Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19162g8.263ON52852828210.0
SAKL0H17006g8.263ON53151921030.0
YLR089C (ALT1)8.263ON59248620240.0
Skud_12.1578.263ON59248620200.0
Suva_10.1738.263ON59248620200.0
Smik_12.1488.263ON59248620150.0
TDEL0F039008.263ON55953120100.0
ZYRO0C01628g8.263ON53448919900.0
KNAG0G020408.263ON59148819840.0
NCAS0B050208.263ON56848619750.0
NDAI0B019908.263ON58848619690.0
CAGL0L12254g8.263ON57448419400.0
Kpol_392.58.263ON51249618700.0
KAFR0B027308.263ON53949118210.0
KLTH0G13662g8.263ON51948218160.0
Kwal_56.237918.263ON51851918080.0
NCAS0B038408.263ON49748617950.0
Skud_4.3728.263ON50748717760.0
TPHA0J007508.263ON52252017690.0
Smik_4.3578.263ON50750317610.0
Suva_2.2718.263ON50750317600.0
KNAG0M012108.263ON52148717570.0
Ecym_43078.263ON53449417510.0
KAFR0B055308.263ON51448717480.0
NDAI0J013608.263ON50148717440.0
YDR111C (ALT2)8.263ON50748717390.0
KAFR0B05520singletonON51048717320.0
AGR085W8.263ON52152217280.0
TPHA0A018008.263ON49849216850.0
TBLA0E044408.263ON56248316910.0
TBLA0F030608.263ON50049416600.0
Kpol_543.398.263ON49248816490.0
TBLA0G01630singletonON50049315930.0
Kwal_34.160181.472ON3791611534e-10
CAGL0J05126g1.321ON4333521223e-06
TDEL0D019001.321ON4431711223e-06
KAFR0A017101.321ON4351811204e-06
TPHA0O014501.321ON4431681205e-06
SAKL0D11528g1.472ON3831521197e-06
SAKL0F02156g3.511ON4982531181e-05
Suva_6.1361.321ON4441711171e-05
KLLA0F03509g2.252ON3871691161e-05
NDAI0B045502.102ON5651801172e-05
Kpol_1035.231.321ON4443571152e-05
KNAG0B053201.321ON4331651133e-05
KNAG0B006603.511ON4961221125e-05
ZYRO0G20636g1.321ON4531391108e-05
KLLA0F10021g3.511ON4973251109e-05
NDAI0G057601.321ON4481421091e-04
Kpol_1039.222.252ON3861691081e-04
Skud_10.1561.321ON4601711072e-04
Kwal_23.48882.252ON3891531062e-04
Ecym_32902.252ON3861271062e-04
KNAG0E018502.252ON3841221062e-04
NCAS0E006703.511ON4971441072e-04
Kpol_278.23.511ON4981221062e-04
YJL060W (BNA3)1.321ON4441711053e-04
TDEL0A016008.204ON4751881053e-04
TPHA0D033703.511ON4971291053e-04
Smik_10.1801.321ON4441441054e-04
KLTH0G09614g2.252ON3891551044e-04
Kwal_14.25741.321ON4431381029e-04
AEL170C1.321ON4583611010.001
NCAS0A092001.321ON4451391000.001
SAKL0H21824gna 1ON4991251000.001
KLTH0G19624gsingletonON4681831000.001
KLLA0F01617g1.321ON4443511000.001
CAGL0G01254g3.511ON5041221000.002
TDEL0C040902.252ON383123990.002
KLTH0B00176g8.204ON448183990.002
Kwal_47.189823.511ON496222990.002
YGL202W (ARO8)3.511ON500149990.002
SAKL0E08492g2.252ON384123980.002
NCAS0B064402.252ON385175980.002
TPHA0F012602.252ON392177980.002
NDAI0I028303.511ON500122980.002
Kpol_1032.398.204ON453190970.003
KAFR0B023808.204ON443181970.003
KLTH0G19646g1.472ON379151970.003
SAKL0D06886g1.321ON447327970.003
KLTH0H10648g1.321ON443321960.004
NDAI0B037302.252ON386126960.004
YHR137W (ARO9)2.102ON513267960.004
KLTH0G02002g3.511ON496160960.004
Smik_7.693.511ON500122950.005
Kwal_47.17462na 1ON492201950.006
KAFR0D014203.511ON492196940.007
Suva_7.613.511ON500324940.007
ZYRO0A01672g2.252ON386123930.008
Kwal_26.77682.475ON422144930.010
Skud_7.693.511ON500149920.014
Ecym_7228na 1ON488156920.015
Ecym_6319singletonON354137910.016
ADL249W2.252ON387124910.017
KNAG0G005501.472ON38754900.021
CAGL0C01243g2.252ON383122880.033
Ecym_62921.321ON430133880.034
Kpol_480.11.472ON380360880.034
ZYRO0G05346g2.102ON504133880.034
TDEL0D057903.511ON497114880.040
Kpol_1035.302.102ON50144880.044
AFR548C3.511ON497125870.048
Skud_8.1982.102ON517173860.062
KLLA0A04906gna 1ON480124850.081
Smik_8.2182.102ON513274850.092
TPHA0O015202.102ON50344850.095
TBLA0I011802.475ON443345840.12
YIL116W (HIS5)2.252ON385123830.14
NCAS0B072202.102ON510162830.16
ZYRO0C06028g3.511ON49660820.19
Skud_9.552.252ON385123820.21
SAKL0G02838g5.449ON243142800.21
Kwal_8.5858.204ON44641820.22
Ecym_55428.204ON446187810.23
SAKL0E02948g2.475ON423268810.25
NCAS0G040501.472ON384124800.29
TBLA0B009902.102ON546159810.30
SAKL0E12188g2.102ON530161800.34
TBLA0B080808.204ON444179800.36
Suva_9.782.252ON386123790.39
CAGL0G06028g2.102ON537160800.40
Suva_15.3342.102ON560165800.41
KLTH0D05478g2.475ON421145790.44
ZYRO0B11088g8.204ON450183790.45
KAFR0J015802.252ON383127790.48
CAGL0K08580g2.475ON453183780.59
KLLA0D11110g2.102ON530129780.65
KLTH0E07678gna 1ON492133770.74
KNAG0G016808.204ON45233760.98
SAKL0H20658g4.155ON471118761.1
Kpol_431.132.475ON443325751.6
CAGL0I06578g8.204ON436178741.6
Smik_5.3198.204ON443178741.6
Suva_5.2818.204ON45032741.7
KLTH0H08976g4.155ON471118741.9
ABL038W2.475ON443346742.0
Smik_9.532.252ON388123732.5
KNAG0H037302.102ON523173732.5
YER152C8.204ON44333705.0
Suva_15.3172.147ON957108715.1
NDAI0C059608.204ON47851705.7
NCAS0A038308.204ON44632697.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19162g
         (528 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...  1091   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   814   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   784   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   782   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   782   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   780   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   778   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   771   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   768   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   765   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   763   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   751   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   724   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   706   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   704   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   701   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   696   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   688   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   686   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   682   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   682   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   681   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   679   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            677   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   676   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   674   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   671   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   670   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   653   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   655   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   644   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   639   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              618   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    64   4e-10
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    52   3e-06
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    52   3e-06
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    51   4e-06
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    51   5e-06
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    50   7e-06
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    50   1e-05
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    50   1e-05
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    49   1e-05
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    50   2e-05
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    49   2e-05
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    48   3e-05
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    48   5e-05
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    47   8e-05
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    47   9e-05
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    47   1e-04
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    46   1e-04
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    46   2e-04
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    45   2e-04
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    45   2e-04
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    45   2e-04
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     46   2e-04
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    45   2e-04
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    45   3e-04
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    45   3e-04
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    45   3e-04
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    45   4e-04
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    45   4e-04
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    44   9e-04
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    44   0.001
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    43   0.001
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    43   0.001
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    43   0.001
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    43   0.001
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    43   0.002
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    43   0.002
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    43   0.002
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    43   0.002
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    43   0.002
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    42   0.002
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    42   0.002
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    42   0.002
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    42   0.002
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    42   0.003
KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {O...    42   0.003
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    42   0.003
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    42   0.003
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    42   0.004
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    42   0.004
YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromat...    42   0.004
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    42   0.004
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    41   0.005
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    41   0.006
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    41   0.007
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    41   0.007
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    40   0.008
Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W...    40   0.010
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    40   0.014
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    40   0.015
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    40   0.016
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    40   0.017
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       39   0.021
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    39   0.033
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    39   0.034
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    39   0.034
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    39   0.034
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    39   0.040
Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON} (69909....    39   0.044
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    38   0.048
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    38   0.062
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    37   0.081
Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W ...    37   0.092
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    37   0.095
TBLA0I01180 Chr9 complement(252457..253788) [1332 bp, 443 aa] {O...    37   0.12 
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    37   0.14 
NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2...    37   0.16 
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    36   0.19 
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    36   0.21 
SAKL0G02838g Chr7 complement(232634..233365) [732 bp, 243 aa] {O...    35   0.21 
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    36   0.22 
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    36   0.23 
SAKL0E02948g Chr5 complement(241418..242689) [1272 bp, 423 aa] {...    36   0.25 
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    35   0.29 
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    36   0.30 
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    35   0.34 
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    35   0.36 
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    35   0.39 
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    35   0.40 
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    35   0.41 
KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} simila...    35   0.44 
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    35   0.45 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    35   0.48 
CAGL0K08580g Chr11 complement(865470..866831) [1362 bp, 453 aa] ...    35   0.59 
KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} simila...    35   0.65 
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    34   0.74 
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    34   0.98 
SAKL0H20658g Chr8 complement(1811772..1813187) [1416 bp, 471 aa]...    34   1.1  
Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,...    33   1.6  
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    33   1.6  
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    33   1.6  
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    33   1.7  
KLTH0H08976g Chr8 complement(772894..774309) [1416 bp, 471 aa] {...    33   1.9  
ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic ho...    33   2.0  
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    33   2.5  
KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.1...    33   2.5  
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    32   5.0  
Suva_15.317 Chr15 (551916..554789) [2874 bp, 957 aa] {ON} YHR120...    32   5.1  
NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa] ...    32   5.7  
NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204     31   7.0  

