCLWEA 443

Query: 439 LRNILPGLKSKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAEEKEKYNRKQQEEPHASAF 498
           L ++                T D ++   +         + EE  K  +KQ+EE HA   
Sbjct: 444 LADV----------------TNDDMAKKTMQPGTAAGTAINEEILK-KQKQEEEKHAKKD 486

Query: 499 DND 501
           D++
Sbjct: 487 DDN 489

>Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON}
           (23785..25272) [1488 nt, 496 aa]
          Length = 495

 Score = 87.0 bits (214), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 122/475 (25%), Positives = 205/475 (43%), Gaps = 70/475 (14%)

Query: 60  LTNSNVNYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKE 119
           L NS+ ++   + PY  LGV + A++ EI+KAY KLA KYHPD I  E +   +E  F  
Sbjct: 47  LCNSDSSF---KDPYKTLGVARSASQSEIKKAYYKLAKKYHPD-INKEPD---AEKTFHN 99

Query: 120 VTAAYEILSDPELKSRYDMYGDSAF--------GSGG-NGFP------------EDDHEF 158
           +  AYEILSD + ++++D +G SAF        GSGG N F              +  + 
Sbjct: 100 LQNAYEILSDEDKRAQFDQFGASAFSQNAGPSGGSGGFNPFANGNGGGFGDFGGLNFEDL 159

Query: 159 DDFMNFFQQYQRQQHGPHASYSNRHQYGEPESKRTPDSRISYKMTTRQLYMG-KTVTFQL 217
                      R   G  +  +   +Y      +     I + ++ +    G   V+   
Sbjct: 160 FGAAFGGGASGRSNGGFGSRVNMVREY------KGDTIEIIHNLSFKDAVFGVNNVSLTF 213

Query: 218 KRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKG 277
                C  C G+GL+K    K   SC+ CNG G   +I   +G  M    + C+ C G+G
Sbjct: 214 NALDPCDTCHGSGLKKGENHKRR-SCSYCNGTG--TQIHVRSGFQMA---STCNHCHGEG 267

Query: 278 RYRKKSASDTCKHCSGKGL-INEEKSQTVYIPRGSRHGDEFRL------PQMADMEYGKE 330
                +  D C  C G G+ ++ +K   V +P     GD  R+      P +A  E  K+
Sbjct: 268 TI--IAFEDMCTKCHGDGVKLDAQKKINVNLPSSLSDGDVIRIPGEGSFPNIAVPEEDKD 325

Query: 331 -----TGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVN 385
                 GD+++ I       +  +   D+ +   I +  A  G  TI  +T D++++R+ 
Sbjct: 326 RVKLSRGDLLVRIRVKPDPDYTIKNKYDIWSVKEIPITTAALG-GTITIKTIDDKQIRLK 384

Query: 386 VPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDN-------W---FNEKSE 435
           V AG   +          G P  NG   GDM +Q  +   K +       W    +   +
Sbjct: 385 VMAG--TQHDQVTSIPNMGVPRRNGLGRGDMKIQYKVVIRKPSTEVETCLWEALADVSKD 442

Query: 436 ITALRNILPGLKSKDTKDPDPLNTEDVLSYSVLHSHDELPDYLAEEKEKYNRKQQ 490
            TA R +   + S + +D    N++D  S + +++  ++ ++++E  +K   K+Q
Sbjct: 443 TTAKRTMSNSILSSNPEDTTKTNSKD--SSTDVNTLKKIENFISETFKKIKGKKQ 495

>ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {ON}
           similar to uniprot|Q752R6 Ashbya gossypii AFR507W
           AFR507Wp and some similarites with YFL016C
           uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 462

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 121/420 (28%), Positives = 171/420 (40%), Gaps = 68/420 (16%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132
           PYD LGV K A+  EI+KAY KLA KYHPD   ++   +     F ++  AYEILSD + 
Sbjct: 34  PYDTLGVGKSASPSEIKKAYYKLAKKYHPDINKEQGAGDK----FHDLQNAYEILSDADK 89

Query: 133 KSRYD------------------------MYGD-SAFGS-GGNGFPEDDHEFDDFMNFFQ 166
           KS+YD                         + D S FG+ GG  F     +         
Sbjct: 90  KSQYDQFGAAAFGQGGAGGGPGGPGAGYGGFSDFSGFGNFGGINF----EDLFGAAFGGG 145

Query: 167 QYQRQQHGPHASYSNRHQYGEPESKRTPDSRISYKMTTRQLYMG-KTVTFQLKRKCLCPH 225
             +  +  P  S   R   G+P         +SY+M  +    G K V  + +    C  
Sbjct: 146 GGRSSRGSPFGSSMFREYRGDP-------IEVSYRMPFKDAVFGAKDVNLKFRALDPCHT 198

Query: 226 CSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKKSAS 285
           C G+G+  K   KP+ SC SC+G G    +   AG  M    T C  C G+G   K+   
Sbjct: 199 CDGSGM--KTGAKPQ-SCPSCHGTGTTVHVR--AGFQMA---TTCQQCGGEGTTTKR--E 248

Query: 286 DTCKHCSGKGL-INEEKSQTVYIPRGSRHGDEFRLPQMA---DMEYGKET--------GD 333
           D C  C G G+   ++KS  V +P+G + GD  R+P      +M    E         GD
Sbjct: 249 DLCGSCHGDGVEWTKDKSVRVDLPQGLQDGDVVRVPGQGSYPNMAVPPEMKSSIRLRRGD 308

Query: 334 VIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIR 393
           V++ I  D       R   D+    +I +  A  G  T+   T D   +R+ V  G   +
Sbjct: 309 VLVRIRVDKDPRFSIRDKWDIWFIQDIPITTAALG-GTVQVPTVDGSHVRLRVQPG--TQ 365

Query: 394 PGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEKSEITALRNILPGLKSKDTKD 453
                     G P   G + G M VQ  I+  K     E+    AL NI     +K T++
Sbjct: 366 HDQIISIPNMGVPRVAG-TRGSMKVQYKIQVKKPQSKAERCLWEALANITNDSNAKRTEN 424

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.218
           YNL077W
          Length = 554

 Score = 84.7 bits (208), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 80/276 (28%), Positives = 117/276 (42%), Gaps = 37/276 (13%)

Query: 191 KRTPDSRISYKMTTRQLYMGKTVTFQLKRKCLCPHCSGTG-LRKKHFQKPEISCTSCNGQ 249
           KR PD + + K T   LY GK    +L+R   C  C G G L  K       SC+ CNG+
Sbjct: 228 KRGPDIKHTLKCTLSNLYSGKRSKLRLERTRCCLKCKGFGSLNIK-------SCSKCNGR 280

Query: 250 GFKERITRLAGGYMVKDHT-VCDACKGKGRYRKKSASDTCKHCSGKGLINEEKSQTVYIP 308
           G   +  +   G M +  T  CD C G G +    A D C  C G+G +NE+K   V I 
Sbjct: 281 GSLTQTKKF--GPMTQTFTQTCDGCGGNGTF--ADAQDICNECQGEGFLNEKKIFEVEIT 336

Query: 309 RGSRHGDEFRLPQMAD----MEYGKE---TGDVIIVIDEDSSKSHLERKSND-LHTTLNI 360
            G   G    L   AD       GKE    GD+I+ I+     +    +  D L+    I
Sbjct: 337 PGMTDGQLIILTGEADEVISTNLGKERVIPGDIILTINLLPDPTFKVVQGADLLYANYKI 396

Query: 361 SLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWP---LSNGDSF---- 413
           +L+ +L G S  +        +++N+  G++I+ G     +  G P   LS G S     
Sbjct: 397 NLLTSLCGGSIYIKNHPSEHLIKINIIPGELIKNGAIKTVENLGMPKIDLSVGHSNDIQA 456

Query: 414 ------GDMYVQINIEFPKDNWFNEKSEITALRNIL 443
                 G++ +   I +P      E   +  L+NIL
Sbjct: 457 NKPTLKGNLVIHFEIVYPD---MLETDTVIELQNIL 489

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 3/67 (4%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+L V  D+ E  I+KAYR LALKYHPDK       E S+ MF++++ AY +LS+ + +
Sbjct: 8   YDILQVRYDSDESVIKKAYRTLALKYHPDK---NNLSEESKQMFQKISEAYVVLSNKDKR 64

Query: 134 SRYDMYG 140
             YD YG
Sbjct: 65  QMYDKYG 71

>Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016C
           (MDJ1) - DnaJ homolog involved in mitochondrial
           biogenesis and protein folding [contig 202] FULL
          Length = 478

 Score = 82.0 bits (201), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 111/415 (26%), Positives = 169/415 (40%), Gaps = 59/415 (14%)

Query: 67  YDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEI 126
            D  + PY  LGV   AT  EI+KAY KLA KYHPD  I++A    ++  F ++  AYEI
Sbjct: 34  LDELKDPYSTLGVSNSATSSEIKKAYYKLAKKYHPD--INKA--ADAQKKFHDLQNAYEI 89

Query: 127 LSDPELKSRYDMYGDSAFGSGGNGFPEDDH--------------------------EFDD 160
           LSD   + ++D YG +AF  G  G                                 F+D
Sbjct: 90  LSDDCKRQQWDQYGPAAFSQGDAGPSGAGGGAEGFGGFGGFGGGGFGGAGGGFGGINFED 149

Query: 161 FMNFFQQYQRQQHGPHASYSNRHQYGEPESKRTPDS-RISYKMTTRQLYMGKTVTFQLKR 219
                        G     S    Y E +      S RIS+K +   ++  K V  +   
Sbjct: 150 LFGAAFGGGAGGAGGAGGRSRGSMYREYQGSPIEISHRISFKDS---VFGTKNVNLKYSA 206

Query: 220 KCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRY 279
              C  C G+GL+    +    +C  C+G G   R+   AG  M    + C+ C G+G  
Sbjct: 207 YDPCNTCDGSGLKPGASRS---TCPGCSGTG--TRVHVRAGFQMA---STCNQCGGEGSV 258

Query: 280 RKKSASDTCKHCSGKGL-INEEKSQTVYIPRGSRHGDEFRL------PQMADMEYGKET- 331
            +   +DTC+ C G+G  +++     V +P G + GD  R+      P +A     K+T 
Sbjct: 259 LRD--ADTCQTCHGEGAKLDKNHELKVDLPHGLQDGDVIRISGKGSYPNIAVDPAMKDTV 316

Query: 332 ----GDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVP 387
               GD+++ I  D       +   D+  T +I +  A  G   +   T D  ++R+ V 
Sbjct: 317 RLSRGDLLLRIRVDKDPRFQIKNKYDIWFTQDIPITTAALG-GVVTIPTVDGEQVRLKVS 375

Query: 388 AGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEKSEITALRNI 442
            G   +  +      +G P  +  + GDM VQ  +   K     EK    AL +I
Sbjct: 376 PG--TQHHDVVSIPQKGVPRGSFGTRGDMKVQYRVVIKKPQSQAEKCLWEALADI 428

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {ON}
           Anc_1.398 YNL007C
          Length = 353

 Score = 77.8 bits (190), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 58/106 (54%), Gaps = 17/106 (16%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A++ EI+K YRK ALKYHPDK   + E+      FKE++ A+EILSD   +
Sbjct: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILSDSNKR 61

Query: 134 SRYDMYGDSAFGSGGNGFPEDD---------HEF--DDFMNFFQQY 168
           S YD YG  A  +GG  F             H F  DD  N F Q+
Sbjct: 62  SVYDQYGLDAARNGGPSFQGQSGFPGGGGSTHSFSNDDAFNIFSQF 107

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.217
           YER048C
          Length = 387

 Score = 75.5 bits (184), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 67/123 (54%), Gaps = 18/123 (14%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YDVLGV   AT +EI+KAYRK A++ HPDK  D+ E ET    F+ V  AY++LSD EL+
Sbjct: 8   YDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDPEAETK---FQAVGEAYQVLSDTELR 64

Query: 134 SRYDMYG-DSA------------FGS--GGNGFPEDDHEFDDFMNFFQQYQRQQHGPHAS 178
           SRYD +G D A            F +  GG+GF +   EF  F +     +    G +A 
Sbjct: 65  SRYDQFGKDDAVPQQGFEDAEEYFSAIFGGDGFKDWIGEFSLFKDLNDASEMMDKGQNAE 124

Query: 179 YSN 181
             N
Sbjct: 125 APN 127

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
           Anc_7.217 YER048C
          Length = 389

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 54/76 (71%), Gaps = 4/76 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YDVLG++ DAT  EI+KAYR+ A++ HPDK  D+ +   +++ F+ V  AY++LSDP+LK
Sbjct: 8   YDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDPD---AQSKFQAVGEAYQVLSDPQLK 64

Query: 134 SRYDMYG-DSAFGSGG 148
           SRYD +G D A    G
Sbjct: 65  SRYDQFGKDDAVPQAG 80

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217
          Length = 387

 Score = 75.1 bits (183), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 62/106 (58%), Gaps = 18/106 (16%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YDVLGV+  AT  EI+KAYR+ A++ HPDK  D+ E   ++A F+EV  AY++LSDP L+
Sbjct: 8   YDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDPE---AQAKFQEVGEAYQVLSDPGLR 64

Query: 134 SRYDMYG-DSAFGS--------------GGNGFPEDDHEFDDFMNF 164
           SRYD +G D A                 GG+GF +   EF  F  F
Sbjct: 65  SRYDEFGKDEAVPQQGFEDANEYFTAIFGGDGFKDWIGEFSLFKEF 110

>CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016c MDJ1
           heat shock protein - chaperone
          Length = 522

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 116/261 (44%), Gaps = 27/261 (10%)

Query: 207 LYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKD 266
           ++  K V+ + +    C  C+G+GL+       + +C SC+G G    +   AG  M+  
Sbjct: 207 VFGKKNVSIKFRALDPCGTCNGSGLKSG---ASKTTCPSCHGSGTTVHVR--AGFQMM-- 259

Query: 267 HTVCDACKGKGRYRKKSASDTCKHCSGKGL-INEEKSQTVYIPRGSRHGDEFRLPQMA-- 323
            + C  C G+G     +ASD CK C G+G+ +N +K+ TV +P G + GD  R+P     
Sbjct: 260 -STCQTCGGEGT--TVNASDFCKSCHGEGVNVNTQKTITVDLPHGLQDGDVVRIPGQGSY 316