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score = 1091 bits (2821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/528 (100%), Positives = 528/528 (100%)

Query: 1   MLSVRVNLKTRISSGMIRVNAPALKSTMPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLK 60
           MLSVRVNLKTRISSGMIRVNAPALKSTMPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLK
Sbjct: 1   MLSVRVNLKTRISSGMIRVNAPALKSTMPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLK 60

Query: 61  AKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQH 120
           AKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQH
Sbjct: 61  AKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQH 120

Query: 121 PELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDG 180
           PELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDG
Sbjct: 121 PELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDG 180

Query: 181 EISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLR 240
           EISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLR
Sbjct: 181 EISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLR 240

Query: 241 EEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIV 300
           EEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIV
Sbjct: 241 EEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIV 300

Query: 301 VIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGY 360
           VIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGY
Sbjct: 301 VIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGY 360

Query: 361 MELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDAL 420
           MELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDAL
Sbjct: 361 MELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDAL 420

Query: 421 DERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLEN 480
           DERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLEN
Sbjct: 421 DERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLEN 480

Query: 481 TGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 528
           TGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD
Sbjct: 481 TGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 528

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/519 (74%), Positives = 451/519 (86%), Gaps = 6/519 (1%)

Query: 16  MIRVN-APALKSTMPSVTSLTQLRFSTTV----KPAPKLSLDDVNENVLKAKYAVRGRIP 70
           M+R   A  +   MP  T   +   S  V    +PA KLSL+D+NENVL+AKYAVRG+IP
Sbjct: 13  MLRTTTAGNIAKNMPHSTLFLRSFSSNFVPYKFQPADKLSLEDLNENVLRAKYAVRGKIP 72

Query: 71  MRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEA-DE 129
            +AEEL++QL +DP SLPF +II+ANIGNPQQLDQKPLTFYR+VLSLLQ+P++LEE   E
Sbjct: 73  QKAEELKNQLARDPKSLPFDRIINANIGNPQQLDQKPLTFYRQVLSLLQNPDMLEEIPRE 132

Query: 130 ALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIY 189
            L  +YK D+I RA RLLS +GGSVGAYS SQGV G R+TVADFITKRD GE +Y EDI+
Sbjct: 133 QLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGVYGFRKTVADFITKRDGGEEAYAEDIF 192

Query: 190 LTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDP 249
           LTAGASAAVSYILSILC+GP TGVLIPIPQYPLYTASLALNNS  LPYYL EE NWST+P
Sbjct: 193 LTAGASAAVSYILSILCRGPQTGVLIPIPQYPLYTASLALNNSHALPYYLDEESNWSTNP 252

Query: 250 EEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQE 309
           EEIE+VV ++I KG++P CLVVINPGNPTGAILS +SI+KIFEVAAKYGIVVIADEVYQE
Sbjct: 253 EEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILSPESIEKIFEVAAKYGIVVIADEVYQE 312

Query: 310 NVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHD 369
           NVF G++F+SM+KVL++LQ+ +HG++DNIQLASLHSTSKGVSGECGQRGGYMEL+GF+HD
Sbjct: 313 NVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLASLHSTSKGVSGECGQRGGYMELLGFSHD 372

Query: 370 IRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFE 429
           +RQVFLKLASISLCPVVTGQALVDLMV PP+PGD SYEQDQ+ER +IHDALD RAS L+E
Sbjct: 373 VRQVFLKLASISLCPVVTGQALVDLMVCPPKPGDASYEQDQKERSEIHDALDARASMLYE 432

Query: 430 TFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGS 489
           TF+RLEGIEC+KPQGAMYL+P+LDL YK +Q+A+HL + PDEFYC+ LLE TGICTVPGS
Sbjct: 433 TFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKAEHLSLSPDEFYCQELLEATGICTVPGS 492

Query: 490 GFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 528
           GFGQVPGTYHLRTTFL PGT+W++ WE+FHK F+++YRD
Sbjct: 493 GFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKKFYNEYRD 531

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  784 bits (2024), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/486 (74%), Positives = 427/486 (87%), Gaps = 2/486 (0%)

Query: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104
           PA +L+L+DVNENVLKAKYAVRG IPMRAEEL+ QL+KDP SLPF +II+ANIGNPQQL 
Sbjct: 107 PAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQ 166

Query: 105 QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162
           QKPLT+YR+VLSLLQ+PELL + ++ L    L+K D+IKRAK L+ ++GGSVGAYS SQG
Sbjct: 167 QKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQG 226

Query: 163 VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222
           V+GIR++VA+FITKRD+GEISYPEDI+LTAGASAAV+Y+LSI C+GP TGVLIPIPQYPL
Sbjct: 227 VEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPL 286

Query: 223 YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282
           YTA+LALNNS+ LPYYL E   WST+PEEIE VV +AIQ  IKPT LVVINPGNPTGA+L
Sbjct: 287 YTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVL 346

Query: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 342
           S +SI +IFEVAAKYG VVIADEVYQEN+F G+KF+SMKK+LR+LQ+ + G++DN+QLAS
Sbjct: 347 SPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLAS 406

Query: 343 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 402
           LHSTSKGVSGECGQRGGYMEL GF+H++RQV LKLASISLCPVVTGQALVDLMV PP  G
Sbjct: 407 LHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEG 466

Query: 403 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 462
           +ES+E DQ ER  IH+ L  RA  L+ETF+ LEGIEC+KPQGAMYL+PK+DLP+K +QEA
Sbjct: 467 EESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEA 526

Query: 463 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 522
           +HLE+ PDEFYCK LLE+TGICTVPGSGFGQ PGTYHLRTTFL PG EW++ WE FHK F
Sbjct: 527 RHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEF 586

Query: 523 FDKYRD 528
           FD+YRD
Sbjct: 587 FDQYRD 592

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/486 (74%), Positives = 428/486 (88%), Gaps = 2/486 (0%)

Query: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104
           PA +L+L+DVNENVLKAKYAVRG IPMRAEEL+ QL+KDP SLPF KII+ANIGNPQQL 
Sbjct: 107 PAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQ 166

Query: 105 QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162
           QKPLT+YR+VLSLLQ+PELL + ++ L    L+K D+IKRAK L+ ++GGSVGAYS SQG
Sbjct: 167 QKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQG 226

Query: 163 VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222
           V+GIR++VA+FITKRDDGEISYPEDI+LTAGASAAV+Y+LSI C+GP TGVLIPIPQYPL
Sbjct: 227 VEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPL 286

Query: 223 YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282
           YTA+LALNNS+ LPYYL E+  WST+PEEIE VV +AIQ  IKPT LVVINPGNPTGA+L
Sbjct: 287 YTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVL 346

Query: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 342
           S +S+ +IFEVAAKYG VVIADEVYQEN+F G+KF+SMKK+LR LQ+ + G++DN+QLAS
Sbjct: 347 SPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLAS 406

Query: 343 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 402
           LHSTSKGVSGECGQRGGYMEL GF+H++RQV LKLASISLCPVVTGQALVDLMV PP  G
Sbjct: 407 LHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEG 466

Query: 403 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 462
           +ES+E DQ ER  IH+ L  RA  L++TF+ LEGIEC+KPQGAMYL+PK+DLP+K +QEA
Sbjct: 467 EESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEA 526

Query: 463 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 522
           +HLE+ PDEFYCK+LLE+TGICTVPGSGFGQ PGTYHLRTTFL PG EW++ WE FHK F
Sbjct: 527 RHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEF 586