Query: 324 -DMEYGKET--------GDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVC 374
            D+   KE         GD+++ I  +       +   D+  T  I +  A  G  T+  
Sbjct: 317 PDIAVDKEMAKSVKLSRGDILVRIRVNKDPHFSIKNKYDIWYTKEIPITTAALG-GTVSI 375

Query: 375 ETYDNRRLRVNVPAG----KVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWF 430
            T +  ++R+ VPAG    +VI   N    K   +  S   + GDM +Q  +   K    
Sbjct: 376 PTIEGTKIRIKVPAGTAPEQVISIPNMGVPKSSPYRNSAVQARGDMKIQYKVVIRKPQSK 435

Query: 431 NEKSEITALRNILPGLKSKDT 451
            E+    AL ++     +K T
Sbjct: 436 AEQCLWEALADVTNDTNAKRT 456

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 44/65 (67%), Gaps = 4/65 (6%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132
           PY+ LGV+K +++ +I+KAY KLA KYHPD I  EA    +E  F ++  AYEILSD   
Sbjct: 48  PYETLGVKKSSSQSDIKKAYYKLAKKYHPD-INKEA---GAEKKFHDLQNAYEILSDESK 103

Query: 133 KSRYD 137
           + +YD
Sbjct: 104 RKQYD 108

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {ON}
           similar to uniprot|P39101 YER048C Saccharomyces
           cerevisiae CAJ1 Nuclear type II J heat shock protein of
           the E. coli dnaJ family
          Length = 395

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 58/92 (63%), Gaps = 11/92 (11%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LG++ DA+  EI+KAYRK A+  HPDK  D+ E   ++A F+ +  AY++LSDPEL+
Sbjct: 8   YDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDPE---AQAKFQAIGQAYQVLSDPELR 64

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFF 165
           SRYD +G        +  P+    F+D   FF
Sbjct: 65  SRYDEFGKE------DAVPQ--QGFEDAAEFF 88

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 3/67 (4%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YDVLGV+ DAT  +I+KAYRK A++ HPDK  ++ E   ++A F+EV+ AY++LSD EL+
Sbjct: 8   YDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPNDPE---AQAKFQEVSKAYKVLSDGELR 64

Query: 134 SRYDMYG 140
           SRYD  G
Sbjct: 65  SRYDEVG 71

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
           YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
           82] FULL
          Length = 353

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A E E++K YRK ALKYHPDK   +AE+      FKE++ A+EIL+DP+ +
Sbjct: 8   YDLLGVSPSAQETELKKGYRKAALKYHPDKPSGDAEK------FKEISEAFEILNDPQKR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EVYDTYGLEA 71

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 72/151 (47%), Gaps = 15/151 (9%)

Query: 280 RKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQMADMEYGKETG--DVIIV 337
           +KKS   T K   G G  +E++   + +  G + G +       D  Y   TG    +  
Sbjct: 198 KKKSFKITRK---GPGGASEKQQVDIQLKPGWKAGTKITYKNEGD--YNPRTGRRQTLQF 252

Query: 338 IDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKV--IRPG 395
           I ++   S+  R  NDL  +L ++  ++L GFS  + +T D R L    P  +V  ++P 
Sbjct: 253 ILQEKPHSNYTRDGNDLIYSLPLTFKESLLGFSKTI-QTIDGRTL----PISRVQPVQPS 307

Query: 396 NYFKFKGEGWPLSNGDS-FGDMYVQINIEFP 425
           +   + G+G P++   S  G++ V+  I++P
Sbjct: 308 DSSTYPGQGMPIAKTPSQRGNLIVKYKIDYP 338

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
           {ON} some similarities with uniprot|P25294 Saccharomyces
           cerevisiae YNL007C SIS1 HSP40 family chaperone sit4
           suppressor dnaJ homolog
          Length = 350

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A E E++K YRK ALKYHPDK   +AE+      FKE++ A+EIL+DP+ +
Sbjct: 8   YDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDAEK------FKEISEAFEILNDPQKR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EIYDNYGLEA 71

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 53/105 (50%), Gaps = 10/105 (9%)

Query: 326 EYGKETG--DVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLR 383
           +Y   TG    +  I ++    +  R  NDL  TL ++  ++L GF+  + +T D R L 
Sbjct: 236 DYNPRTGRRQTMQFIIQEKPHENYTRDGNDLIYTLPLTFKESLLGFNKTI-QTIDGRTL- 293

Query: 384 VNVPAGKV--IRPGNYFKFKGEGWPLS-NGDSFGDMYVQINIEFP 425
              P  +V  ++P +   + G+G P++ N    G++ V+  I++P
Sbjct: 294 ---PISRVQPVQPSDVSTYPGQGMPVAKNPSQRGNLIVKYKIDYP 335

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {ON}
           highly similar to uniprot|P25294 Saccharomyces
           cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 46/70 (65%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LG+   A E EI+K YRK ALKYHPDK   + E+      FKE++ A+EILSDP+ +
Sbjct: 8   YDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILSDPQKR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EVYDQYGLEA 71

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 48/103 (46%), Gaps = 6/103 (5%)

Query: 326 EYGKETG--DVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLR 383
           +Y   TG    +  I ++       R  NDL  TL ++  ++L GF+  + +T D R L 
Sbjct: 235 DYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTI-QTIDGRTLP 293

Query: 384 VNVPAGKVIRPGNYFKFKGEGWPLSNGDS-FGDMYVQINIEFP 425
           V+    + I+P     + G+G P+       GDM V   +++P
Sbjct: 294 VS--RIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYP 334

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 50/67 (74%), Gaps = 3/67 (4%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGVE DAT  EI+KAYR+ A++ HPDK  D+ +   ++A F+ V  AY++LSDP L+
Sbjct: 8   YDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDPD---AQAKFQAVGEAYQVLSDPGLR 64

Query: 134 SRYDMYG 140
           SRYD +G
Sbjct: 65  SRYDEFG 71

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
           (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 59/92 (64%), Gaps = 11/92 (11%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV+ +AT  EI+KAYR+ A++ HPDK  D+ E   +++ F+ V  AY++LSDP L+
Sbjct: 8   YDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDPE---AQSKFQAVGEAYQVLSDPGLR 64

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFF 165
           SRYD +G        +  P+  H F+D   FF
Sbjct: 65  SRYDEFGKD------DAVPQ--HGFEDATEFF 88

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTAAYEILSD 129
           PY++LGV   +TE EI+KAYR L+LK+HPDK+   + E ER + E +F +++ AYE L++
Sbjct: 122 PYEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEIFVQISKAYEALTN 181

Query: 130 PELKSRYDMYG 140
           P  K  Y +YG
Sbjct: 182 PATKENYLLYG 192

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {ON}
           some similarities with uniprot|P25294 Saccharomyces
           cerevisiae YNL007C SIS1 HSP40 family chaperone sit4
           suppressor dnaJ homolog
          Length = 357

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/78 (48%), Positives = 48/78 (61%), Gaps = 6/78 (7%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A E E++K Y+K ALKYHPDK   + E+      FKE++ AYEILSD   +
Sbjct: 8   YDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDTEK------FKEISEAYEILSDSSKR 61

Query: 134 SRYDMYGDSAFGSGGNGF 151
             YD YG  A  +GG  F
Sbjct: 62  EIYDQYGLEAARNGGPAF 79

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
           Anc_1.398
          Length = 363

 Score = 72.4 bits (176), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 47/75 (62%), Gaps = 6/75 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A E EI+K YRK ALKYHPDK   + E+      FK+++ AYEILSD   +
Sbjct: 8   YDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDTEK------FKQISEAYEILSDSNKR 61

Query: 134 SRYDMYGDSAFGSGG 148
             YD YG  A  +GG
Sbjct: 62  EIYDQYGLEAARNGG 76

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {ON}
           Anc_2.15 YNL227C
          Length = 626

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 54/82 (65%), Gaps = 2/82 (2%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++LGVE +AT+VE++KAYR+ AL++HPDK  D  E  T  A+F  V AAYE+L+DP+ +
Sbjct: 6   YELLGVETNATDVELKKAYRRKALQFHPDKNPDNVEETT--AIFASVRAAYEVLADPQER 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDD 155
           + YD + +       N    DD
Sbjct: 64  AWYDDHKEQILNDSVNLDDADD 85

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398
          Length = 367

 Score = 72.0 bits (175), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 6/75 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+L V+  A E E++K YRK ALKYHPDK   + E+      FKE++ A+EIL+DP+ +
Sbjct: 8   YDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILNDPQKR 61

Query: 134 SRYDMYGDSAFGSGG 148
             YD YG  A  +GG
Sbjct: 62  EIYDQYGLEAARNGG 76

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {ON}
           YER048C (CAJ1) - homologous to E. coli DnaJ [contig 197]
           FULL
          Length = 393

 Score = 72.0 bits (175), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 58/92 (63%), Gaps = 11/92 (11%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LG++ DA+  +I+KAYRK A+  HPDK  D+ E   ++A F+ +  AY++LSDP+L+
Sbjct: 8   YDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDPE---AQAKFQAIGEAYQVLSDPDLR 64

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFF 165
           SRYD +G        N  P+    F+D   FF
Sbjct: 65  SRYDEFGKE------NAVPQ--QGFEDAAEFF 88

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 72.8 bits (177), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 69/135 (51%), Gaps = 17/135 (12%)

Query: 9   KYSERFSSSKPYVFFTTGRFSVLHIWKYQMFKKQYEQEGHVDEEGAIGCTRLTNSNVNYD 68
           K+  +F S    +F  T  F  +  W       Q         E AIG         ++D
Sbjct: 71  KFRSKFESKTSNLFNWTNLFICVG-WLVVAMLVQVISNNDKIREAAIG---------SFD 120

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTAAYE 125
               PYD+LGV   A++ EI+ AYRKL+LK+HPDK+   I E E+ + E M+ +++ AYE
Sbjct: 121 ----PYDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYE 176

Query: 126 ILSDPELKSRYDMYG 140
            L+D  +K  Y MYG
Sbjct: 177 ALTDELVKQNYLMYG 191

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (65%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A++ E++K YRK ALKYHPDK   + E+      FKE++ A+EILSDP  +
Sbjct: 8   YDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILSDPNKR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EVYDTYGLEA 71

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 40/149 (26%), Positives = 69/149 (46%), Gaps = 11/149 (7%)

Query: 280 RKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQMADMEYGKETG--DVIIV 337
           ++KS   T K  +G   I E+K   + +  G + G +       D  Y   TG    I  
Sbjct: 194 KRKSFKITRKGQTG---IPEKKQIDIQLRPGWKAGTKITYKNEGD--YNPSTGGRQTIQF 248

Query: 338 IDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNY 397
           I ++      +R  NDL  TL ++  ++L GF   V  T D R++ ++    + ++P   
Sbjct: 249 IIQEKPHEFFKRDGNDLIYTLPLTFKESLLGFDKTV-RTIDGRQISIH--KTQPVQPSEE 305

Query: 398 FKFKGEGWPLS-NGDSFGDMYVQINIEFP 425
            ++ G+G PLS N    GD+ V+   ++P
Sbjct: 306 MRYPGQGMPLSKNPSERGDLIVKYKTDYP 334

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
           SIS1Type II HSP40 co-chaperone that interacts with the
           HSP70 protein Ssa1p; not functionally redundant with
           Ydj1p due to due to substrate specificity; shares
           similarity with bacterial DnaJ proteins
          Length = 352

 Score = 71.6 bits (174), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (65%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A E E++K YRK ALKYHPDK   + E+      FKE++ A+EIL+DP+ +
Sbjct: 8   YDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILNDPQKR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EIYDQYGLEA 71

 Score = 38.9 bits (89), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 53/105 (50%), Gaps = 10/105 (9%)

Query: 326 EYGKETG--DVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLR 383
           +Y  +TG    +  + ++ S  + +R  +DL  TL +S  ++L GFS  + +T D R L 
Sbjct: 238 DYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTI-QTIDGRTL- 295

Query: 384 VNVPAGKV--IRPGNYFKFKGEGWPLS-NGDSFGDMYVQINIEFP 425
              P  +V  ++P     + G+G P   N    G++ V+  +++P
Sbjct: 296 ---PLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 337

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
           {ON} Anc_1.398 YNL007C
          Length = 369

 Score = 71.6 bits (174), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (62%), Gaps = 6/78 (7%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A E E++K YRK ALKYHPDK   + E+      FKE++ A+EIL+D + +
Sbjct: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILNDSQKR 61

Query: 134 SRYDMYGDSAFGSGGNGF 151
             YD YG  A  +GG  F
Sbjct: 62  EIYDQYGLEAARNGGPAF 79

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {ON}
           YNL007C (REAL)
          Length = 359

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (65%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A E E++K YRK ALKYHPDK   + E+      FKE++ A+EIL+DP+ +
Sbjct: 8   YDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILNDPQKR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EIYDQYGIEA 71

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 47/91 (51%), Gaps = 8/91 (8%)

Query: 338 IDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKV--IRPG 395
           + ++ S  + +R  +DL  TL +S  ++L GFS  + +T D R L    P  +V  ++P 
Sbjct: 259 VIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTI-QTIDGRTL----PLSRVQPVQPS 313

Query: 396 NYFKFKGEGWPL-SNGDSFGDMYVQINIEFP 425
               + G+G P   N    G++ V+  +++P
Sbjct: 314 QTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 344

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A E E++K YRK ALKYHPDK   + E+      FKE++ A+EIL+DP  +
Sbjct: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILNDPNTR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EVYDQYGLEA 71

 Score = 38.1 bits (87), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 52/99 (52%), Gaps = 7/99 (7%)

Query: 328 GKETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVP 387
           G++T   +I   ++ +    +R  +DL   L +S  ++L GFS  +  T D R+L ++  
Sbjct: 220 GRKTLQFVI---QEKAHPDFKRDGDDLIYILRLSFKESLLGFSKTI-NTIDGRKLPLS-- 273

Query: 388 AGKVIRPGNYFKFKGEGWPLS-NGDSFGDMYVQINIEFP 425
             + I+P     + G+G P+S N    G++ ++  I++P
Sbjct: 274 RSQPIQPTEISTYPGQGMPVSKNPSQRGNLIIKYKIDYP 312

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {ON}
           similar to gnl|GLV|CAGL0H03707g Candida glabrata
           CAGL0H03707g and some similarites with YNL007C
           uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
           HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LG+   A E EI+K YRK ALKYHPDK   + E+      FKE++ A+EILSD + +
Sbjct: 8   YDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILSDAQKR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EVYDTYGLEA 71

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 68/149 (45%), Gaps = 11/149 (7%)

Query: 280 RKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQMADMEYGKETG--DVIIV 337
           +KKS   T K   G G ++E+    + +  G + G +       D  Y   TG    +  
Sbjct: 199 KKKSFKITRK---GAGGVSEKNQIDIQLKPGWKAGTKITFKGEGD--YNPRTGGRQTLQF 253

Query: 338 IDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNY 397
           + ++       R+ NDL  TL +S  ++L GFS  V +T D + + +     + I+P   
Sbjct: 254 VLQEKPHEFFTRQDNDLIYTLPLSFKESLLGFSKQV-QTIDGKTIPIT--RTQPIQPTQT 310

Query: 398 FKFKGEGWPLS-NGDSFGDMYVQINIEFP 425
             + G+G  LS N    GD+ ++  I++P
Sbjct: 311 STYPGQGMTLSKNPSQRGDLIIKFKIDYP 339

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.217
           YER048C
          Length = 380

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 58/93 (62%), Gaps = 13/93 (13%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YDVLGV  +AT  +I+KAYRK A++ HPDK  D+ E   +++ F+ V  AY++LSDP L+
Sbjct: 8   YDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDPE---AQSKFQAVGEAYQVLSDPGLR 64

Query: 134 SRYDMYG-DSAFGSGGNGFPEDDHEFDDFMNFF 165
           S+YD +G D A  + G         F+D   FF
Sbjct: 65  SKYDQFGKDDAVPNAG---------FEDAQEFF 88

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
           to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
           HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (65%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A E E++K YRK ALKYHPDK   + E+      FKE++ A+EIL+DP+ +
Sbjct: 8   YDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILNDPQKR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EIYDSYGLEA 71

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 72/151 (47%), Gaps = 15/151 (9%)

Query: 280 RKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQMADMEYGKETG--DVIIV 337
           RKKS   T K   G G + E+K   + +  G + G +       D  Y ++TG    +  
Sbjct: 193 RKKSFKITRK---GPGSVPEKKQIDIQMKPGWKAGTKITFKNEGD--YNQQTGGRQTMQF 247

Query: 338 IDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKV--IRPG 395
           + ++    H +R  N+L  TL +S  ++L GFS  + +T D R L    P  +V  I+P 
Sbjct: 248 VIQEKLHPHFKRDGNNLIYTLPLSFKESLLGFSKTI-QTIDGRTL----PISRVQPIQPS 302

Query: 396 NYFKFKGEGWPLSNGDS-FGDMYVQINIEFP 425
               + G+G PL    +  GD+ ++  +++P
Sbjct: 303 ETSTYPGQGMPLPKTPAQRGDLIIKYKVDYP 333

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {ON}
           YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 64/121 (52%), Gaps = 17/121 (14%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++LGVE  A++ +++KAYRK AL YHPDK  D  E  T  A+F  + AAYE+L+DP+ +
Sbjct: 6   YELLGVETTASDADLKKAYRKKALVYHPDKNRDNVEEAT--AIFATIRAAYEVLADPQER 63

Query: 134 SRYDMYGDSAF----GSGGNGFPEDDHEF---------DDFMNFFQQ--YQRQQHGPHAS 178
           + YD +         G   +G   D++E          DD + FF    Y R+   P   
Sbjct: 64  AWYDSHKQQILSDDIGMTNDGEEYDEYEVDATVTGITTDDLLKFFNSGLYSRKDDSPAGF 123

Query: 179 Y 179
           Y
Sbjct: 124 Y 124

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
           YER048C (REAL)
          Length = 391

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 50/67 (74%), Gaps = 3/67 (4%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LG++ DAT  EI+KAYR+ A++ HPDK  D+ +   ++A F+ V  AY++LSDP L+
Sbjct: 8   YDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDPGLR 64

Query: 134 SRYDMYG 140
           S+YD +G
Sbjct: 65  SKYDEFG 71

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (60%), Gaps = 8/97 (8%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
           M    Y++LGVE  A++ E++KAYRK AL++HPDK  D  +  T    F  + AAYE+LS
Sbjct: 1   MKTCYYELLGVEVTASDAELKKAYRKKALQFHPDKNPDNVDEATEN--FATIRAAYEVLS 58

Query: 129 DPELKSRYD-----MYGDSAFGSGGNGFPED-DHEFD 159
           DP+ ++ YD     +  DS  G+  +G+ +D DH  D
Sbjct: 59  DPQERAWYDAHKEQILNDSPIGTAEDGYYDDEDHVVD 95

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {ON}
           Anc_7.217 YER048C
          Length = 366

 Score = 69.3 bits (168), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 69/133 (51%), Gaps = 15/133 (11%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YDVLGV   A+ +EI+KAYRK A++ HPDK  D+ +   ++A F+ V  AY++LSD EL+
Sbjct: 8   YDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDPD---AQAKFQRVGEAYQVLSDEELR 64

Query: 134 SRYDMYGDSAFGSGGNGFPEDD---------HEFDDFMNFFQQYQRQQHGPHASYSNRHQ 184
            RYD +G   +     GF +             F D++  F  +  +Q    A      +
Sbjct: 65  KRYDEFGKD-YAIPQQGFTDAQEYFTAIFGGESFGDWIGEFSIF--KQMNEMAEKEQEQE 121

Query: 185 YGEPESKRTPDSR 197
            G P+ K T + R
Sbjct: 122 QGGPDGKMTKEQR 134

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {ON}
           Anc_1.398 YNL007C
          Length = 363

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (62%), Gaps = 6/75 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A E E++K YRK ALKYHPDK   + E+      FKE++ A+EIL+D + +
Sbjct: 8   YDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDTEK------FKEISEAFEILNDKQKR 61

Query: 134 SRYDMYGDSAFGSGG 148
             YD YG  A   GG
Sbjct: 62  EIYDQYGLEAARQGG 76

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 43/79 (54%), Gaps = 4/79 (5%)

Query: 348 ERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPL 407
           +R  +DL  TL ++  ++L GFS  + +T D R L ++      ++P    ++ G+G P+
Sbjct: 273 KRNGDDLEYTLPLTFKESLLGFSKTI-QTIDGRTLPLS--RSSPVQPTETSRYPGQGMPM 329

Query: 408 SNGDS-FGDMYVQINIEFP 425
               S  GD+ V+  I++P
Sbjct: 330 PKMPSQRGDLVVRFKIDYP 348

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
           (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 44/70 (62%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+L V   A E EI+K YRK ALKYHPDK   + E+      FKE++ A+EILSD E +
Sbjct: 8   YDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILSDAEKR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EVYDQYGLKA 71

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
           similar to Ashbya gossypii AAL008W
          Length = 347

 Score = 68.6 bits (166), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV  +  + E++K YRK ALKYHPDK   + E+      FKE++ A+EIL+DP  +
Sbjct: 8   YDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILNDPNKR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EVYDKYGLEA 71

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 72/149 (48%), Gaps = 11/149 (7%)

Query: 280 RKKSASDTCKHCSGKGLINEEKSQTVYIPRGSRHGDEFRLPQMADMEYGKETG--DVIIV 337
           ++KS   T K  SG   I E+K   + +  G + G +       D  Y   TG    +  
Sbjct: 192 KRKSFKITRKGPSG---IPEKKQIDIQLRPGWKAGTKITYKNEGD--YNPSTGGRQTLQF 246

Query: 338 IDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNY 397
           I ++     L+R  NDL  TL +S  ++L GFS  V  T D R++ ++    + ++P   
Sbjct: 247 IIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTV-HTIDGRQIFIS--KTQPVQPSEE 303

Query: 398 FKFKGEGWPLS-NGDSFGDMYVQINIEFP 425
            ++ G+G PLS N    GD+ V+  I++P
Sbjct: 304 SRYPGQGMPLSKNPSERGDLIVKYKIDYP 332

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.398
           YNL007C
          Length = 359

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (62%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A + EI+K YRK ALKYHPDK   + E+      FKE++ A+EILSD   +
Sbjct: 8   YDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILSDKNKR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EVYDQYGLQA 71

 Score = 37.4 bits (85), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 66/136 (48%), Gaps = 8/136 (5%)

Query: 293 GKGLINEEKSQTVYIPRGSRHGDEFRLPQMADMEYGKETG--DVIIVIDEDSSKSHLERK 350
           G+G I E+    + +  G + G +       D  Y  +TG    +  + ++ +    +R+
Sbjct: 214 GQGGIPEKTQIDIQLKPGWKAGTKITYKSQGD--YNPQTGGRKTLQFMLQEKNHPVFKRE 271

Query: 351 SNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNG 410
            +DL  TL ++  ++L GF+  + +T D R L ++    + I+P     + G+G P+   
Sbjct: 272 GDDLTCTLPLTFKESLLGFNKQI-QTIDGRTLPIS--RTQPIQPSETSVYPGQGMPIPKT 328

Query: 411 DS-FGDMYVQINIEFP 425
            S  G++ V+  I++P
Sbjct: 329 PSQRGNLIVRYKIDYP 344

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} similar
           to uniprot|P53863 Saccharomyces cerevisiae YNL227c
          Length = 623

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 49/66 (74%), Gaps = 2/66 (3%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+L V  DA++++++KAYR+ AL+YHPDK  D  E  T+  +F E+ AAYE+LSDP+ +
Sbjct: 6   YDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNVEEATT--IFAEIRAAYEVLSDPQER 63

Query: 134 SRYDMY 139
           + YD +
Sbjct: 64  AWYDSH 69

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 59/93 (63%), Gaps = 6/93 (6%)

Query: 54  AIGCTRLTNSNVNYDMAQ---TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDE 107
           ++   R++N++   + A     PY++LG+   A+E +I+ AYRKL++K+HPDK+   + E
Sbjct: 108 SVLVQRISNNDAIKEAASGMFDPYELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSE 167

Query: 108 AERETSEAMFKEVTAAYEILSDPELKSRYDMYG 140
            ER T E M+ ++T AYE L+D  ++  +  YG
Sbjct: 168 KERTTMEEMYVQITKAYEALTDEAMRENFLKYG 200

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {ON}
           YNL007C (REAL)
          Length = 366

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 45/70 (64%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A E E++K YRK ALKYHPDK   + E+      FKE++ A+EIL+D + +
Sbjct: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILNDSQKR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EIYDQYGLEA 71

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 53/105 (50%), Gaps = 10/105 (9%)

Query: 326 EYGKETG--DVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLR 383
           +Y  +TG    +  + ++ S  + +R  +DL  TL +S  ++L GFS  + +T D R L 
Sbjct: 252 DYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTI-QTIDGRTL- 309

Query: 384 VNVPAGKV--IRPGNYFKFKGEGWPL-SNGDSFGDMYVQINIEFP 425
              P  +V  ++P     + G+G P   N    G++ V+  +++P
Sbjct: 310 ---PLSRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYP 351

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
           YER048C (REAL)
          Length = 391

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 50/67 (74%), Gaps = 3/67 (4%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LG++ +AT  EI+KAYR+ A++ HPDK  D+ +   ++A F+ V  AY++LSDP L+
Sbjct: 8   YDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDPGLR 64

Query: 134 SRYDMYG 140
           S+YD +G
Sbjct: 65  SKYDEFG 71

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
           CAJ1Nuclear type II J heat shock protein of the E. coli
           dnaJ family, contains a leucine zipper-like motif, binds
           to non-native substrates for presentation to Ssa3p, may
           function during protein translocation, assembly and
           disassembly
          Length = 391

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 50/67 (74%), Gaps = 3/67 (4%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LG++ +AT  EI+KAYR+ A++ HPDK  D+ +   ++A F+ V  AY++LSDP L+
Sbjct: 8   YDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDPGLR 64

Query: 134 SRYDMYG 140
           S+YD +G
Sbjct: 65  SKYDQFG 71

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {ON}
           YNL007C (REAL)
          Length = 368

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 45/70 (64%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A E E++K YRK ALKYHPDK   + E+      FKE++ A+EIL+D + +
Sbjct: 8   YDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILNDAQKR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EIYDQYGLEA 71

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 43/83 (51%), Gaps = 8/83 (9%)

Query: 346 HLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGKV--IRPGNYFKFKGE 403
           + +R  +DL  TL +S  ++L GFS  + +T D R L    P  +V  ++P     + G+
Sbjct: 276 NFKRDGDDLIYTLPLSFKESLLGFSKTI-QTIDGRTL----PLSRVQPVQPSQTSTYPGQ 330

Query: 404 GWPL-SNGDSFGDMYVQINIEFP 425
           G P   N    G++ V+  +++P
Sbjct: 331 GMPTPKNPSQRGNLIVKYKVDYP 353

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7.157
           YIR004W
          Length = 446

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 53/76 (69%), Gaps = 4/76 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LG+   AT++EI+KAYRK ++K HPDK  ++    ++   F+ ++ AY++LSD +L+
Sbjct: 8   YDLLGISTTATDIEIKKAYRKKSIKEHPDKNPNDP---SATERFQAISEAYQVLSDKQLR 64

Query: 134 SRYDMYG-DSAFGSGG 148
           S YD YG + A  SGG
Sbjct: 65  SNYDKYGKEKAIPSGG 80

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
           {ON} highly similar to uniprot|P39101 Saccharomyces
           cerevisiae YER048c CAJ1
          Length = 382

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 48/67 (71%), Gaps = 3/67 (4%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YDVLG+  +AT  EI+KAYRK+A+  HPDK  D+ E   ++A F+ V  AY++L+DP L+
Sbjct: 8   YDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDPE---AQAKFQAVGEAYQVLNDPALR 64

Query: 134 SRYDMYG 140
            +YD +G
Sbjct: 65  KQYDEFG 71

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} similar
           to uniprot|P39101 Saccharomyces cerevisiae YER048c CAJ1
          Length = 373

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 59/103 (57%), Gaps = 18/103 (17%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV+ +AT  EI+KAYR+ A++ HPDK  ++     ++A F+ V  AY++LSD EL+
Sbjct: 8   YDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDP---NAQAKFQAVGEAYQVLSDDELR 64