Query: 523 FDKYRD 528
           FD+YRD
Sbjct: 587 FDQYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/486 (75%), Positives = 425/486 (87%), Gaps = 2/486 (0%)

Query: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104
           PA +L+LDDVNENVLKA+YAVRG IPMRAEEL+ QL+KDP SLPF+KII+ANIGNPQQL 
Sbjct: 107 PAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQ 166

Query: 105 QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162
           QKPLT+YR+VLSLLQ+PELL   ++ L    L+K D+IKRAK L+ ++GGSVGAYS SQG
Sbjct: 167 QKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQG 226

Query: 163 VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222
           V+GIR++VADFITKRD GE +YPEDI+LTAGASAAV+Y+LSI C+GP TGVLIPIPQYPL
Sbjct: 227 VEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPL 286

Query: 223 YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282
           YTA+LALNNS+PLPYYL E   WST+PEEIE VV +AIQ  IKPT LVVINPGNPTGA+L
Sbjct: 287 YTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVL 346

Query: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 342
           S +SI +IFEVAAKYG VVIADEVYQEN+F G++F SMKKVLR+LQ+ + G++DN+QLAS
Sbjct: 347 SPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLAS 406

Query: 343 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 402
           LHSTSKGVSGECGQRGGYMEL GF+H++RQV LKLASISLCPVVTGQALVDLMV PP  G
Sbjct: 407 LHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEG 466

Query: 403 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 462
           +ES+E DQ ER  IH+ L+ RA  L+ETF+ LEGIEC+KPQGAMYL+PK+D+P+K IQEA
Sbjct: 467 EESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEA 526

Query: 463 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 522
            HLE+ PDEFYCK LLE+TGICTVPGSGFGQ PGTYHLRTTFL PG EW++ WE FHK F
Sbjct: 527 HHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEF 586

Query: 523 FDKYRD 528
           FD+YRD
Sbjct: 587 FDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/486 (74%), Positives = 425/486 (87%), Gaps = 2/486 (0%)

Query: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104
           PA +L+LDDVNENVLKAKYAVRG IPMRAEEL+ QL+KDP SLPF+KII+ANIGNPQQL 
Sbjct: 107 PAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQ 166

Query: 105 QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162
           QKPLT+YR+VLSLLQ+PELL + ++ L    L+K D+IKRAK L+ E+GGSVGAYS SQG
Sbjct: 167 QKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGAYSSSQG 226

Query: 163 VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222
           V+GIR +VA+FITKRD+GEISYPEDI+LTAGASAAV+Y+LSI C+GP TGVLIPIPQYPL
Sbjct: 227 VEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPL 286

Query: 223 YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282
           YTA+LALNNS+ LPYYL E   WST+PEEIE VV +AI+  IK T LVVINPGNPTGA+L
Sbjct: 287 YTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGNPTGAVL 346

Query: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 342
           S +SI +IFEVAAKYG VVIADEVYQEN+F G+KF+SMKK+LR+LQ+ + G++DN+QLAS
Sbjct: 347 SPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLAS 406

Query: 343 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 402
           LHSTSKGVSGECGQRGGYMEL GF+H++RQV LKLASISLCPVVTGQALVDLMV PP  G
Sbjct: 407 LHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPLEG 466

Query: 403 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 462
           +ES+E DQ ER  IH+ L  RA  L++TF+ LEGIEC+KPQGAMYL+PK+DLP++ +QEA
Sbjct: 467 EESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFRAVQEA 526

Query: 463 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 522
           +HLE+ PDEFYCK LLE+TGICTVPGSGFGQ PGTYHLRTTFL PG EW++ WE FHK F
Sbjct: 527 RHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEF 586

Query: 523 FDKYRD 528
           FD YRD
Sbjct: 587 FDHYRD 592

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/531 (69%), Positives = 442/531 (83%), Gaps = 5/531 (0%)

Query: 3   SVRVNLKTRISSGMIRVNAPALKSTMPSVTSLTQL---RFSTTVKPAPKLSLDDVNENVL 59
           ++   L+ R   G   +N    +ST  +   L  +   +      PA  L++ D+NENVL
Sbjct: 29  TITTTLQGRSGLGRSYMNIKRARSTSSTAAGLHHIYHKKCHQDFYPAESLTVRDLNENVL 88

Query: 60  KAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQ 119
           KAKYAVRG IPMRAEEL++QLK+DPSSLPF KI++ANIGNPQQL+QKPL+FYR+VLS+LQ
Sbjct: 89  KAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQ 148

Query: 120 HPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKR 177
           +PE+LE+ +E L  + ++K D+I+RAKR+L +VGGSVGAYS SQGV GIR+TVADFIT+R
Sbjct: 149 YPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSSSQGVYGIRKTVADFITER 208

Query: 178 DDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPY 237
           D GE +YPEDI+LTAGASAAVSY+LSILC+G  TGVLIPIPQYPLYTA+LALNNS  LPY
Sbjct: 209 DSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPY 268

Query: 238 YLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKY 297
           YL EE  WST+  EIE VV ++I+ GI+P+ LVVINPGNPTG++LS ++I+KIF+VAAKY
Sbjct: 269 YLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKY 328

Query: 298 GIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQR 357
           GIVVIADEVYQEN+F GS+F+SMKKVLR LQK + G YDN+QL SLHSTSKGVSGECGQR
Sbjct: 329 GIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQR 388

Query: 358 GGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIH 417
           GGYMEL GF H+IRQV LKLASISLCPVVTGQALVDLMV PP+PGDESYEQD++ERE IH
Sbjct: 389 GGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIH 448

Query: 418 DALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKAL 477
           + LD RA  L +TF+ LEGIEC+KP+GAMYL+P++ LPYK IQ AQHLE  PDEFYC+ L
Sbjct: 449 EELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKL 508

Query: 478 LENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 528
           LE TGICTVPGSGFGQ PGTYHLRTTFL PGTEW++ WE FHK F+D+YRD
Sbjct: 509 LEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYDQYRD 559

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/489 (74%), Positives = 418/489 (85%), Gaps = 2/489 (0%)

Query: 42  TVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQ 101
            V PA KL L +VNENVLKAKYAVRG IPM A EL  +LKKDP SLPF  I+SANIGNPQ
Sbjct: 46  AVYPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQ 105

Query: 102 QLDQKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQ 159
            L QKPLTFYR+VLSLLQ+P LLEE ++ L    LY+ D+I RA+RLL+++G SVGAYS 
Sbjct: 106 HLKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYST 165

Query: 160 SQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQ 219
           SQG+QGIRETVA FIT+RD GE +Y EDI+LTAGAS+AVSY+LSILCKG  TGVLIPIPQ
Sbjct: 166 SQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQ 225

Query: 220 YPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTG 279
           YPLYTASLALNNS PLPYYL E+  WST+P EIE VV +AI++ IKP+ LVVINPGNPTG
Sbjct: 226 YPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTG 285

Query: 280 AILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQ 339
           A+LSE+ I +IF +AAKYGIVVIADEVYQENVF G++F+SMKK+LR LQK+  G +DN+Q
Sbjct: 286 AVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQ 345

Query: 340 LASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPP 399
           LASLHSTSKGVSGECGQRGGYME+ GFN+DIRQV LKLASISLCPVVTGQALVDLMVSPP
Sbjct: 346 LASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPP 405

Query: 400 QPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVI 459
           +PGDESYE DQQER+ IH+AL ERA KL  TF+ LEGIEC+KP+GAMYL+P+L LP+K I
Sbjct: 406 KPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAI 465

Query: 460 QEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFH 519
           Q A+H  M PD FYCK LLE TGICTVPGSGFGQ PGTYHLRTTFL PGTEW+E WE FH
Sbjct: 466 QSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFH 525

Query: 520 KAFFDKYRD 528
           KAF+++YRD
Sbjct: 526 KAFYEEYRD 534

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/488 (73%), Positives = 426/488 (87%), Gaps = 4/488 (0%)

Query: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104
           PA ++ + D+NENVLKAKYAVRG IPMRAE+L+ QL++DP SLPF KII+ANIGNPQQL+
Sbjct: 104 PAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLN 163

Query: 105 QKPLTFYREVLSLLQHPELLEEADE---ALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQ 161
           QKPL+FYR+VLSLLQ PELL    E   A  +LYK D+++RA++LL ++GGSVGAYS SQ
Sbjct: 164 QKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQ 223

Query: 162 GVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYP 221
           GV GIR+TVADFIT+RD+ E +YPEDI+LTAGASAAVSY+LSI CKG  TGVLIPIPQYP
Sbjct: 224 GVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYP 283

Query: 222 LYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAI 281
           LYTA+LALNNS  LPYYL E+  WST+ +EI+ VVLDAI + IKP+ LVVINPGNPTGA+
Sbjct: 284 LYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAV 343