Query: 134 SRYDMYG-DSAFGS--------------GGNGFPEDDHEFDDF 161
            RYD  G +SA                 GG+GF E   EF  F
Sbjct: 65  KRYDQLGKESAVPQQGFVDPSEYFTAIFGGDGFKEWVGEFSLF 107

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39101 YER048C Saccharomyces
           cerevisiae CAJ1 Nuclear type II J heat shock protein of
           the E. coli dnaJ family
          Length = 393

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 47/67 (70%), Gaps = 3/67 (4%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD LG+  DAT  EI+KAYRK A+  HPDK  ++ +   ++A F+ V  AY++LSDP L+
Sbjct: 8   YDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDPD---AQAKFQAVGQAYQVLSDPGLR 64

Query: 134 SRYDMYG 140
           SRYD +G
Sbjct: 65  SRYDEFG 71

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.157
           YIR004W
          Length = 434

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 52/76 (68%), Gaps = 4/76 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGVE ++T++EI+KAYRK ++K HPDK  +  +   +   F+ ++ AY++LSD  L+
Sbjct: 8   YDLLGVEPNSTDIEIKKAYRKKSIKLHPDKNPNNPD---ATKKFQAISEAYQVLSDKNLR 64

Query: 134 SRYDMYG-DSAFGSGG 148
           S YD +G D A   GG
Sbjct: 65  SNYDKFGKDKAIPKGG 80

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {ON}
           Anc_2.15
          Length = 616

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 67/120 (55%), Gaps = 16/120 (13%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++LGV+  AT++E++KAYRK AL++HPDK  D  +  T   +F  + +AYE+LSDP+ +
Sbjct: 6   YELLGVDVTATDLELKKAYRKKALQFHPDKNPDNVDEATE--IFATIRSAYEVLSDPQER 63

Query: 134 SRYD-----MYGDSAFGSGGNGFPEDDHE-------FDDFMNFFQQ--YQRQQHGPHASY 179
           + YD     +  D+  G+   G+ E++ +        D+ + FF    Y +    P   Y
Sbjct: 64  AWYDAHKEQILSDAPIGTQEEGYDENEVDSMVTGVTTDELLMFFNSSLYTKLNDSPAGLY 123

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTAAYEILSD 129
           PY++LG+   A++ +I+ AYRKL+LK+HPDK+   + EA+RE  EA + ++T AYE L+D
Sbjct: 122 PYELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESLTD 181

Query: 130 PELKSRYDMYG 140
             ++  Y  YG
Sbjct: 182 ELIRFNYLTYG 192

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 43/70 (61%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A + EI+K YRK AL+YHPDK     E+      FK+++ AYEILSD   +
Sbjct: 8   YDLLGVSPSANDQEIKKGYRKAALQYHPDKPTGNTEK------FKQISEAYEILSDSNKR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EVYDQYGLEA 71

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.398
           YNL007C
          Length = 355

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 6/70 (8%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A + EI+K YRK ALKYHPDK     E+      FKE++ A+EILSD   +
Sbjct: 8   YDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGNTEK------FKEISEAFEILSDSNKR 61

Query: 134 SRYDMYGDSA 143
             YD YG  A
Sbjct: 62  EVYDQYGLEA 71

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
           JJJ1Co-chaperone that stimulates the ATPase activity of
           Ssa1p, required for a late step of ribosome biogenesis;
           associated with the cytosolic large ribosomal subunit;
           contains a J-domain; mutation causes defects in
           fluid-phase endocytosis
          Length = 590

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 48/69 (69%), Gaps = 2/69 (2%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
           M    Y++LGVE  A+++E++KAYRK AL+YHPDK  D  E  T +  F  + AAYE+LS
Sbjct: 1   MKTCYYELLGVETHASDLELKKAYRKKALQYHPDKNPDNVEEATQK--FAVIRAAYEVLS 58

Query: 129 DPELKSRYD 137
           DP+ ++ YD
Sbjct: 59  DPQERAWYD 67

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 47/71 (66%), Gaps = 3/71 (4%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTAAYEILSD 129
           PYD+LG+   A+E EI+ AYRKL++K+HPDK+   + E ER T E  + ++T AYE L+D
Sbjct: 120 PYDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEALTD 179

Query: 130 PELKSRYDMYG 140
              +  +  YG
Sbjct: 180 ELTRQNFLKYG 190

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {ON}
           Anc_7.217 YER048C
          Length = 364

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 57/92 (61%), Gaps = 11/92 (11%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LG++  AT  EI+KAYRK A++ HPDK  D+ +   +++ F+ V  AY++LSD +L+
Sbjct: 8   YDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDPD---AQSKFQSVGEAYQVLSDDDLR 64

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFF 165
            RYD +G        N  P+  H F+D   +F
Sbjct: 65  KRYDEFGKD------NAVPQ--HGFEDAGEYF 88

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {ON}
           similar to uniprot|P39101 YER048C Saccharomyces
           cerevisiae CAJ1 Nuclear type II J heat shock protein of
           the E. coli dnaJ family
          Length = 428

 Score = 66.6 bits (161), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 54/94 (57%), Gaps = 6/94 (6%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T YD+L V  DA+  EI+K+YRKLA+K HPDK  D+ + +T    F+E+  AY++L D +
Sbjct: 6   TYYDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDPQAQTK---FQELAKAYQVLIDDD 62

Query: 132 LKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFF 165
           L+ +YD +G           P D   ++  M  F
Sbjct: 63  LRKKYDQFG---LDETNGEIPMDQDPYEMLMTVF 93

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
           (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 48/66 (72%), Gaps = 2/66 (3%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++LGV+  AT++E++KAYRK AL++HPDK  D  E  T   +F  + +AYE+LSDP+ +
Sbjct: 6   YELLGVDITATDIELKKAYRKKALQFHPDKNPDNVEEATE--IFATIRSAYEVLSDPQER 63

Query: 134 SRYDMY 139
           + YD +
Sbjct: 64  AWYDAH 69

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 67.0 bits (162), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 5/82 (6%)

Query: 64  NVNYDMAQT--PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEA---ERETSEAMFK 118
            +   MAQ   PYD+LG+   A++ +I+ AYR+L+LK+HPDK+  E    ER   E M+ 
Sbjct: 115 TITQSMAQMFDPYDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYV 174

Query: 119 EVTAAYEILSDPELKSRYDMYG 140
           +++ A+E L+DP ++  Y  YG
Sbjct: 175 QISKAHEALTDPIVRENYLKYG 196

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
           Anc_2.15 YNL227C
          Length = 659

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 58/90 (64%), Gaps = 7/90 (7%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++L V + A+++E++KAYRK AL+YHPDK  +  E  T  A+F E+ AAYE+LSDP+ +
Sbjct: 6   YELLEVSEYASDLELKKAYRKKALQYHPDKNRENPEEAT--AIFSEIRAAYEVLSDPQER 63

Query: 134 SRYDMYGDSAFGSGGNGFP-EDDHEFDDFM 162
           + YD +         N  P ED++E D  +
Sbjct: 64  AWYDSHKQQIL----NDTPLEDEYEVDSIV 89

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} similar
           to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
           Protein that may function as a cochaperone as suggested
           by the presence of a DnaJ-like domain
          Length = 525

 Score = 66.2 bits (160), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/90 (37%), Positives = 53/90 (58%), Gaps = 2/90 (2%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
           M    Y++LGV   A ++E++KA+R+ AL+YHPDK  D  E  T    F ++ AAYE+L+
Sbjct: 1   MKTCYYELLGVSSTADDLELKKAFRRKALQYHPDKNRDNVEEATE--TFAQIRAAYEVLN 58

Query: 129 DPELKSRYDMYGDSAFGSGGNGFPEDDHEF 158
           DP+ ++ YD +         NG   +D E+
Sbjct: 59  DPQERAWYDSHKSQILNDDINGGTYEDDEY 88

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {ON}
           YNL227C (REAL)
          Length = 593

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 56/92 (60%), Gaps = 5/92 (5%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
           M    Y++LGVE  A+++E++KAYRK AL+YHPDK  D  +  T +  F  + AAYE+LS
Sbjct: 1   MKACYYELLGVESHASDLELKKAYRKKALQYHPDKNPDNVQEATEK--FAIIRAAYEVLS 58

Query: 129 DPELKSRYDMYGDSAFGSGGNGFPEDDHEFDD 160
           DP+ ++ YD + +          P+ D  +D+
Sbjct: 59  DPQERAWYDSHKEQILNDTA---PDADGYYDE 87

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {ON}
           Anc_7.217 YER048C
          Length = 396

 Score = 65.5 bits (158), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 4/76 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YDVLG+   AT  EI+KAYR+ A++ HPDK  D+    T+   F++V  AY++LSDP+L+
Sbjct: 8   YDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDP---TASERFQQVGEAYQVLSDPDLR 64

Query: 134 SRYDMYG-DSAFGSGG 148
            +YD +G D+A    G
Sbjct: 65  KQYDEFGKDNAVPQQG 80

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
           [687 nt, 229 aa]
          Length = 228

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/110 (41%), Positives = 61/110 (55%), Gaps = 10/110 (9%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y+VL VE+ + E EI+K+YRKLA+K HPDK       + SEA FK +  A+E+LSD E +
Sbjct: 24  YNVLKVERSSDETEIKKSYRKLAIKLHPDK---NPHPKASEA-FKVINRAFEVLSDNEKR 79

Query: 134 SRYDMYG----DSAFGSGGNGFPEDDHEF-DDFMNFFQQYQRQQHGPHAS 178
             +D  G    D    S  +GF      F  DF N F + Q  Q G HA+
Sbjct: 80  EIFDRIGRDPDDRGVSSSASGFNGAQPGFPSDFENMFFRRQFNQGG-HAA 128

>TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {ON}
           Anc_8.61 YFL016C
          Length = 470

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 99/248 (39%), Gaps = 26/248 (10%)

Query: 207 LYMGKTVTFQLKRKCLCPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKD 266
           ++  K    Q      C  C G+GL+K        +C SC+G G       + GG+ +  
Sbjct: 186 VFGAKNANLQFSVLDPCGVCHGSGLKK---NAQSSTCPSCHGTG---TTVHVRGGFQMA- 238

Query: 267 HTVCDACKGKGRYRKKSASDTCKHCSGKGL-INEEKSQTVYIPRGSRHGDEFRLPQMADM 325
            + C+ C G+G   +    D C  C G+G+ +N ++S +V +P+G + GD  R+P     
Sbjct: 239 -STCNQCGGEGTTVR--PEDVCSKCHGEGVELNSQRSISVDLPQGLQDGDVVRVPGQGSY 295

Query: 326 EYGK-----------ETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVC 374
            +               GDV++ I  D       R   D+  T  I +  A  G   +  
Sbjct: 296 PHLAVDPKMKNSVKLHRGDVLVRIRVDKDSRFSIRNKTDIWFTKEIPITTAALG-GQVTI 354

Query: 375 ETYDNRRLRVNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEKS 434
            T D+ ++R+ V  G   +          G P   G+  G M VQ  I   K     EK 
Sbjct: 355 PTVDDTQIRLKVQPG--TQHDQVISIPNMGVPRIGGER-GAMKVQYKIVIKKPQSKAEKC 411

Query: 435 EITALRNI 442
              AL ++
Sbjct: 412 LWEALADV 419

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
           to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
           Protein that may function as a cochaperone as suggested
           by the presence of a DnaJ-like domain
          Length = 590

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 63/120 (52%), Gaps = 16/120 (13%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++LGVE  A++ +++KAYR+ AL+YHPDK  D  E  T+  +F  + +AYE+L+DP+ +
Sbjct: 6   YELLGVETTASDSDLKKAYRRKALQYHPDKNPDNVEEATT--VFATIRSAYEVLADPQER 63

Query: 134 SRYDMYGDSAFGS---GGNGFPEDDHEF---------DDFMNFFQQ--YQRQQHGPHASY 179
           + YD +            NG   D++E          DD + FF    Y R    P   Y
Sbjct: 64  AWYDSHKQQILSDDFGAENGDDYDEYEVDAAVSGVTTDDLLKFFNTGLYSRVDDTPAGFY 123

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
           Protein that may function as a cochaperone as suggested
           by the presence of a DnaJ-like domain
          Length = 678

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 46/66 (69%), Gaps = 2/66 (3%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++LGVE  A+++E++KAYRK ALKYHPDK  +  E  T    F  +  AYE+LSDP+ +
Sbjct: 6   YELLGVESIASDLELKKAYRKKALKYHPDKNPNNVEEATQ--AFATIRLAYEVLSDPQER 63

Query: 134 SRYDMY 139
           + YD +
Sbjct: 64  AWYDSH 69

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
           {ON} similar to uniprot|P40564 YIR004W Saccharomyces
           cerevisiae DJP1 Cytosolic J-domain-containing protein,
           required for peroxisomal protein import
          Length = 433

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 4/87 (4%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T YD+LGV  DA +++I+KAYRK ++K HPDK  D+    T+   F+ ++ AY++LS  E
Sbjct: 6   TYYDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDP---TATERFQAISEAYQVLSSEE 62

Query: 132 LKSRYDMYGDSAFGSGGNGFPEDDHEF 158
           L+ +YD +G        NGF +   +F
Sbjct: 63  LRMKYDKFGKEE-AMPKNGFEDAGEQF 88

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
           YMR161W
          Length = 233

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+L V+K A  VEI+K+YRKLA+K HPDK       +  EA FK +  A+E+LSD E +
Sbjct: 26  YDILNVQKSADSVEIKKSYRKLAIKLHPDK---NPHPKAGEA-FKVINRAFEVLSDDEKR 81

Query: 134 SRYDMYG 140
           S +D  G
Sbjct: 82  SVFDRIG 88

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} similar
           to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
           Protein that may function as a cochaperone as suggested
           by the presence of a DnaJ-like domain
          Length = 620

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 2/72 (2%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+L V+ DAT+ ++++AYRK AL YHPDK  +  E  T   +F ++ AAYE+LSD + +
Sbjct: 6   YDLLDVKSDATDTDLKRAYRKKALLYHPDKNRNNIEEATE--VFAQIRAAYEVLSDAQER 63

Query: 134 SRYDMYGDSAFG 145
           + YD + D    
Sbjct: 64  AWYDAHKDQILN 75

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
           YER048C (REAL)
          Length = 391

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 49/67 (73%), Gaps = 3/67 (4%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LG++ +AT  EI+KAYR+ A++ HPDK  D+ +   ++A F+ V  AY++LSD  L+
Sbjct: 8   YDILGIKPEATATEIKKAYRRKAMETHPDKHPDDPD---AQAKFQAVGEAYQVLSDQGLR 64

Query: 134 SRYDMYG 140
           S+YD +G
Sbjct: 65  SKYDEFG 71

>AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YJR097W (JJJ3)
          Length = 156

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 37/107 (34%), Positives = 53/107 (49%), Gaps = 13/107 (12%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
           M  + YD+LG+  DA  +E+R+AYR+  L+ HPDK     +    +     +  AY +LS
Sbjct: 1   MDGSHYDILGIAVDAEPLEVRQAYRQRLLEAHPDK-----QGGVDKGAVTRIQQAYRVLS 55

Query: 129 DPELKSRYD---MYGDSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQ 172
           DP  +S YD       +A G  G     D+H  DDF     +Y  QQ
Sbjct: 56  DPTQRSAYDGELAVQIAATGVHGRADALDEHSLDDF-----EYNEQQ 97

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
           {ON} similar to uniprot|P39101 YER048C Saccharomyces
           cerevisiae CAJ1 Nuclear type II J heat shock protein of
           the E. coli dnaJ family
          Length = 398

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 3/67 (4%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD LG+   AT  EI+KAYR+ A++ HPDK  D+ E E     F+ V  AY++LSD  L+
Sbjct: 8   YDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDPEAENK---FQAVGEAYQVLSDESLR 64

Query: 134 SRYDMYG 140
           +RYD YG
Sbjct: 65  ARYDEYG 71

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {ON}
           Anc_7.157 YIR004W
          Length = 470

 Score = 63.9 bits (154), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T YD+LG+   AT+ EI+KAYRK ++K HPDK  ++    T+   F++++ AY++LSD  
Sbjct: 6   TYYDILGITPTATQAEIKKAYRKKSIKEHPDKNPNDP---TATERFQQISEAYQVLSDEH 62

Query: 132 LKSRYDMYG 140
           L++ YD +G
Sbjct: 63  LRNNYDQFG 71

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {ON}
           YNL227C (REAL)
          Length = 600

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 55/93 (59%), Gaps = 6/93 (6%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
           M    Y++LGVE  A+++E++KAYRK AL+YHPDK  D  E  T +  F  + AAYE+LS
Sbjct: 1   MKTCYYELLGVESHASDLELKKAYRKKALQYHPDKNPDNVEEATEK--FAIIRAAYEVLS 58

Query: 129 DPELKSRYDMYGDSAFGSGGNGFPEDDHEFDDF 161
           D + ++ YD + +       N  P D   + DF
Sbjct: 59  DSQERAWYDSHKEQIL----NDTPPDADGYYDF 87

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
           (REAL)
          Length = 224

 Score = 61.6 bits (148), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 46/67 (68%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++L V+K AT+ EI+KAYRKLA+K HPDK    +    SEA FK +  A+E+LS+ E +
Sbjct: 23  YEILRVDKKATDGEIKKAYRKLAIKLHPDK---NSHPRASEA-FKVINRAFEVLSNEEKR 78

Query: 134 SRYDMYG 140
           S YD  G
Sbjct: 79  SIYDRIG 85

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {ON}
           YNL227C (REAL)
          Length = 596

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 47/69 (68%), Gaps = 2/69 (2%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
           M    Y++LGVE  A+++E++KAYRK AL+YHPDK  D  E  T +  F  + AAYE+LS
Sbjct: 1   MKACYYELLGVESHASDLELKKAYRKKALQYHPDKNPDNVEEATQK--FAIIRAAYEVLS 58

Query: 129 DPELKSRYD 137
           D + ++ YD
Sbjct: 59  DSQERAWYD 67

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 63.2 bits (152), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 3/71 (4%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTAAYEILSD 129
           PY++LGV   A + EI+ AYRKL++K+HPDK+   +    R   E M+ ++T AYE L+D
Sbjct: 123 PYEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESLTD 182

Query: 130 PELKSRYDMYG 140
             +K  Y  YG
Sbjct: 183 ENVKENYLRYG 193

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {ON}
           Anc_7.157
          Length = 482

 Score = 62.8 bits (151), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 4/85 (4%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LG+E  AT+ EI+KAYRK ++K HPDK  ++ +   +   F+ ++ AY++LSD  L+
Sbjct: 8   YDLLGIEPSATQGEIKKAYRKKSIKEHPDKNPNDPQ---ATERFQAISEAYQVLSDESLR 64

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEF 158
            +YD YG        NGF +   +F
Sbjct: 65  LKYDKYGKKE-AIPQNGFEDAAEQF 88

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2.15
           YNL227C
          Length = 551

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 54/84 (64%), Gaps = 6/84 (7%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++LGV+  A+++E++KAYRK AL+YHPDK   + E  T   +F  +  AYE+LSDP+ +
Sbjct: 6   YELLGVDSHASDLELKKAYRKKALQYHPDKNPTKVEEATE--IFATIRTAYEVLSDPQER 63

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHE 157
           + YD + +       N  P +++E
Sbjct: 64  AWYDSHKEQIL----NDIPLNEYE 83

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 68/138 (49%), Gaps = 19/138 (13%)

Query: 6   FNVKYSERFSSSKPYVFFTTGRFSVLHIWKYQMFKKQYEQEGHVDEEGAIGCTRLTNSNV 65
           F +KY  +   SK    F      V+  W +     Q        ++ A+G         
Sbjct: 71  FRMKYDNKNQISK---VFNWRNLIVIVGWAFVALLVQRISNNDAIKQAAVGI-------- 119

Query: 66  NYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTA 122
            +D    PY++LG+   A++ +I+ AYRKL++K+HPDK+   + + ER + E  + ++T 
Sbjct: 120 -FD----PYELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITK 174

Query: 123 AYEILSDPELKSRYDMYG 140
           AYE L+D  +K  +  YG
Sbjct: 175 AYEALTDEVIKENFLKYG 192

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
           (REAL)
          Length = 432

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 50/76 (65%), Gaps = 4/76 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   AT +EI+KAYRK +++ HPDK  ++ +   +   F+ ++ AY++L D EL+
Sbjct: 8   YDLLGVSTTATAIEIKKAYRKKSIQEHPDKNPNDPK---ATERFQAISEAYQVLGDDELR 64

Query: 134 SRYDMYG-DSAFGSGG 148
           ++YD YG   A   GG
Sbjct: 65  AKYDKYGRKEAIPQGG 80

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
           {ON} highly similar to uniprot|P40564 Saccharomyces
           cerevisiae YIR004w DJP1
          Length = 425

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 51/78 (65%), Gaps = 4/78 (5%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T YD+LG+   AT VEI+KAYRK +++ HPDK  ++    T+   F+ ++ AY++LS  E
Sbjct: 6   TYYDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDP---TATERFQAISEAYQVLSSEE 62

Query: 132 LKSRYDMYG-DSAFGSGG 148
           L+++YD +G   A   GG
Sbjct: 63  LRAKYDKFGKQEAIPKGG 80

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
           Anc_2.350 YMR161W
          Length = 225

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 51/94 (54%), Gaps = 16/94 (17%)

Query: 71  QTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDP 130
           Q  Y+VL +E+ A++ EI+K+YRKLA+K HPDK         SEA FK +  A+E+LSD 
Sbjct: 23  QAFYEVLQIERSASDNEIKKSYRKLAIKLHPDK---NPHPRASEA-FKVINRAFEVLSDE 78

Query: 131 ELKSRYDMYG------------DSAFGSGGNGFP 152
           E +  YD  G             S F +   GFP
Sbjct: 79  EKRRLYDRLGRDPDDRNMPSASSSGFRTASAGFP 112

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
           HLJ1Co-chaperone for Hsp40p, anchored in the ER
           membrane; with its homolog Ydj1p promotes ER-associated
           protein degradation (ERAD) of integral membrane
           substrates; similar to E. coli DnaJ
          Length = 224

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++L V++ AT+ EI+KAYRKLA+K HPDK    +  +  EA FK +  A+E+LS+ E +
Sbjct: 23  YEILKVDRKATDSEIKKAYRKLAIKLHPDK---NSHPKAGEA-FKVINRAFEVLSNEEKR 78

Query: 134 SRYDMYG 140
           S YD  G
Sbjct: 79  SIYDRIG 85

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++L VE+ +TE EI+KAYRKLA++ HPDK       + SEA FK +  A+E+LSD E +
Sbjct: 23  YEILKVERTSTENEIKKAYRKLAIRLHPDK---NPHPKASEA-FKIINRAFEVLSDNEKR 78

Query: 134 SRYDMYG 140
             +D  G
Sbjct: 79  RIFDQLG 85

>KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 471

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 71/255 (27%), Positives = 104/255 (40%), Gaps = 44/255 (17%)

Query: 223 CPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKK 282
           C  C G+GL+  H +     C +C+G G +  +   AG  M    + C  C G+G   K 
Sbjct: 200 CSSCDGSGLKAGHSRS---VCPTCHGTGTQVHVR--AGFQMA---STCQTCDGEGSTIKD 251

Query: 283 SASDTCKHCSGKGL-INEEKSQTVYIPRGSRHGDEFRLPQMAD-----------MEYGKE 330
           S  D C  C   G  +N  K+ TV +P G + GD  R+P                E    
Sbjct: 252 S--DKCGTCHSHGFKLNSNKTITVDLPHGLQDGDTIRVPNQGSYPGMAIDPSMKSELHLT 309

Query: 331 TGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAG- 389
            GD++I +            + D+  T  I +  A  G   I   T +  ++R+ V +G 
Sbjct: 310 RGDLLIRVRVRKDTRFQVSNNYDIIYTQEIPITTAALG-GVIEVPTVEEEKIRLKVSSGT 368

Query: 390 ---KVIRPGNYFKFKGEGWPLSNGDSFGDMYV--QINIEFPKDN-----W---FNEKSEI 436
              +VIR  N      +G P       GDM V  +I I+ PKD      W    +  ++ 
Sbjct: 369 QHDQVIRIPN------KGVPRGARGDRGDMLVKFKIVIKKPKDETERYLWETLAHLTNDT 422

Query: 437 TALRNILP-GLKSKD 450
           TA R I P G  +KD
Sbjct: 423 TARRTITPSGSSAKD 437

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 49/72 (68%), Gaps = 4/72 (5%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132
           PY VLG+ K++++ +I+KAY KLA KYHPD      + E S+  F ++  AYEILSD + 
Sbjct: 26  PYKVLGINKNSSQSDIKKAYYKLAKKYHPDI----NKEEDSQKKFHDLQNAYEILSDEDK 81

Query: 133 KSRYDMYGDSAF 144
           + +YD +G +AF
Sbjct: 82  RKQYDQFGAAAF 93

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
           Anc_2.350
          Length = 224

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++L VEK A + EI+KAYRKLA+K HPDK       + SEA FK +  A+E+LSD E +
Sbjct: 24  YEILKVEKTANDNEIKKAYRKLAVKLHPDK---NPHPKASEA-FKIINRAFEVLSDVEKR 79

Query: 134 SRYDMYG 140
             YD  G
Sbjct: 80  QLYDRIG 86

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.157
           YIR004W
          Length = 425

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 59/102 (57%), Gaps = 10/102 (9%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++LGV   AT VEI+KAYRK +++ HPDK  D+     +   F+ ++ AY++LSD +L+
Sbjct: 8   YEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDDP---MATERFQAISEAYQVLSDEDLR 64

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEF------DDFMNFFQQYQ 169
            +YD +G +     G GF +   +F      D F ++  + Q
Sbjct: 65  GKYDRFGKTEAVPKG-GFEDAAEQFSVIFGGDAFASYIGELQ 105

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 47/66 (71%), Gaps = 2/66 (3%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++LGV+  A++ +++KAYR+ AL+YHPDK I   ++ T   +F  + AAYE+LSD + +
Sbjct: 6   YELLGVDSGASDTDLKKAYRRKALQYHPDKNIGNVQQATE--IFASIRAAYEVLSDAQER 63

Query: 134 SRYDMY 139
           + YD +
Sbjct: 64  AWYDAH 69

>Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W
           (REAL)
          Length = 172

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 56/120 (46%), Gaps = 11/120 (9%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T Y++L +  DAT+ EI++AYR   L  HPDK+        S     ++  AY ILSD  
Sbjct: 8   THYEILRIPSDATQEEIKRAYRDQLLHTHPDKLTKNTHGTISSVTINKIQDAYRILSDIR 67

Query: 132 LKSRYDM-----YGDSAFGSGGNGFPE---DDHEFD-DFMNFFQQYQRQQ--HGPHASYS 180
            +  YD      Y    F + G+G  E   DD  FD D + F     R Q  +G H S S
Sbjct: 68  SRCEYDRLILENYKQQGFHNCGDGLDEFSLDDFSFDEDKLEFMMNCPRCQFVNGFHFSES 127

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
           (REAL)
          Length = 225

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y +L V+K AT+ EI+KAYRKLA+K HPDK       + SEA FK +  A+E+LS+ E +
Sbjct: 23  YQILKVDKKATDGEIKKAYRKLAIKLHPDK---NPHPKASEA-FKIINRAFEVLSNEEKR 78

Query: 134 SRYDMYG 140
             YD  G
Sbjct: 79  GLYDRIG 85

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytosolic
           J-domain-containing protein, required for peroxisomal
           protein import and involved in peroxisome assembly,
           homologous to E. coli DnaJ
          Length = 432

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 50/76 (65%), Gaps = 4/76 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A+ +EI+KAYRK +++ HPDK  ++    T+   F+ ++ AY++L D +L+
Sbjct: 8   YDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDP---TATERFQAISEAYQVLGDDDLR 64

Query: 134 SRYDMYG-DSAFGSGG 148
           ++YD YG   A   GG
Sbjct: 65  AKYDKYGRKEAIPQGG 80

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 3/71 (4%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTAAYEILSD 129
           PY++LGV   +T+ EI+ AYRKL++K+HPDK+   ++E ER   E  F  +  AY+ L+D
Sbjct: 112 PYELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALTD 171