Query: 282 LSEQSIQKIFEVAAKYGIVVIADEVYQENVF-KGSKFYSMKKVLRNLQKTYHGQYDNIQL 340
           LSE++I +IFE+AAKYGIVVIADEVYQEN+F +  KF+SMKKVLR LQ+ + G++D +QL
Sbjct: 344 LSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQL 403

Query: 341 ASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQ 400
           ASLHSTSKGVSGECGQRGG+MEL GF+H+IRQV LKLASISLCPVVTGQALVDLMV PPQ
Sbjct: 404 ASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQ 463

Query: 401 PGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQ 460
            G+ESYE DQ ER  IH  L +RA+KL+ETF+RLEGI+C+KPQGAMYL+P+L+LP+K +Q
Sbjct: 464 EGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQ 523

Query: 461 EAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHK 520
           +AQH+EM  DEFYCK LLENTGICTVPGSGFGQVPGTYHLRTTFL PGTEW++ WEKFHK
Sbjct: 524 KAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHK 583

Query: 521 AFFDKYRD 528
            F++KYRD
Sbjct: 584 EFYNKYRD 591

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/486 (73%), Positives = 423/486 (87%), Gaps = 2/486 (0%)

Query: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104
           PA +L+L ++N+NVLKAKYAVRG IPMRAEEL+ QL++DPSSLPF  I++ANIGNPQQL+
Sbjct: 83  PADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQLN 142

Query: 105 QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162
           QKPL+FYR+VLSLLQ+PE+L++ +  L    L+K D+++RAK LL E+GG+VGAYS SQG
Sbjct: 143 QKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSASQG 202

Query: 163 VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222
           V GIR+TVA+FITKRD+GE +YPEDI+LTAGASAAV Y+LSILCKGP TGVLIPIPQYPL
Sbjct: 203 VYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPL 262

Query: 223 YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282
           YTASLALNNS  LPYYL E+  WST+P+EIE+VVL A  K I+P+ LVVINPGNPTGA+L
Sbjct: 263 YTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVL 322

Query: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 342
           SE+SI+ IFE+AAKYGIVVIADEVYQENVF   KF+SMKKVLRNLQK + G YD +QLAS
Sbjct: 323 SEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLAS 382

Query: 343 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 402
           LHSTSKGVSGECGQRGGYMEL GF H++R V LKLASISLCPVVTGQALVDLMVSPP+ G
Sbjct: 383 LHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPKKG 442

Query: 403 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 462
           DES+EQDQ ER+ I   L  RA +L++ F+ LEGIEC+KPQGAMYL+P+LDLP+K +Q+A
Sbjct: 443 DESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQKA 502

Query: 463 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 522
           QHLEM PDEFYCK+LLE TGICTVPGSGFGQ PGTYHLRTTFL PGTEW+E W+ FH+ F
Sbjct: 503 QHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQDF 562

Query: 523 FDKYRD 528
           ++ YRD
Sbjct: 563 YNTYRD 568

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/486 (73%), Positives = 420/486 (86%), Gaps = 2/486 (0%)

Query: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104
           PA +L+L D+NENVLKAKYAVRG IPMRAEEL+ QL+ +PS+LPFS+I++ANIGNPQQL 
Sbjct: 103 PAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLK 162

Query: 105 QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162
           QKPL+FYR+VLS+LQ+P++L+E ++ L    +YK D+I RAK LLSE+GGSVGAYS SQG
Sbjct: 163 QKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSASQG 222

Query: 163 VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222
           V GIR+TVA+FIT+RD GE +YPEDI+LT        Y+LSILC+GP TGVLIPIPQYPL
Sbjct: 223 VYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPL 282

Query: 223 YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282
           YTA+LALNNS  LPYYL E+  WST+P+EIE+VV DA+++ I P+ LVVINPGNPTGA+L
Sbjct: 283 YTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVL 342

Query: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 342
           +E+SI+ IFE+AAKYGIVVIADEVYQEN+  G KFYSMKKVLR LQK++ G++DN+QLAS
Sbjct: 343 TEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLAS 402

Query: 343 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 402
           LHSTSKGVSGECGQRGGYMEL+GF H++R+V LKLASISLCPVVTGQALVDLMVSPP+ G
Sbjct: 403 LHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPKKG 462

Query: 403 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 462
           D SYEQDQ ER  I   L  RAS+L+ETF  LEGIEC+KPQGAMYL+PKLDLP+K +QEA
Sbjct: 463 DASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEA 522

Query: 463 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 522
           QHLEM PDEFYCK+LL+ TGICTVPGSGFGQ PGTYHLRTTFL PGTEW++ WE FHK F
Sbjct: 523 QHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHKEF 582

Query: 523 FDKYRD 528
           +D YRD
Sbjct: 583 YDNYRD 588

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/484 (72%), Positives = 412/484 (85%)

Query: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104
           PA + +L DVNE VL AKYAVRG IPMRAEEL+ QL ++P SLPF+ II+ANIGNPQQL 
Sbjct: 91  PAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIGNPQQLK 150

Query: 105 QKPLTFYREVLSLLQHPELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQ 164
           QKPL+FYR+VLSLLQ+PEL+   +   QT+ K D+I RAKRLL ++GGSVGAYS SQGV 
Sbjct: 151 QKPLSFYRQVLSLLQYPELIPTLENNPQTMIKQDAIDRAKRLLDDIGGSVGAYSSSQGVL 210

Query: 165 GIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYT 224
           GIR+TVADFIT RDDG I+YPEDI+LTAGAS+AV Y+LSI C+G  TGVLIPIPQYPLYT
Sbjct: 211 GIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYT 270

Query: 225 ASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSE 284
           A+LAL NS  LPYYL EE  WSTDPEE+E ++LD+I+  IKP+ LVVINPGNPTGA+LSE
Sbjct: 271 ATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINPGNPTGAVLSE 330

Query: 285 QSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLH 344
           ++I++IF +AAKYGI+VIADEVYQENVF+  KF+SMKKVLR LQ    G YDN+QLASLH
Sbjct: 331 EAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLH 390

Query: 345 STSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDE 404
           STSKGVSGECGQRGGYMELVGF HDIRQV LKLASISLCPVVTGQALVDLMV PPQ G+E
Sbjct: 391 STSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMVCPPQKGEE 450

Query: 405 SYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQH 464
           SYEQDQ+ER +IH  L +RA+ L + F +L+GI C+KPQGAMYL+PKL+LPYK IQEA H
Sbjct: 451 SYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPYKAIQEALH 510

Query: 465 LEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFD 524
            +M PDEFYCK+LLE TGICTVPGSGFGQ PGTYHLRTTFL PGT+W+E W  FH+ F++
Sbjct: 511 QDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQEFYN 570

Query: 525 KYRD 528
           K+++
Sbjct: 571 KFKN 574

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/496 (69%), Positives = 410/496 (82%), Gaps = 6/496 (1%)

Query: 33  SLTQLRFSTTVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKI 92
           S T       V PA KL +DD+N+NVLKAKYAVRG IP+RAEEL+  L+     LPF  +
Sbjct: 23  STTLYEHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTV 81

Query: 93  ISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADEALQTLYKTDSIKRAKRLLSEVGG 152
           I+ANIGNPQQL QKPLTFYR+VLS+LQ+PELLE        ++K D+I+RA++LL E+G 
Sbjct: 82  INANIGNPQQLKQKPLTFYRQVLSILQYPELLESGS----NIFKKDAIERARKLLKEIG- 136

Query: 153 SVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTG 212
           SVG+YS SQG+  IR+TVA+FITKRDDGEIS P DI+LTAGAS+AV Y+LSILCK   +G
Sbjct: 137 SVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSG 196

Query: 213 VLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVI 272
           VLIPIPQYPLYTA+LALNN+  LPYYL E + WSTD  EIE+V+ D++ KGIKPT LV+I
Sbjct: 197 VLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVII 256

Query: 273 NPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYH 332
           NPGNPTG+ILS +S++KI EVAA +GIV+IADEVYQENVF  +KF+SMKKVLRNLQK + 
Sbjct: 257 NPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFP 316

Query: 333 GQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALV 392
           G+YD +QLASLHSTSKGVSGECGQRGGYMEL GFN +I+QV LKL SISLCPVVTGQALV
Sbjct: 317 GEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALV 376

Query: 393 DLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKL 452
           DLMVSPPQ GDESYEQDQ ER  I + L  RA  L+E F+ +EG+ C+KP+GAMYL+PK+
Sbjct: 377 DLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKI 436

Query: 453 DLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWV 512
           DLP+KV+Q++Q L++ PDEFYCKALLE TGICTVPGSGFGQ PGTYHLRTTFL PGTEW+
Sbjct: 437 DLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWI 496

Query: 513 ETWEKFHKAFFDKYRD 528
           + W KFH  F+DKYRD
Sbjct: 497 DRWNKFHAEFYDKYRD 512

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/491 (69%), Positives = 410/491 (83%), Gaps = 2/491 (0%)