Query: 130 PELKSRYDMYG 140
              K  Y  YG
Sbjct: 172 EITKENYRKYG 182

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {ON}
           Anc_2.15 YNL227C
          Length = 581

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 49/81 (60%), Gaps = 2/81 (2%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++L V+  A + E++KAYR+ AL+YHPDK  +  E  T   +F  + AAYE+LSDP+ +
Sbjct: 6   YELLDVQPFADDNELKKAYRRKALQYHPDKNPENVEEATE--IFASIRAAYEVLSDPQER 63

Query: 134 SRYDMYGDSAFGSGGNGFPED 154
           + YD + +        G  ED
Sbjct: 64  AWYDSHKEQILNDEPIGLNED 84

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 54/93 (58%), Gaps = 6/93 (6%)

Query: 54  AIGCTRLTNSNVNYDMAQT---PYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDE 107
           AI   R+ ++    D A     PY++LG+   A++ +I+ AYRKL++K+HPDK+   +  
Sbjct: 104 AILLQRINSNEAIQDAATKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTS 163

Query: 108 AERETSEAMFKEVTAAYEILSDPELKSRYDMYG 140
            E+   E  + ++T AYE L+D  ++  Y  YG
Sbjct: 164 DEKSVMEETYVQITKAYESLTDELVRQNYLKYG 196

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 53/85 (62%), Gaps = 4/85 (4%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV  DA  +EI+KAYRK +++ HPDK  ++ +   +   F+ ++ AY++LS  EL+
Sbjct: 8   YDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPNDPK---ATERFQAISEAYQVLSSDELR 64

Query: 134 SRYDMYGDSAFGSGGNGFPEDDHEF 158
           ++YD +G        NGF +   +F
Sbjct: 65  AKYDKFGKEE-AVPQNGFEDAGEQF 88

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {ON}
           similar to uniprot|P48353 Saccharomyces cerevisiae
           YMR161w HLJ1
          Length = 232

 Score = 58.9 bits (141), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+L VE+ +++V+I+KAYRKLA+K HPDK         +   FK +  A+E+LSD + +
Sbjct: 23  YDILNVERSSSDVDIKKAYRKLAIKLHPDK----NPYPKAHEAFKLINRAFEVLSDSQKR 78

Query: 134 SRYDMYG 140
             YD  G
Sbjct: 79  QIYDQIG 85

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTAAYEILSD 129
           PY +LGV   AT+ +I+ AYRKL++K+HPDK+   +   ER   E M+ +++ AYE L+D
Sbjct: 124 PYALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEALTD 183

Query: 130 PELKSRYDMYG 140
              K+ Y  YG
Sbjct: 184 EITKANYLTYG 194

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 52/81 (64%), Gaps = 3/81 (3%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKI--IDEAERETSEAMFKEVTAAYEILSDPE 131
           Y +LGV+K AT  ++R++Y +L  K+HPDK   +++ +R+ +E    E+  AYEILSD +
Sbjct: 530 YKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAYEILSDDD 589

Query: 132 LKSRYD-MYGDSAFGSGGNGF 151
            +++YD    +S    G +GF
Sbjct: 590 KRTKYDNARANSRNSRGAHGF 610

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {ON}
           similar to uniprot|P40564 YIR004W Saccharomyces
           cerevisiae DJP1 Cytosolic J-domain-containing protein,
           required for peroxisomal protein import
          Length = 429

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 55/87 (63%), Gaps = 4/87 (4%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T YD+LGV  +A  +EI+KAYRK +++ HPDK  ++    ++   F+ ++ AY++LS+ E
Sbjct: 6   TYYDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDP---SATERFQSISQAYQVLSNEE 62

Query: 132 LKSRYDMYGDSAFGSGGNGFPEDDHEF 158
           L+++YD +G        NGF +   +F
Sbjct: 63  LRTKYDKFGKEE-AVPQNGFEDAAEQF 88

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {ON}
           similar to gnl|GLV|CAGL0J01936g Candida glabrata
           CAGL0J01936g and some similarites with uniprot|P40564
           YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
           J-domain- containing protein, required for peroxisomal
           protein import
          Length = 418

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (65%), Gaps = 4/76 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGVE  AT+VEI+KAYRK ++  HPDK  D+     +   F+ ++ AY++LS+ +L+
Sbjct: 8   YDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDP---AATERFQSISEAYQVLSNKDLR 64

Query: 134 SRYDMYG-DSAFGSGG 148
           + YD  G + A   GG
Sbjct: 65  ANYDKSGKEKAIPKGG 80

>ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL073W
           (JEM1)
          Length = 611

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 45/81 (55%), Gaps = 4/81 (4%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKI--IDEAERETSEAMFKEVTAAYEILSDPE 131
           Y +LG+  DA   +IR+AY  L  KYHPDK   + +AER   E     +  AYE+LSD  
Sbjct: 511 YKILGIGNDANAKDIRRAYLHLTKKYHPDKQGNMSDAERAKVEEKMSSINEAYEVLSDES 570

Query: 132 LKSRYDMY--GDSAFGSGGNG 150
            +  YDM   G  +  +GGNG
Sbjct: 571 KRKEYDMLRSGGGSQHAGGNG 591

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 55/93 (59%), Gaps = 6/93 (6%)

Query: 54  AIGCTRLTNSNVNYDMAQT---PYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDE 107
           AI   R+ +++   D A     PY++LG+   A++ +I+ AYRKL++K+HPDK+   +  
Sbjct: 104 AILLQRINSNDAIKDAATKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTP 163

Query: 108 AERETSEAMFKEVTAAYEILSDPELKSRYDMYG 140
            E+   E  + ++T AYE L+D  ++  Y  YG
Sbjct: 164 DEKSVMEETYVQITKAYESLTDELVRQNYLKYG 196

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
           (REAL)
          Length = 224

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 46/67 (68%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++L V++ AT+ +I+KAYRKLA+K HPDK    +  +  EA FK +  A+E+LS+ E +
Sbjct: 23  YEILKVDRKATDSDIKKAYRKLAIKLHPDK---NSHPKAGEA-FKVINRAFEVLSNEEKR 78

Query: 134 SRYDMYG 140
           S YD  G
Sbjct: 79  SIYDRIG 85

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {ON}
           some similarities with uniprot|P48353 Saccharomyces
           cerevisiae YMR161W
          Length = 233

 Score = 58.5 bits (140), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y+VL +E++A++ EI+KAYRKLA+K HPDK         SEA FK +  A+E+LSD + +
Sbjct: 24  YEVLQIEREASDNEIKKAYRKLAIKLHPDK---NKHPRASEA-FKRINRAFEVLSDEQKR 79

Query: 134 SRYDMYG 140
             +D  G
Sbjct: 80  RIFDQVG 86

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
           YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
           PARTIAL
          Length = 85

 Score = 54.7 bits (130), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 41/58 (70%), Gaps = 4/58 (6%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           Y+VL VEK A+++EI+KAYRKLA+K HPDK         SEA FK +  A+E+LSD +
Sbjct: 24  YEVLRVEKQASDLEIKKAYRKLAIKLHPDK---NKHPRASEA-FKRINRAFEVLSDEQ 77

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/88 (37%), Positives = 56/88 (63%), Gaps = 6/88 (6%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T YD+LGV  DA +++I+KAYRK +++ HPDK  ++ +   +   F+ ++ AY++L   E
Sbjct: 6   TYYDLLGVSPDAKQIDIKKAYRKKSVQEHPDKNPNDPK---ATERFQAISEAYQVLGSDE 62

Query: 132 LKSRYDMYG-DSAFGSGGNGFPEDDHEF 158
           L+++YD +G D A     NGF +   +F
Sbjct: 63  LRAKYDKFGKDEAVPQ--NGFEDAGEQF 88

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 56/93 (60%), Gaps = 6/93 (6%)

Query: 54  AIGCTRLTNSNVNYDMAQT---PYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDE 107
           A+   R+ +++   D A     PY++LG+   A++ +I+ AYRKL++K+HPDK+   +  
Sbjct: 104 AVLLQRINSNDAIKDAAIKLFDPYEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTT 163

Query: 108 AERETSEAMFKEVTAAYEILSDPELKSRYDMYG 140
            E++  E  + ++T AYE L+D  ++  Y  YG
Sbjct: 164 DEKDVMEETYVQITKAYESLTDELVRQNYLKYG 196

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
           Anc_7.157
          Length = 414

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 50/76 (65%), Gaps = 4/76 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++LG+   AT +EI+KAYRK +++ HPDK  ++    T+   F+ ++ AY++LSD  L+
Sbjct: 8   YELLGISPSATAIEIKKAYRKKSIQEHPDKNPNDP---TATERFQAISEAYQVLSDDTLR 64

Query: 134 SRYDMYG-DSAFGSGG 148
            +YD YG   A  +GG
Sbjct: 65  LKYDKYGKKEAVPTGG 80

>YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protein
           of unknown function, contains a CSL Zn finger and a
           DnaJ-domain; involved in diphthamide biosynthesis;
           ortholog human Dph4
          Length = 172

 Score = 57.0 bits (136), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 57/120 (47%), Gaps = 11/120 (9%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T Y++L +  DAT+ EI+KAYR   L  HPDK+        S     ++  AY+ILS+ +
Sbjct: 8   THYEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVTINKIQDAYKILSNIK 67

Query: 132 LKSRYDM-----YGDSAFGSGGNGFPE---DDHEFD-DFMNFFQQYQRQQH--GPHASYS 180
            +  YD      Y    F + G+G  E   DD  FD D + F     R Q   G H S S
Sbjct: 68  TRREYDRLILENYKRQGFHNCGDGLDEFSLDDFSFDEDKLEFMMNCPRCQFVGGFHFSES 127

>TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {ON}
           Anc_1.113 YJR097W
          Length = 159

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 51/98 (52%), Gaps = 11/98 (11%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILS 128
           M  + Y+ LG+  D +  EI+KAY++  L  HPDKI D    E+S     ++  AY++L 
Sbjct: 1   MISSHYETLGLNSDCSLEEIKKAYKEKLLSSHPDKIGD----ESSSVEVNKIQEAYKVLC 56

Query: 129 DPELKSRYD-----MYGDSAFGSGGNGFPEDDHEFDDF 161
           D  L+ +YD      Y    F   G+G   DD+  D+F
Sbjct: 57  DVNLREKYDESLKKQYKHQGFLGSGDGL--DDYSLDEF 92

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2.15
           YNL227C
          Length = 598

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 46/72 (63%), Gaps = 2/72 (2%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++L VE  A++ +++KAYR+ AL+YHPDK I+  +  T   +F  +  AYEILSDP+ +
Sbjct: 6   YELLDVEMTASDADLKKAYRRKALQYHPDKNINNIKEATD--IFANIRTAYEILSDPQER 63

Query: 134 SRYDMYGDSAFG 145
             YD + +    
Sbjct: 64  VWYDSHKNQILN 75

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.157
           YIR004W
          Length = 411

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 52/79 (65%), Gaps = 10/79 (12%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDE---AERETSEAMFKEVTAAYEILSDP 130
           Y++LG+E  AT VEI+KAYRK +++ HPDK  ++    ER      F+ ++ AY++LSD 
Sbjct: 8   YELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGATER------FQAISEAYQVLSDS 61

Query: 131 ELKSRYDMYG-DSAFGSGG 148
           +L++ YD +G + A   GG
Sbjct: 62  DLRANYDKFGKEKAIPKGG 80

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
           (REAL)
          Length = 421

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 32/79 (40%), Positives = 49/79 (62%), Gaps = 10/79 (12%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTAAYEILSDP 130
           YD+LGV   A+ +EI+KAYRK +++ HPDK    +   ER      F+ ++ AY++L D 
Sbjct: 8   YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDLKATER------FQAISEAYQVLGDD 61

Query: 131 ELKSRYDMYG-DSAFGSGG 148
           EL+++YD +G   A   GG
Sbjct: 62  ELRAKYDKFGRKEAIPQGG 80

>Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W
           (REAL)
          Length = 168

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 55/112 (49%), Gaps = 9/112 (8%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T Y++L +  DAT+ EI+KAYR   L  HPDK+  +   + +      +  AY++LS+ +
Sbjct: 8   THYEILRIPSDATQEEIKKAYRDRLLNTHPDKLAKKTSNKVNSVTIDTIQDAYKVLSNIK 67

Query: 132 LKSRYDM-----YGDSAFGSGGNGFPE---DDHEFD-DFMNFFQQYQRQQHG 174
            +  YD      Y    F + G+G  E   DD  FD + + F     R Q G
Sbjct: 68  TRGEYDKLILENYKHQGFHNCGDGLDEFSLDDFSFDEEKLEFMMNCPRCQFG 119

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPEL 132
           PY+ LGV KDA+  +I+KAY KLA ++HPD   DE     +E  F ++  AYEILSD   
Sbjct: 42  PYETLGVAKDASASQIKKAYYKLAKQFHPDINKDEG----AEKKFHDLQNAYEILSDENK 97

Query: 133 KSRYDMY 139
           + +YD +
Sbjct: 98  RRQYDQF 104

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/252 (21%), Positives = 94/252 (37%), Gaps = 48/252 (19%)

Query: 219 RKCLCPHCSGTGLR---KKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKG 275
           ++ +C  C GTG +   +  FQ    +C+ C+G+G+  R                     
Sbjct: 216 QRSVCGGCHGTGTQVHVRAGFQMAS-TCSQCSGEGYSIR--------------------- 253

Query: 276 KGRYRKKSASDTCKHCSGKGLI-NEEKSQTVYIPRGSRHGDEFRLPQMADMEYGK----- 329
                     D C  CSG+G++ N  K   +  P G + GD  ++P      + +     
Sbjct: 254 --------RGDRCGTCSGEGVVFNRNKEVKMDFPHGLQDGDVVKVPGQGSFPHIQVDPKT 305

Query: 330 ------ETGDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLR 383
                   GD+++ +  +       + + D+     I +  A  G  T+   T D  ++R
Sbjct: 306 AHTMRLRRGDLLVQVQVERDPRFQIKNNYDIWYVQEIPITTAALG-GTVSIPTVDGDQIR 364

Query: 384 VNVPAGKVIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEKSEITALRNIL 443
           + V  G   +P        +G P     + GDM VQ  I   K     EK    AL ++ 
Sbjct: 365 LKVIPG--TQPDQVVSIPNKGVPRGLSGARGDMKVQYRIVMKKPQSKAEKFLWEALADVT 422

Query: 444 PGLKSKDTKDPD 455
               ++ T++ D
Sbjct: 423 GDKTARRTENID 434

>KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} similar
           to uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
           Protein involved in folding of mitochondrially
           synthesized proteins in the mitochondrial matrix
           localizes to the mitochondrial inner membrane member of
           the DnaJ family of molecular chaperones
          Length = 473

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 59/232 (25%), Positives = 92/232 (39%), Gaps = 42/232 (18%)

Query: 223 CPHCSGTGLRKKHFQKPEISCTSCNGQGFKERITRLAGGYMVKDHTVCDACKGKGRYRKK 282
           CP CSGTG R                         +  G+ +   + C+ C G+G   + 
Sbjct: 223 CPGCSGTGTR-----------------------VHIRAGFQMA--STCNQCGGEGSVVRD 257

Query: 283 SASDTCKHCSGKGL-INEEKSQTVYIPRGSRHGDEFRL------PQMADMEYGKET---- 331
             SDTC  C G+G  +N++ +  V +P G + GD  R+      P +A     K+T    
Sbjct: 258 --SDTCATCHGEGASLNKDHAIKVDLPHGLQDGDVIRISGQGSYPNIAVDPAMKDTVRLS 315

Query: 332 -GDVIIVIDEDSSKSHLERKSNDLHTTLNISLVDALTGFSTIVCETYDNRRLRVNVPAGK 390
            GDV++ I  D       +   D+  T +I +  A  G   +   T D  ++R+ V  G 
Sbjct: 316 RGDVLLRIRVDKDPRFQIKNKYDIWLTQDIPITTAALG-GIVTVPTVDGEQVRLKVAPG- 373

Query: 391 VIRPGNYFKFKGEGWPLSNGDSFGDMYVQINIEFPKDNWFNEKSEITALRNI 442
             +  +      +G P     S GDM VQ  I   K     E+    AL ++
Sbjct: 374 -TQHNDVVSISQKGVPRGAFGSRGDMKVQYKISIKKPQSQAERCLWEALADV 424

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 50/78 (64%), Gaps = 4/78 (5%)

Query: 67  YDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEI 126
            D  + PY  LGV K A+  EI+KAY KLA KYHPD  I++A  E ++  F ++  AYEI
Sbjct: 35  LDELKDPYATLGVSKSASGSEIKKAYYKLAKKYHPD--INKA--EDAQKKFHDLQNAYEI 90

Query: 127 LSDPELKSRYDMYGDSAF 144
           LSD   + ++D +G +AF
Sbjct: 91  LSDDSKRQQWDQFGPAAF 108

>TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1.185
           YJL162C
          Length = 586

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 40/64 (62%), Gaps = 4/64 (6%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y VLG+   A+  EIRK+Y KLA   HPDK    ++   SE +FK V+ A+ IL DPELK
Sbjct: 16  YSVLGLTSKASVSEIRKSYMKLAKSLHPDK----SKSNASEELFKIVSNAHSILIDPELK 71

Query: 134 SRYD 137
             YD
Sbjct: 72  LDYD 75

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
           (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 50/76 (65%), Gaps = 4/76 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+L ++  AT +EI+KAYRK ++K HPDK  ++    T+   F+ ++ AY++LSD  L+
Sbjct: 8   YDLLDIDITATAIEIKKAYRKKSIKEHPDKNPNDP---TATERFQAISEAYQVLSDKNLR 64

Query: 134 SRYDMYG-DSAFGSGG 148
           + YD +G + A   GG
Sbjct: 65  ANYDKFGKEKAIPKGG 80

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTAAYEILSD 129
           PY++LGV   A++ +I+ AYRKL++K+HPDK+   +   E+   E  + ++T AYE L+D
Sbjct: 126 PYEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAYESLTD 185

Query: 130 PELKSRYDMYG 140
             ++  Y  YG
Sbjct: 186 ELVRQNYLKYG 196

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
           similarities with uniprot|P48353 Saccharomyces
           cerevisiae YMR161W
          Length = 232

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++L VEK A++ EI+KAYRKLA++ HPDK         SEA FK +  A+E+LSD   +
Sbjct: 26  YELLQVEKGASDNEIKKAYRKLAIRLHPDK---NTHPRASEA-FKRINRAFEVLSDVGKR 81

Query: 134 SRYDMYG 140
             +D  G
Sbjct: 82  RMFDQLG 88

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
           (REAL)
          Length = 431

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 49/76 (64%), Gaps = 4/76 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A+ +EI+KAYRK +++ HPDK  ++ +   +   F+ ++ AY++L D EL+
Sbjct: 8   YDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDPK---ATERFQAISEAYQVLGDNELR 64

Query: 134 SRYDMYG-DSAFGSGG 148
            +YD YG   A   GG
Sbjct: 65  VKYDKYGRKEAIPQGG 80

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
           (REAL)
          Length = 168

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 44/87 (50%), Gaps = 5/87 (5%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T Y++L +  DAT+ EI+KAYR   L  HPDK+        +     ++  AY+ILS+ +
Sbjct: 8   THYEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNNQ 67

Query: 132 LKSRYDM-----YGDSAFGSGGNGFPE 153
            +  YD      Y    F + G+G  E
Sbjct: 68  KRGEYDKTILENYKKQGFHNCGDGLDE 94

>CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar to
           uniprot|P47138 Saccharomyces cerevisiae YJR097w
          Length = 175

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 53/99 (53%), Gaps = 12/99 (12%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKI----IDEAERETSEAMFKEVTAAYEILSD 129
           Y+VLGV  DA+  EI+  YRK+ L  HPDK     ID   +  S     ++  AY +LS+
Sbjct: 12  YEVLGVPVDASTDEIKLTYRKMLLTLHPDKSKTVPIDSTIKIRSGVSINQIQEAYRVLSN 71

Query: 130 PELKSRYD--------MYGDSAFGSGGNGFPEDDHEFDD 160
            +L++ Y+        + G + FG G + F  D+ EF++
Sbjct: 72  DQLRAAYNRALNDSNKLAGFNNFGDGLDEFNLDEFEFNE 110

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {ON}
           similar to uniprot|P48353 Saccharomyces cerevisiae
           YMR161W
          Length = 238

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++L VE+ A + EI+K+YRKLA++ HPDK         SEA FK +  A+E+L D E +
Sbjct: 24  YEILKVERTANDNEIKKSYRKLAIRLHPDK---NPHPRASEA-FKLINRAFEVLGDSEKR 79

Query: 134 SRYDMYG 140
           S YD  G
Sbjct: 80  SLYDRLG 86

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} similar
           to uniprot|P40564 YIR004W Saccharomyces cerevisiae DJP1
           Cytosolic J-domain-containing protein, required for
           peroxisomal protein import
          Length = 419

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T YD+LGV  DA  ++I+KAYRK +++ HPDK  ++    T+   F+ ++ AY++LS  +
Sbjct: 6   TYYDLLGVSPDAKSIDIKKAYRKKSVQEHPDKNPNDP---TATERFQAISQAYQVLSKDD 62

Query: 132 LKSRYDMYG 140
           L+++YD +G
Sbjct: 63  LRAKYDKFG 71

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 6/88 (6%)

Query: 59  RLTNSNVNYDMAQT---PYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERET 112
           R+TN++   + A     PY++LG+   ATE E+R +YRKL++K+HPDK+   + + ER  
Sbjct: 99  RITNNDALQESASLLFDPYELLGIGTSATEREVRSSYRKLSVKFHPDKLSKDLSQEERLQ 158

Query: 113 SEAMFKEVTAAYEILSDPELKSRYDMYG 140
            E  +  +T AY+ L++   +  Y  YG
Sbjct: 159 LEEQYVLITKAYKALTEEVTRENYLKYG 186

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 60/105 (57%), Gaps = 16/105 (15%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDE---AERETSEAMFKEVTAAYEILSDP 130
           YD+LG+  +AT +EI+KAYRK +++ HPDK  ++    ER      F+ ++ AY++LS+ 
Sbjct: 8   YDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDPGATER------FQAISEAYQVLSND 61

Query: 131 ELKSRYDMYGDSAFGSGGNGFPEDDHEF------DDFMNFFQQYQ 169
           EL+++YD  G       G GF +   +F      D F ++  + Q
Sbjct: 62  ELRAKYDRLGKQEAVPKG-GFEDAAEQFSAIFGGDAFASYIGELQ 105

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {ON}
           Anc_2.350 YMR161W
          Length = 227

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+L V+K A + EI+K+YRKLA+K HPDK       + SEA FK +  A+E+L D + +
Sbjct: 26  YDILKVDKTAQDNEIKKSYRKLAIKLHPDK---NPHPKASEA-FKRINRAFEVLGDEKKR 81

Query: 134 SRYDMYG 140
             +D  G
Sbjct: 82  VLFDRIG 88

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
           (DJP1) - involved in peroxisome biogenesis [contig 135]
           FULL
          Length = 421

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 48/69 (69%), Gaps = 3/69 (4%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T YD+LGV+  A  ++I+KAYRK +++ HPDK  ++    T+   F+ ++ AY++LS  +
Sbjct: 7   TYYDLLGVDPSAKAIDIKKAYRKKSVQEHPDKNPNDP---TATERFQAISQAYQVLSKED 63

Query: 132 LKSRYDMYG 140
           L+++YD YG
Sbjct: 64  LRAKYDKYG 72

>KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {ON}
           Anc_1.185 YJL162C
          Length = 555

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T Y +LG+  +AT++EIRK+Y  LA K HPDK   EA  E    +FK V  A+ IL+D E
Sbjct: 13  THYSILGLTPNATDIEIRKSYMNLARKLHPDKSKSEATGE----LFKLVVHAHSILTDVE 68

Query: 132 LKSRYD 137
            K  YD
Sbjct: 69  KKRAYD 74

>KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar to
           uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
           Protein required along with Dph1p Dph2p Kti11p and Dph5p
           for synthesis of diphthamide which is a modified
           histidine residue of translation elongation factor 2
           (Eft1p or Eft2p) contains a DnaJ-like domain,
          Length = 162

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTAAYE 125
           M ++ Y++LG+E DA+ +EI++AYR + L+ HPDK     +     TS     ++  AY+
Sbjct: 1   MQRSFYEILGIESDASNIEIKRAYRAMLLETHPDKSGLNYNSNGNNTSSHSVTDIQEAYQ 60

Query: 126 ILSDPELKSRYD 137
            L D +L+ +YD
Sbjct: 61  TLIDQDLRKKYD 72

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 50/102 (49%), Gaps = 16/102 (15%)

Query: 67  YDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKII--DEAERETSEAMFKEVTAAY 124
           YD  +  Y +LGV  +A   EIRKAY  L  KYHPDKI      ++E+      ++  AY
Sbjct: 537 YDPKKDYYKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAY 596

Query: 125 EILSDPELKSRYDMYG--------------DSAFGSGGNGFP 152
           E LSD + +  YD+                ++ F + GNGFP
Sbjct: 597 ETLSDEDKRKEYDLSKSNPRRNTFAQGPRQNNMFKNPGNGFP 638

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (63%), Gaps = 2/66 (3%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKI--IDEAERETSEAMFKEVTAAYEILSDPE 131
           Y +LG+ K+AT  +IRKAY +L  +YHPDK   + E+E++ +     E+  AYE LSD  
Sbjct: 561 YKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETLSDEA 620

Query: 132 LKSRYD 137
            KS YD
Sbjct: 621 KKSEYD 626

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTAAYEILSD 129
           PY +LGV   AT+ E+R AYRKL++K+HPDK+   + + +R   E  +  +T AY+ L+D
Sbjct: 117 PYTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTD 176

Query: 130 PELKSRYDMYG 140
              K  Y  +G
Sbjct: 177 EITKENYLKFG 187

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 48/96 (50%), Gaps = 18/96 (18%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKII---DEAERETSEAMFKEVTAAYEILSDP 130
           Y VLGV   AT  EIRKAY  L  KYHPDKI    ++ E    E M  ++  AYE LSD 
Sbjct: 537 YKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHETM-SQINEAYETLSDD 595

Query: 131 ELKSRYDM--------------YGDSAFGSGGNGFP 152
           + +  YD+                ++ F + GNGFP
Sbjct: 596 DKRKEYDLSRSNPRRNTFAQGPRQNNMFKNPGNGFP 631

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
           Anc_2.350 YMR161W
          Length = 219

 Score = 55.5 bits (132), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y+VL VE+ A++ EI+KAYR+LA+K HPDK        ++EA FK +  A+E+L D + +
Sbjct: 25  YEVLQVERTASDNEIKKAYRRLAIKLHPDK---NGHPRSAEA-FKVINRAFEVLGDEDKR 80

Query: 134 SRYDMYG 140
             +D  G
Sbjct: 81  RLFDQLG 87

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 48/102 (47%), Gaps = 15/102 (14%)

Query: 66  NYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKII--DEAERETSEAMFKEVTAA 123
           +YD  +  Y  LGV   AT  EIRKAY  L  KYHPDKI      ++E+      ++  A
Sbjct: 532 SYDPKKDYYKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEA 591

Query: 124 YEILSDPELKSRYDMYGD-------------SAFGSGGNGFP 152
           YE LSD   +  YD+                S F + GNGFP
Sbjct: 592 YEALSDDNKRKEYDLSRSNPHRNTFAQGPRQSMFKNQGNGFP 633

>NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185
          Length = 594

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T Y +LG+   AT+ EIRK+Y K A K HPDK    ++ +T   +FK V  A+ IL+D E
Sbjct: 18  TYYSILGLHPQATDNEIRKSYMKFARKLHPDK----SKSDTCAELFKLVVHAHSILTDKE 73

Query: 132 LKSRYD 137
           LK  YD
Sbjct: 74  LKLEYD 79

>AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR254C (SEC63)
          Length = 669

 Score = 57.0 bits (136), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 44/71 (61%), Gaps = 3/71 (4%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTAAYEILSD 129
           PY++L V   AT+ EIR AYRKL++K+HPDK+   + + ER   E  +  +T AY+ L+D
Sbjct: 116 PYELLQVGSGATDREIRSAYRKLSVKFHPDKLAKDLQDTERSVLEEQYVLITKAYKALTD 175