Query: 38  RFSTTVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANI 97
           + +   KPA +L++ D+NENVLKAKYAVRG+IP RAEEL+ QL + P+SLPF KII+ANI
Sbjct: 47  KHNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANI 106

Query: 98  GNPQQLDQKPLTFYREVLSLLQHPELLE--EADEALQTLYKTDSIKRAKRLLSEVGGSVG 155
           GNPQQL Q+PL+FYR+VLSLLQ+P LL   E       +YK D+I RAK++L ++GGSVG
Sbjct: 107 GNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVG 166

Query: 156 AYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLI 215
           AYS+SQGV GIR TVA+FIT+RD GE +YPEDI+LTAGASAAV+Y+LSILCKG  TGVLI
Sbjct: 167 AYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLI 226

Query: 216 PIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPG 275
           PIPQYPLYTA+LALNNS  LPY+L E   WS +P EIE V+  A+Q  IKP  LVVINPG
Sbjct: 227 PIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPG 286

Query: 276 NPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQY 335
           NPTGA+LS+++I  I E+AAKYGIVVIADEVYQEN+F G KF+S+K VLR LQ+   G++
Sbjct: 287 NPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKF 346

Query: 336 DNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLM 395
           DN+QLASLHSTSKGVSGECGQRGGYME++GF H++RQV LKLASISLCPVVTGQALVDLM
Sbjct: 347 DNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLM 406

Query: 396 VSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLP 455
           VSPP+ G+ES+  DQ +R+ IH  L +RA  L++TF+ L+GIEC+KP GAMYL+PKL+LP
Sbjct: 407 VSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLP 466

Query: 456 YKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETW 515
           Y+ IQEAQ LE+ PDEFYCK LLE+TGICTVPGSGFGQV GTYHLRTTFL PG EW+++W
Sbjct: 467 YRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSW 526

Query: 516 EKFHKAFFDKY 526
           ++FH  F +KY
Sbjct: 527 KQFHIEFMEKY 537

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/482 (69%), Positives = 402/482 (83%), Gaps = 2/482 (0%)

Query: 48  KLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKP 107
           K +L DVN+ VL AKYAVRG IP+RAEELR +L ++P SLPF+KII+ANIGNPQQLDQKP
Sbjct: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKP 98

Query: 108 LTFYREVLSLLQHPELLEEADEA-LQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGI 166
           LTFYR+VLSLLQ+P L+E      L  L+K D+++RAK++L +VGGSVGAYS SQGV G 
Sbjct: 99  LTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGF 158

Query: 167 RETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTAS 226
           R++VA+FI +RD GE +   DI+LTAGAS+AVS ILS+ C G   G LIPIPQYPLYTA+
Sbjct: 159 RQSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTAT 217

Query: 227 LALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQS 286
           LALN++  LPYYL E   WS D E++EQVV DAI+KG++PTCLVVINPGNPTGAILS ++
Sbjct: 218 LALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEA 277

Query: 287 IQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHST 346
           I+KI  VAAKY +VVIADEVYQEN F  + F SMKKVLR LQKT  G+YDN+QLASLHST
Sbjct: 278 IEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHST 337

Query: 347 SKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESY 406
           SKGVSGECGQRGGYMELVGF+ +++QVFLKLASISLCPVVTGQALVDLMV PP+ GD SY
Sbjct: 338 SKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASY 397

Query: 407 EQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLE 466
           E D+QER  IH++L ++++ L+ETF  LEG+ C+KPQGAMYL+PKLDL  K I++A+ L 
Sbjct: 398 ELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLG 457

Query: 467 MEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKY 526
           M PDE+YCK LLE TGICTVPGSGF QVPGTYHLRTTFL PGTEWV++W+KFH+ F D++
Sbjct: 458 MAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEH 517

Query: 527 RD 528
           RD
Sbjct: 518 RD 519

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  701 bits (1808), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/519 (64%), Positives = 418/519 (80%), Gaps = 4/519 (0%)

Query: 12  ISSGMIRVNAPALKSTMPSVTSLTQLRFSTTVKP-APKLSLDDVNENVLKAKYAVRGRIP 70
           +S  +IR + P  +  +  +++   LR   + KP   K +L D+NE VL AKYAVRG IP
Sbjct: 2   LSRPIIR-SMPHSRLVLRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIP 60

Query: 71  MRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADEA 130
           +RAEEL+ +L ++P SLPF KII+ANIGNPQQLDQKPLTFYR+VL+LLQ+P+L+ +    
Sbjct: 61  LRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSG 120

Query: 131 -LQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIY 189
            L   +K D+++RAK++L +VGGSVGAYS SQGV G RE+VA+FI +RD GE +  +DI+
Sbjct: 121 ELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIF 179

Query: 190 LTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDP 249
           LT GAS AVSYILS+ C GP  G LIPIPQYPLYTASLALNNS  LPYYL EE  WS D 
Sbjct: 180 LTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDT 239

Query: 250 EEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQE 309
           E+IE+VV D+I+KGI+PTCLVVINPGNPTGA+L+  +I+ + +VAAKY +V+IADEVYQE
Sbjct: 240 EQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQE 299

Query: 310 NVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHD 369
           N F  ++F SMKKVLR LQKT  G+YDN+QLASLHSTSKGVSGECGQRGGYMELVGF+ +
Sbjct: 300 NGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEE 359

Query: 370 IRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFE 429
           ++QVFLKLASISLCPVVTGQAL+DLMV PP+ GD SYEQD+QER DIHDAL +R+  L++
Sbjct: 360 VKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQ 419

Query: 430 TFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGS 489
            F  +EG+ C++PQGAMYL+PKL+L  K I +A+   + PDE+YCK LLE TGICTVPGS
Sbjct: 420 AFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGS 479

Query: 490 GFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 528
           GFGQVPGT+HLRTTFL PGTEW+++W+KFH+ F + +RD
Sbjct: 480 GFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHRD 518

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/486 (66%), Positives = 402/486 (82%), Gaps = 1/486 (0%)

Query: 44  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 103
           +PAPKLSL D+NENV+ AK+A+RG I ++AE+L+ QL K+P  LPF +I  ANIGNPQ+L
Sbjct: 12  QPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQEL 71

Query: 104 DQKPLTFYREVLSLLQHPELLEEADEAL-QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162
           +QKPLTF R+V+S+LQ+PELL   D    + ++ +DS  RA+RLL ++GGSVGAYS SQG
Sbjct: 72  NQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQG 131

Query: 163 VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222
           V GIR+T A++ITKRD GE SYPEDI+LT GA++A SY+LS+LC+GP TGVLIPIPQYPL
Sbjct: 132 VYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPL 191

Query: 223 YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282
           YTA+LALN S  +PYYL EE  WST+  EIE++VLD+I+KGIKP+ +VVINPGNPTGA+L
Sbjct: 192 YTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVL 251

Query: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 342
           SE +I KIF++AAKYGIVV+ADEVYQEN+F G +F+S KKVLR LQK Y G++DNIQLAS
Sbjct: 252 SELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLAS 311

Query: 343 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 402
           +HSTSKGV GECGQRGGYMELVGF  ++RQ+ LKLA +++C VVTGQA+VDLM+ PP+ G
Sbjct: 312 MHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKKG 371

Query: 403 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 462
           D SYE D++ER++I DA+ ERA KL+  F +L+GIEC+KPQGAMYLYP L L  K I +A
Sbjct: 372 DASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIAKA 431

Query: 463 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 522
           + L + PDEFYC  LL+ TGICTVPGSGFGQ  GTYHLRTTFL PG EW+  WEKFHK F
Sbjct: 432 ESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHKHF 491

Query: 523 FDKYRD 528
           ++KY+D
Sbjct: 492 YEKYQD 497

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/487 (65%), Positives = 403/487 (82%), Gaps = 2/487 (0%)

Query: 44  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 103
           KPA K++  D+N +V KA+YAVRG IP RA+EL+++LKK+P  LPF  II+ANIGNPQQL
Sbjct: 21  KPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQL 80

Query: 104 DQKPLTFYREVLSLLQHPELLEEADEALQTL--YKTDSIKRAKRLLSEVGGSVGAYSQSQ 161
           DQKPLTF R+VLS+L++PE+L+   E L +L  +  D++KRA+ LL ++GGSVGAYS SQ
Sbjct: 81  DQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSHSQ 140

Query: 162 GVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYP 221
           GV GIR+TVADFIT RD GE + PEDIYLT GAS+A + +LS+LCK   TG+LIPIPQYP
Sbjct: 141 GVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIPQYP 200

Query: 222 LYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAI 281
           LYTAS +L N++ LPYYL EE NWST+ +EIE+VV DA++KGI+P+ L+VINPGNPTGA+
Sbjct: 201 LYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAV 260