Query: 130 PELKSRYDMYG 140
              +  +  YG
Sbjct: 176 DATRDNFLRYG 186

>SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar to
           uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
           Protein required along with Dph1p Dph2p Kti11p and Dph5p
           for synthesis of diphthamide which is a modified
           histidine residue of translation elongation factor 2
           (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 165

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 55/100 (55%), Gaps = 9/100 (9%)

Query: 69  MAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETS--EAMFKEVTAAYEI 126
           M ++ Y+VL VE  A+  +I++AYR+  L  HPDK   +  R  +  +A  +++  AY +
Sbjct: 1   MNKSHYEVLAVEAGASLSQIKRAYRERLLDTHPDKKNGQQARSQAHTQASIEQIQQAYRV 60

Query: 127 LSDPELKSRYDM-----YGDSAFGSGGNGFPEDDHEFDDF 161
           L+DP  + +YD      Y    F + G+G   D++  D+F
Sbjct: 61  LADPTRREQYDAELAKSYKMQGFHNTGDGL--DEYSLDEF 98

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 57.0 bits (136), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 36/103 (34%), Positives = 51/103 (49%), Gaps = 16/103 (15%)

Query: 66  NYDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEA--ERETSEAMFKEVTAA 123
           NYD  +  Y +LGV   A+  EIRKAY  L  KYHPDKI      ++E+      ++  A
Sbjct: 532 NYDPKKDYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEA 591

Query: 124 YEILSDPELKSRYDMY--------------GDSAFGSGGNGFP 152
           YE LSD + +  YD+                ++ F + G+GFP
Sbjct: 592 YETLSDDDKRKEYDLSRSNPRRNTFPQGPRQNNMFKNPGSGFP 634

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {ON}
           Anc_2.350 YMR161W
          Length = 220

 Score = 54.7 bits (130), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/119 (32%), Positives = 58/119 (48%), Gaps = 27/119 (22%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++L V + A + EI+KAYRKLA+K HPDK       + +EA FK +  A+E+L + E +
Sbjct: 24  YEILKVNRTANDSEIKKAYRKLAIKLHPDK---NPHPKAAEA-FKLINRAFEVLGNSEKR 79

Query: 134 SRYDMYG--------------DSAFGSGGNGFPEDDHEFDDFMNFFQQYQRQQHGPHAS 178
             ++  G              +SAF S    FP         MNF   + R +H   A+
Sbjct: 80  EIFNRIGRDPDDRHVPSNAASESAFSSQSEHFP---------MNFENAFFRNRHAGAAA 129

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar to
           Ashbya gossypii AFL190C
          Length = 243

 Score = 55.1 bits (131), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++L ++K+A++ +++KAYRKLA+K HPDK         +EA FK++  A+E+LSD   +
Sbjct: 26  YELLQIDKEASDSDVKKAYRKLAIKLHPDK---NRHPRAAEA-FKKINRAFEVLSDENKR 81

Query: 134 SRYDMYG 140
             YD  G
Sbjct: 82  KVYDQIG 88

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar to
           uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 54.7 bits (130), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++L V K A+E +I+KAYRKLA+K HPDK         SEA FK++  A+E+LSD   +
Sbjct: 24  YEMLKVGKSASESDIKKAYRKLAIKLHPDK---NRHPRASEA-FKKINRAFEVLSDDSKR 79

Query: 134 SRYDMYG 140
             +D  G
Sbjct: 80  RIFDQLG 86

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 51/101 (50%), Gaps = 14/101 (13%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDK--IIDEAERETSEAMFKEVTAAYEILSDPE 131
           Y VLGV + AT  +IRK+Y  +  KYHPDK   + EA++  ++    E+  AYEILSD  
Sbjct: 507 YKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSDEG 566

Query: 132 LKSRYD--------MYGDSAFGSGGNGFPEDDHEFDDFMNF 164
            +  YD            S FG G  GFP     F   MNF
Sbjct: 567 KRKEYDDQRSGRAPQGQGSPFGQG--GFPFGSGNFK--MNF 603

>KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON}
           Anc_1.297 YJL073W
          Length = 668

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 42/80 (52%), Gaps = 5/80 (6%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDK--IIDEAERETSEAMFKEVTAAYEILSDPE 131
           Y +LGV K++    IRKAY  L  KYHPDK   + + E+E +     E+  AYEIL D  
Sbjct: 556 YKILGVAKNSDSKNIRKAYLNLTKKYHPDKQGQLSQKEQEQNHEKMSEINEAYEILGDES 615

Query: 132 LKSRYDMYGDSAFGSGGNGF 151
            K  YD   D   G+G   F
Sbjct: 616 KKKEYD---DGRLGNGNAHF 632

>ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER048C (CAJ1)
          Length = 578

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (60%), Gaps = 3/69 (4%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           YD+LGV   A   +  KAYR  A++ HPD          + A F+EV+ AY++LSDP+LK
Sbjct: 8   YDILGVTPSAFAEQNNKAYRMKAIQTHPDM---NPTHPYAHAKFQEVSKAYKVLSDPDLK 64

Query: 134 SRYDMYGDS 142
           +RY  +G S
Sbjct: 65  NRYTEFGLS 73

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 42/71 (59%), Gaps = 3/71 (4%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTAAYEILSD 129
           PY +L V   +T+ EIR AYRKL++K+HPDK+   +   ER   E  +  +T AY+ L+D
Sbjct: 118 PYALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALTD 177

Query: 130 PELKSRYDMYG 140
              +  Y  YG
Sbjct: 178 EVTRENYLKYG 188

>NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8.698
           YOR254C
          Length = 680

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 68/137 (49%), Gaps = 17/137 (12%)

Query: 8   VKYSERFSS-SKPYVFFTTGRFSVLHIWKYQMFKKQYEQEGHVDEEGAIGCTRLTNSNVN 66
           +K+  +++S SK    F      ++  W    +  Q        ++ AIG          
Sbjct: 70  IKFRSKYTSKSKLSCLFNWKNLFIVVGWAVVFYLVQRISNNDAIKQAAIGI--------- 120

Query: 67  YDMAQTPYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTAA 123
           +D    PYD+LG+   +++ +I+ AYRKL++K+HPDK+   +   ER   E  + ++T A
Sbjct: 121 FD----PYDILGISSSSSDKDIKSAYRKLSIKFHPDKLSKDLSADERIVMEEKYVQITKA 176

Query: 124 YEILSDPELKSRYDMYG 140
           YE L+D  ++  Y  YG
Sbjct: 177 YEALTDETVRENYLKYG 193

>TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {ON}
           Anc_1.297 YJL073W
          Length = 715

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 3/76 (3%)

Query: 66  NYDMAQTPY-DVLGVEKDATEVEIRKAYRKLALKYHPDK--IIDEAERETSEAMFKEVTA 122
           N DMA   Y  +LGV+K++   EIRK+Y  L  KYHPDK   + E E+E +    +++  
Sbjct: 597 NADMANKDYYKILGVKKNSQLKEIRKSYLSLTKKYHPDKQGQLSEEEQERNHKKMEQINE 656

Query: 123 AYEILSDPELKSRYDM 138
           AYE LSD   +  YD+
Sbjct: 657 AYECLSDESKRKEYDL 672

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 38/66 (57%), Gaps = 2/66 (3%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDK--IIDEAERETSEAMFKEVTAAYEILSDPE 131
           Y VLG+ K A+  EIRKAY  L  KYHPDK   + E E+E       +V  AYEILSD  
Sbjct: 524 YKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEILSDEG 583

Query: 132 LKSRYD 137
            K  YD
Sbjct: 584 KKRDYD 589

>KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {ON}
           Anc_1.185 YJL162C
          Length = 544

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 44/66 (66%), Gaps = 4/66 (6%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T Y +LGV  DAT  EI K+YRKLA+K HPDK    ++ +  E +FK V  A+ +L++ E
Sbjct: 9   THYSLLGVHFDATNEEISKSYRKLAMKLHPDK----SKSDKCEELFKLVVHAHSVLTNGE 64

Query: 132 LKSRYD 137
            +++Y+
Sbjct: 65  ERAKYN 70

>KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar to
           uniprot|P47138 Saccharomyces cerevisiae YJR097W JJJ3
           Protein required along with Dph1p Dph2p Kti11p and Dph5p
           for synthesis of diphthamide which is a modified
           histidine residue of translation elongation factor 2
           (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 10/93 (10%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++LGV+  +T  EI+KAY++  L  HPDK       E      +E+  AY++L +P  K
Sbjct: 8   YEILGVDTKSTVAEIKKAYKEKLLCTHPDK---NRTVEAQNVSIEEIKEAYQVLVNPSGK 64

Query: 134 SRYD-----MYGDSAFGSGGNGFPEDDHEFDDF 161
             YD      Y    F +GG G   +D+  D+F
Sbjct: 65  ENYDKELAESYKKQGFYNGGEGL--EDYSLDEF 95

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 3/71 (4%)

Query: 73  PYDVLGVEKDATEVEIRKAYRKLALKYHPDKI---IDEAERETSEAMFKEVTAAYEILSD 129
           PY +L +   +T+ EIR AYRKL++K+HPDK+   +   ER   E  +  +T AY+ L+D
Sbjct: 116 PYALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKALTD 175

Query: 130 PELKSRYDMYG 140
              +  Y  YG
Sbjct: 176 EITRENYLRYG 186

>ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa]
           {ON} similar to uniprot|P47138 Saccharomyces cerevisiae
           YJR097W JJJ3 Protein required along with Dph1p Dph2p
           Kti11p and Dph5p for synthesis of diphthamide which is a
           modified histidine residue of translation elongation
           factor 2 (Eft1p or Eft2p) contains a DnaJ-like domain
          Length = 162

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 49/93 (52%), Gaps = 4/93 (4%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T Y+VL V+ DA+ +EI++AYR   L  HPDK  DE  +         +  AY +LSD +
Sbjct: 3   THYEVLRVKFDASLIEIKQAYRDRLLNAHPDKNNDE-NKPALNVSVNAIQEAYRVLSDEK 61

Query: 132 LKSRYD---MYGDSAFGSGGNGFPEDDHEFDDF 161
           L+  YD   + G    G  G G   D++  D+F
Sbjct: 62  LRREYDHEVVEGQKNSGYVGTGDGLDEYSLDEF 94

>KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|P46997 Saccharomyces
           cerevisiae YJL162C JJJ2 Protein that may function as a
           cochaperone as suggested by the presence of a DnaJ-like
           domain
          Length = 590

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 43/66 (65%), Gaps = 4/66 (6%)

Query: 72  TPYDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           T Y VLG++ DA+E +I+KAYR++A+  HPDK     +  ++  MFK V+ A  +L D E
Sbjct: 12  THYSVLGLKSDASESQIKKAYRRIAMAIHPDK----NKSASAAEMFKLVSHAQSVLIDKE 67

Query: 132 LKSRYD 137
           L+  Y+
Sbjct: 68  LRRTYN 73

>TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {ON}
           Anc_1.92 YGL128C
          Length = 312

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 6/72 (8%)

Query: 74  YDVLGVEKDATEV---EIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDP 130
           YD+LG   + + +   EI+K YR LALKYHPDK  ++    T    F ++T A  IL++ 
Sbjct: 16  YDILGFHNNNSTITSNEIKKRYRSLALKYHPDKTPNDL---TLVEKFHKITIALNILTNN 72

Query: 131 ELKSRYDMYGDS 142
           +LK+ YD + +S
Sbjct: 73  QLKTEYDKWLNS 84

>Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON}
           (110867..111739) [873 nt, 291 aa]
          Length = 290

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 43/68 (63%), Gaps = 6/68 (8%)

Query: 75  DVLGVEKDATEV---EIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPE 131
           D++G  +   E+   EIRK YR+LALKYHPDK I   +    +++F +++ A +IL D  
Sbjct: 23  DLVGNRRQPNEITLTEIRKEYRRLALKYHPDKNISNVD---IDSIFHDISLANQILCDSS 79

Query: 132 LKSRYDMY 139
           L+ +YD +
Sbjct: 80  LREQYDKW 87

>NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa]
           {ON} Anc_1.297
          Length = 635

 Score = 54.7 bits (130), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 49/96 (51%), Gaps = 6/96 (6%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDK--IIDEAERETSEAMFKEVTAAYEILSDPE 131
           Y +L V KDA   +IRK+Y  L  K+HPDK   + E E++  +    E+  AYE+LSD  
Sbjct: 529 YKILDVSKDAGAKDIRKSYLNLTKKFHPDKQGQLSEKEQKKIQEKMSEINEAYEVLSDET 588

Query: 132 LKSRYDMYGDSAFGSGGNGFPEDDHEFDDFMNFFQQ 167
            ++ YD+          NG  ++     DF   FQQ
Sbjct: 589 KRNEYDLNRSGNHNGMANGGAQN----FDFGRMFQQ 620

>SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {ON}
           similar to uniprot|Q757X4 Ashbya gossypii AEL112C
           AEL112Cp and some similarites with YJL162C
           uniprot|P46997 Saccharomyces cerevisiae YJL162C JJJ2
           Protein that may function as a cochaperone as suggested
           by the presence of a DnaJ-like domain
          Length = 583

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 4/64 (6%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y VLG+  DAT+ +IRK+Y KLA + HPDK    ++ E +  +FK V  A+ IL+D E +
Sbjct: 14  YSVLGLPFDATDAQIRKSYMKLARELHPDK----SKSEVAAELFKVVAHAHSILTDREKR 69

Query: 134 SRYD 137
            +YD
Sbjct: 70  LKYD 73

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR161W
           (HLJ1)
          Length = 235

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133
           Y++L V++ A++ +I+KAYRK+A+K HPDK         +EA FK+V  A+E+LSD + +
Sbjct: 26  YELLQVDEKASDGDIKKAYRKMAIKLHPDK---NRHPRAAEA-FKKVNRAFEVLSDEKKR 81

Query: 134 SRYDMYG 140
             YD  G
Sbjct: 82  RVYDQLG 88

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,595,012
Number of extensions: 2919085
Number of successful extensions: 10516
Number of sequences better than 10.0: 399
Number of HSP's gapped: 10020
Number of HSP's successfully gapped: 425
Length of query: 512
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 398
Effective length of database: 40,409,475
Effective search space: 16082971050
Effective search space used: 16082971050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)