Query: 282 LSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLA 341
           L+E++I +I  +AAKYGI VI+DEVYQENVF   KF+SMKKVLR LQ  Y G++DN+QLA
Sbjct: 261 LTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLA 320

Query: 342 SLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQP 401
           SLHS SKG  GECGQRGGYME+VGF+ DIR    KL SIS+C VVTGQA+VDLMV+PPQP
Sbjct: 321 SLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQP 380

Query: 402 GDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQE 461
           GDESYEQD+QER  I + +  RA+ L+ETF+ LEGIEC+ PQGAMYL+P+L LP K  +E
Sbjct: 381 GDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAFRE 440

Query: 462 AQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKA 521
           ++ L +EPDEFYC +LLE+TGICTVPGSGFGQ PGTYH+RTTFL PGT+W++ W+ FH++
Sbjct: 441 SERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFHQS 500

Query: 522 FFDKYRD 528
           FF++YRD
Sbjct: 501 FFNEYRD 507

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/520 (65%), Positives = 423/520 (81%), Gaps = 3/520 (0%)

Query: 11  RISSGMIRVNAPALKSTMPSVTSLTQLRFS-TTVKPAPKLSLDDVNENVLKAKYAVRGRI 69
           R  S    VNA A+  +   + SLT +       KPA KL+++D+NENVLKAKYAVRG+I
Sbjct: 4   RSRSTNCTVNA-AIALSGKRLLSLTTISLKHKNFKPADKLTINDLNENVLKAKYAVRGKI 62

Query: 70  PMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADE 129
           P RAE L+ QL  +PSSLPF K+I+ANIGNPQQL+QKPLTFYR+VLSLLQ+P +L+E   
Sbjct: 63  PARAEVLKQQLIDNPSSLPFKKVINANIGNPQQLNQKPLTFYRQVLSLLQYPMVLDETFS 122

Query: 130 A-LQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDI 188
              +TLYK D+I+RAKR+L+++G SVG+YS SQGV G+R+TVA++I++RD GE +Y EDI
Sbjct: 123 GNTKTLYKQDAIERAKRILNDIGSSVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDI 182

Query: 189 YLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTD 248
           +LTAGAS+AVSY+L+ILCKG  +GVLIPIPQYPLYTA+LALNN+  LPYYL E   WST+
Sbjct: 183 FLTAGASSAVSYLLNILCKGKESGVLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTN 242

Query: 249 PEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQ 308
            EEIE VV +AI++ I P  LVVINPGNPTGAILS +SI+KIF+VAA +GIVVIADEVYQ
Sbjct: 243 MEEIENVVHNAIREKIIPRVLVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQ 302

Query: 309 ENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNH 368
           EN+F G++F+SMKKVLR+LQ+   G+Y+N+QLASLHSTSKGVSGECGQRGGYMEL GF+ 
Sbjct: 303 ENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFST 362

Query: 369 DIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLF 428
           +I+   LKL SISLCPVVTGQALVDLM  PP+ G+ SYEQDQ ER  IH  L ERA+ L+
Sbjct: 363 EIKHEILKLCSISLCPVVTGQALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLW 422

Query: 429 ETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPG 488
           + F+ +EG+ C+KPQG+MYL+PK+D+P+K +++AQ L++ PDE YC  LLE TGICTVPG
Sbjct: 423 KAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPG 482

Query: 489 SGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 528
           SGFGQ PGT+HLRTTFL PGT W++ W +FH+ F +KYRD
Sbjct: 483 SGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIFCNKYRD 522

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/503 (64%), Positives = 403/503 (80%), Gaps = 6/503 (1%)

Query: 28  MPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSL 87
           + SV +   L F    KPA K++  D+N  V KA+YAVRG IP RA+EL+++LK+ P  L
Sbjct: 9   LKSVFTTKDLNF----KPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVL 64

Query: 88  PFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADEALQTL--YKTDSIKRAKR 145
           PF  II+ANIGNPQQLDQKPLTF R+VLS+L++PE+L    + L +L  ++ D++ RA+ 
Sbjct: 65  PFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEH 124

Query: 146 LLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSIL 205
           LL ++GGS+GAYS SQGV GIR++VA+FITKRDDGE + PE+IYLT GAS+A + +LS+L
Sbjct: 125 LLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLL 184

Query: 206 CKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIK 265
           CK   TG+LIPIPQYPLYTAS +L N++ LPYYL E  NWST  +EIE+VV DA++KGIK
Sbjct: 185 CKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIK 244

Query: 266 PTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLR 325
           P+ L+VINPGNPTGA+LSE +I KI  +AAKYGI +I+DEVYQENVF G KF+SMKKVLR
Sbjct: 245 PSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLR 304

Query: 326 NLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPV 385
            LQ+ Y G++DN+QLASLHS SKG  GECGQRGGYME+VGF+ DIR    KL SIS+C V
Sbjct: 305 KLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSV 364

Query: 386 VTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGA 445
           VTGQA+VDLMV PPQPGDESY+QD  ER  I   +  RA+ L ETF+ LEGIEC+KPQGA
Sbjct: 365 VTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGA 424

Query: 446 MYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFL 505
           MYL+P+L LP K ++E++ L +EPDEFYC +LLE+TGICTVPGSGFGQ PGTYH+RTTFL
Sbjct: 425 MYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFL 484

Query: 506 PPGTEWVETWEKFHKAFFDKYRD 528
            PGT+W++ W+ FH+ FF+KYRD
Sbjct: 485 APGTQWIQDWKHFHQDFFNKYRD 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/503 (63%), Positives = 409/503 (81%), Gaps = 6/503 (1%)

Query: 28  MPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSL 87
           + SV +   L F    KPA KL+  D+N +V KA+YAVRG IP RAEEL+++LK+  +SL
Sbjct: 9   LKSVFTTKDLDF----KPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSL 64

Query: 88  PFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADEALQTL--YKTDSIKRAKR 145
           PF+ II+ANIGNPQQLDQKPLTF R+VLS+L++PE+L    + L +L  +  D++KRA+R
Sbjct: 65  PFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQR 124

Query: 146 LLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSIL 205
           LL ++GGSVGAYS SQGV GIR+TVADFIT+RD GE + PEDIYLT GAS+A + +LS+L
Sbjct: 125 LLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLL 184

Query: 206 CKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIK 265
           CK   TG+L+PIPQYPLYTAS +L N++ LPYYL EE +WST+ +EIE+VVLDA++KGI+
Sbjct: 185 CKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIR 244

Query: 266 PTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLR 325
           P+ LVVINPGNPTGA+L+E +I KI  +AAKYGI +I+DEVYQEN+F   KF+SMKK+LR
Sbjct: 245 PSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILR 304

Query: 326 NLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPV 385
            LQ  + G++DN+QLASLHS SKG  GECGQRGGYME+VGF+ DIR    KL SIS+C V
Sbjct: 305 KLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSV 364

Query: 386 VTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGA 445
            TGQA++DLMV PPQPGDESY+QD++ER  I++ +  RA+ L+ETF+ LEGI+C+KPQGA
Sbjct: 365 ATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGA 424

Query: 446 MYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFL 505
           MYL+PKL LP K ++E++ L +EPD  YC +LLE+TGICTVPGSGFGQ  GTYH+RTTFL
Sbjct: 425 MYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFL 484

Query: 506 PPGTEWVETWEKFHKAFFDKYRD 528
           PPGT+W++ W +FH+ FF+KYRD
Sbjct: 485 PPGTQWIQDWRQFHQDFFNKYRD 507

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/487 (64%), Positives = 403/487 (82%), Gaps = 2/487 (0%)

Query: 44  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 103
           +PA KL  DD+N+N++ A+YAVRG IPM+AEEL  QL + P  LPF+ I  ANIGNPQQL
Sbjct: 35  EPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQL 94

Query: 104 DQKPLTFYREVLSLLQHPELLEEADEALQT-LYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162
           DQKPLTF R+V+S+LQ+P LL+  ++ + +  YK D+ KRA  LL ++GGSVGAYS +QG
Sbjct: 95  DQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQG 154

Query: 163 VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222
           V GIRE+VADFIT+RD+GE + P+DI+LT GAS A +Y+LSILC+  +TG++IPIPQYPL
Sbjct: 155 VYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPL 214

Query: 223 YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282
           YTAS+ + NS  LPYYL EE  WST  EEIEQ V+D+I++G+ P  +VVINPGNPTGA+L
Sbjct: 215 YTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVL 274

Query: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTY-HGQYDNIQLA 341
           S  +I +I  +AAKYGIVV+ADEVYQ N++KG KF+SMKKVLR+LQ+ + +G+YDN+QLA
Sbjct: 275 SFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLA 334

Query: 342 SLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQP 401
           S+HSTSKGVSGECGQRGGYMELVGF++++RQV LKLASIS+C VVTGQALVDLM++PP+ 
Sbjct: 335 SMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPRE 394

Query: 402 GDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQE 461
           GD+SYE D +ER++IH+ +  R   L++TF +LEGIEC++PQGAMYL+PKL L  K I+E
Sbjct: 395 GDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEE 454

Query: 462 AQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKA 521
           A+ L ++PDEFYC  LL+ TGICTVPGSGFGQ  GTYH+RTTFL PGT+W++ WE FHKA
Sbjct: 455 AKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKA 514

Query: 522 FFDKYRD 528
           F+DKYRD
Sbjct: 515 FYDKYRD 521

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/494 (64%), Positives = 398/494 (80%), Gaps = 5/494 (1%)

Query: 35  TQLRFSTTVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIIS 94
           +++RF    +P   L L+D+N NVL+AKYAVRG+IP RA EL  QL +DP SLPF KII 
Sbjct: 46  SRIRF----EPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIY 101

Query: 95  ANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADEALQTLYKTDSIKRAKRLLSEVGGSV 154
           ANIGNPQQL QKPL+F REVLSLL+ P LL+   E L  +YK D+++RAKR++ ++  S+
Sbjct: 102 ANIGNPQQLGQKPLSFSREVLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSI 161

Query: 155 GAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVL 214
           GAYS SQGV G R+TVA++++ RD GE +  EDI+LT GAS   S ++ +LCKG  +GVL
Sbjct: 162 GAYSHSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVL 220

Query: 215 IPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINP 274
           IPIPQYPLYTA++ LNN+  LPYYL EE  WS + +++E++++++I+KG+KP CLVVINP
Sbjct: 221 IPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINP 280

Query: 275 GNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQ 334
           GNPTGAIL  +S+++IF +AAKY IVVIADEVYQENVF+G KFYSMKKVLR+LQ+ Y   
Sbjct: 281 GNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKEL 340

Query: 335 YDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDL 394
           + N+QL SLHSTSKG+SGECGQRGGYMELVGF+ DIR+V LK+ASI LC  V GQALVDL
Sbjct: 341 FSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDL 400

Query: 395 MVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDL 454
           M+S P+PGDESYE+D  ER  I +AL ER+  L+ETF+ LEG+ECRKPQG+MYL+P+L L
Sbjct: 401 MLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVL 460

Query: 455 PYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVET 514
           P K I+ A+ L+M+PDEFYC  LL +TGICTVPGSGFGQ P T HLRTTFL PGTEW+E+
Sbjct: 461 PQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIES 520

Query: 515 WEKFHKAFFDKYRD 528
           WE FHK+F+DKYRD
Sbjct: 521 WELFHKSFYDKYRD 534

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/487 (66%), Positives = 394/487 (80%), Gaps = 4/487 (0%)

Query: 44  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSS--LPFSKIISANIGNPQ 101
           KPA K++LDD+N+NVLK++YAVRG IP RAEEL  +L  + SS  L F  I+ ANIGNPQ
Sbjct: 29  KPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNPQ 88

Query: 102 QLDQKPLTFYREVLSLLQHPELLEEADEALQT-LYKTDSIKRAKRLLSEVGGSVGAYSQS 160
           QLDQKPLTF R+V+S+LQ+PELL + +  + T ++K+D+++RA+ LL  +GGSVGAYS S
Sbjct: 89  QLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYSSS 148

Query: 161 QGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQY 220
           QGV GIRETVA++IT RD+GE + P+DI+LT GAS A SY+LS+LCK  NTGVLIPIPQY
Sbjct: 149 QGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPIPQY 208

Query: 221 PLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGA 280
           PLYTA++ L +++ LPYYL EE  WST+  EIE+VVLDAI   +KP+ +VVINPGNPTG+
Sbjct: 209 PLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGS 268

Query: 281 ILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQL 340
           +LS+  I  I  + AKYGIV+IADEVYQEN+F G +F+SMKKVLR+LQK Y G+YD +QL
Sbjct: 269 VLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAVQL 327

Query: 341 ASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQ 400
           ASLHSTSKGVSGECGQRGGYMELVGF  +IRQ  LKLASISLC V+TGQALVDLMV+PP+
Sbjct: 328 ASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNPPK 387

Query: 401 PGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQ 460
            GDESYE D  ER++IH+ L ERA KL+  F +L+G+EC+KPQGAMYL+PKL  P  +I 
Sbjct: 388 KGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTLIT 447

Query: 461 EAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHK 520
           EA +  M PDEFYC ALLE TGICTVPGSGFGQ  GTYHLRTTFL PG +W E W+ FH+
Sbjct: 448 EAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLFHE 507

Query: 521 AFFDKYR 527
            FF KY+
Sbjct: 508 EFFSKYQ 514

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/487 (64%), Positives = 395/487 (81%), Gaps = 4/487 (0%)

Query: 44  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 103
           +PAPKLS+ D+N NV+KA++AVRG IPM+A+EL+ QL K+P SLPF++I  ANIGNPQ+L
Sbjct: 14  EPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQEL 73

Query: 104 DQKPLTFYREVLSLLQHPELLEEADEALQT---LYKTDSIKRAKRLLSEVGGSVGAYSQS 160
            QKPLTF R+V+S+LQ+PELL   +E   T   +Y  DS  RA++LL+E+GGSVGAYS S
Sbjct: 74  HQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSAS 133

Query: 161 QGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQY 220
           QGV GIR+T+A++IT+RD GE + P DI++T GA+AA SY+LSIL  GP TGVL+PIPQY
Sbjct: 134 QGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQY 193

Query: 221 PLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVL-DAIQKGIKPTCLVVINPGNPTG 279
           PLYTA LAL+N+  LPYYL EE  WS D  EIE+ +  +A+ KGI+P  +V+INPGNPTG
Sbjct: 194 PLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTG 253

Query: 280 AILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQ 339
           +ILSE S+ KIF +AAKYGIV+IADEVYQEN+F G+KF+S KKVLR+LQK +  QY+N+Q
Sbjct: 254 SILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQ 313

Query: 340 LASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPP 399
           LASLHSTSKG+ GECGQRGGYME++GFN+D+R + LKLA I +CPVVTGQA++DLM+ PP
Sbjct: 314 LASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPP 373

Query: 400 QPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVI 459
           + GD+SY+ D  ER+ IH+ +  RA KL++ FS +EGI+C+KPQGAMYL+P+L L  KVI
Sbjct: 374 KQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVI 433

Query: 460 QEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFH 519
            EA+  EMEPDEFYC  LL  TGICTVPGSGFGQ P TYHLRTTFL PG +W+  WEKFH
Sbjct: 434 DEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEKFH 493

Query: 520 KAFFDKY 526
           KAF  +Y
Sbjct: 494 KAFLKRY 500

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/487 (64%), Positives = 396/487 (81%), Gaps = 2/487 (0%)

Query: 44  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 103
           KPA K++  D+N  V KA+YAVRG IP RA+EL+++LKK+P  LPF  II+ANIGNPQQL
Sbjct: 21  KPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQL 80

Query: 104 DQKPLTFYREVLSLLQHPELLEEADEALQTL--YKTDSIKRAKRLLSEVGGSVGAYSQSQ 161
           DQKPLTF R+VL++L++PE+L      L +L  +  D+++RA+RLL+++GGS+GAYS SQ
Sbjct: 81  DQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHSQ 140

Query: 162 GVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYP 221
           GV GIR+TVADFIT+RD GE + PEDIYLT GAS+A + +LS+LCK   TG+LIPIPQYP
Sbjct: 141 GVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQYP 200

Query: 222 LYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAI 281
           LYTAS +L N++ LPYYL EE NWST+ +EIE+VV DA++K I+P+ L+VINPGNPTGA+
Sbjct: 201 LYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAV 260

Query: 282 LSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLA 341
           LSE++I +I  +AAKYGI +I+DEVYQEN+F   KF+SMKKVLR LQ  Y G++DN+QLA
Sbjct: 261 LSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLA 320

Query: 342 SLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQP 401
           SLHS SKG   ECGQRGGYME++GF+ +IR    KL SIS+C VVTGQA+VDLMV PPQP
Sbjct: 321 SLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQP 380

Query: 402 GDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQE 461
           GDESYEQD  ER  I   +  RA+ L+ETF  LEGIEC+KPQGAMYL+P+L LP K + E
Sbjct: 381 GDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALCE 440

Query: 462 AQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKA 521
           ++ L +EPDEFYC +LLE+TGICTVPGSGFGQ PGTYH+RTTFL PGT+W++ W++FH+ 
Sbjct: 441 SERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFHQD 500

Query: 522 FFDKYRD 528
           FF KYR+
Sbjct: 501 FFSKYRN 507

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/487 (64%), Positives = 398/487 (81%), Gaps = 4/487 (0%)

Query: 44  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQL--KKDPSSLPFSKIISANIGNPQ 101
           +PAPK+S+ D+N+ ++ A+YAVRG I MRAEEL  +L  K  P S PF +II ANIGNPQ
Sbjct: 25  EPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNPQ 84

Query: 102 QLDQKPLTFYREVLSLLQHPELLEEADEAL-QTLYKTDSIKRAKRLLSEVGGSVGAYSQS 160
           QLDQKPLTF R+V+S+L++P LL+  D  L Q +YK D+++RA+ L S++G SVGAYS +
Sbjct: 85  QLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSLA 144

Query: 161 QGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQY 220
           QGV GIRET A FI+KRD+ E +  +DI+LT GAS AV+Y++  LC+  +TG+LIPIPQY
Sbjct: 145 QGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQY 204

Query: 221 PLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGA 280
           PLYTAS+ ++N++ LPYYL EE  WST  EEIE  V++AI+ GIKP+ +VVINPGNPTGA
Sbjct: 205 PLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTGA 264

Query: 281 ILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQL 340
           +LS   IQ+I  VAAKYGIV+IADEVYQ+N+F G +F+SMKK+LR LQK Y G+YDN+QL
Sbjct: 265 VLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDNVQL 323

Query: 341 ASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQ 400
           ASLHSTSKGVSGECGQRGGYME+VGF+ ++R + LKLASI++C VVTGQALVDLMV PP 
Sbjct: 324 ASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDPPH 383

Query: 401 PGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQ 460
            GDESYE+DQ+ER +IH  L +RA KL++TFS LEGIEC+KPQGAMYL+P+L LP + I+
Sbjct: 384 VGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRAIE 443

Query: 461 EAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHK 520
           EA+ L+ME DEFYC  LLENTGICTVPGSGFGQ  GTYH+RTTFL PGTEW++ W+KFH+
Sbjct: 444 EAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKFHE 503

Query: 521 AFFDKYR 527
            F  +Y+
Sbjct: 504 KFMKEYQ 510

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/522 (62%), Positives = 406/522 (77%), Gaps = 6/522 (1%)

Query: 12  ISSGMIRVNAPA-----LKSTMPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLKAKYAVR 66
           ++ GM+R N+       L+  +     L+ ++  +   PA  ++L DVNENV+KAKYAVR
Sbjct: 1   MAIGMLRRNSSGTAVSVLQGRVLRTRRLSSVKDGSRFVPAEPMTLADVNENVVKAKYAVR 60

Query: 67  GRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEE 126
           G+IP RAEEL  +L++ P SLPFSKII ANIGNPQQL QKPLTFYR+V+SL+Q+P+LLE 
Sbjct: 61  GKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLLEM 120

Query: 127 ADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPE 186
             E LQ  +K D + RA+R+L + GGSVGAYS SQGV+G R TVA FI +RD G  + P+
Sbjct: 121 PAEWLQQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRD-GIPANPD 179

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           ++YLTAGAS+AVS +LS  CKGP TGVLIPIPQYPLYTA++  NN+  LPYYL E   WS
Sbjct: 180 NVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWS 239

Query: 247 TDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEV 306
           T+P+E+E+V+LD+ ++ I P CLVVINPGNPTG++LS + ++ I  +AAKYGIVVIADEV
Sbjct: 240 TNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEV 299

Query: 307 YQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGF 366
           YQ+NVF  +KF+SM+KVL+NLQ      Y N+QLASLHS SKG+SGECGQRGGYMEL+GF
Sbjct: 300 YQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGF 359

Query: 367 NHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASK 426
             ++R+VF+KLASISLCPVVTGQALVDLMV PP  GD SYEQ  QE   I+  L+ER+  
Sbjct: 360 REELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQL 419

Query: 427 LFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTV 486
           L++TF  LEGIEC  PQGA+YL+PKL LP K I+ AQ L +  DE YC  LL+ TGICTV
Sbjct: 420 LWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTV 479

Query: 487 PGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 528
           PG+GFGQ+PGTYH+RTTFLPPGT+W+E+W+ FHK F+DKYRD
Sbjct: 480 PGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYDKYRD 521

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/492 (61%), Positives = 385/492 (78%), Gaps = 6/492 (1%)

Query: 41  TTVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNP 100
           T   P  K++L D+N  ++K +YAVRG IP RAEEL+ QL+KDP SLPF+KII+ANIGNP
Sbjct: 7   TDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNP 66

Query: 101 QQLDQKPLTFYREVLSLLQHPELLEEADEALQTL-----YKTDSIKRAKRLLSEVGGSVG 155
           QQL QKPL+F R+VLS+LQ+P++LE+ +  LQTL     Y+ D ++RA++LL E+GGSVG
Sbjct: 67  QQLGQKPLSFIRKVLSILQYPDILED-ESKLQTLIELRVYQKDVVRRARKLLGEIGGSVG 125

Query: 156 AYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLI 215
           AYS SQGV GI++TVAD+ITKRD GE++YPEDI+LT GAS+AVS+IL + C GP TGVLI
Sbjct: 126 AYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLI 185

Query: 216 PIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPG 275
           PIPQYPLYTA++ L  +  + YYL EE NWS +  E+E  + ++I+ GIKPT +V+INPG
Sbjct: 186 PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245

Query: 276 NPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQY 335
           NPTG+IL+E+ I  I  ++AKYG+++IADEVYQENVF G++F+S+KKVLR LQ+ Y G Y
Sbjct: 246 NPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFY 305

Query: 336 DNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLM 395
           + +QLASLHSTSKG+ GECGQRGGYMEL+G   D+R   +KL SIS+C VVTGQAL+D++
Sbjct: 306 ETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMV 365

Query: 396 VSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLP 455
           VSPP+PGDESYE DQ ER +I + L  R+ KL + F  LEG+EC +PQGAMYL+PK   P
Sbjct: 366 VSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFP 425

Query: 456 YKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETW 515
            K I  AQ L  E D  YCK LLE+TGICTVPGSGFGQ P TYHLRTTFL PG  W++ W
Sbjct: 426 QKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLW 485

Query: 516 EKFHKAFFDKYR 527
            KFH  F ++YR
Sbjct: 486 RKFHTEFCERYR 497

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/483 (63%), Positives = 388/483 (80%), Gaps = 2/483 (0%)

Query: 46  APKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQ 105
           A +L  +D+N NV+KAKYAVRG IP  A++L+ QL K P +LPF  +I++NIGNPQQL Q
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140

Query: 106 KPLTFYREVLSLLQHPELLEEADEALQTL-YKTDSIKRAKRLLSEVGGSVGAYSQSQGVQ 164
           KPL+F R+VLS+L++P LL+     + ++ Y  DSI+RAK LL+++G S+GAYS SQGV 
Sbjct: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGVH 199

Query: 165 GIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYT 224
           GIR+TVADFIT RDDGE++YP+DI+LTAGAS+AVS ILSILCKG  TGVLIPIPQYPLYT
Sbjct: 200 GIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPLYT 259

Query: 225 ASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSE 284
           A+L LN++  LPYYL E   WSTD  EI +V  D+++ GIKPTCLVVINPGNPTG++L+ 
Sbjct: 260 ATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTV 319

Query: 285 QSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLH 344
           ++I+ +F+VAAKYG+VVIADEVYQ+N+F GS+F+SMKK+LR LQK    +YDNIQLASLH
Sbjct: 320 EAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASLH 379

Query: 345 STSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDE 404
           S SKG+ GECG RGGY E +GF  +++QV  KL+SISLC  V GQALVDLM  PP+ G+ 
Sbjct: 380 SCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGEP 439

Query: 405 SYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQH 464
           SYE DQ ER+ I     +R++KL+E F+ LEG+ C+KPQGAMY++P + LP+  I+ AQ+
Sbjct: 440 SYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQN 499

Query: 465 LEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFD 524
           L++ PDEFYC+ LL+ TGICTVPGSGFGQ PGTYH+RTTFL PG EW++ WEKFH  FF+
Sbjct: 500 LDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFFE 559

Query: 525 KYR 527
           KYR
Sbjct: 560 KYR 562

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/494 (62%), Positives = 387/494 (78%), Gaps = 8/494 (1%)

Query: 42  TVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQ 101
           T  PAPK SL+D+NE++LKA+YA+RG IP RAEEL  QL ++  SLPF+KI+ ANIGNPQ
Sbjct: 7   TFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQ 66

Query: 102 QLDQKPLTFYREVLSLLQHPELLEEADEAL-QTLYKTDSIKRAKRLLSEVGGSVGAYSQS 160
           QLDQ+PLTF R+V+SL+Q P+LL+  D  L Q +Y  DSI+RA +LL+ +GGSVGAYS S
Sbjct: 67  QLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126

Query: 161 QGVQGIRETVADFITKRD-------DGEISYPEDIYLTAGASAAVSYILSILCKGPNTGV 213
           QGV  IR+ VA FI KRD       D       +++LTAGAS AV +IL +  K  + GV
Sbjct: 127 QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186

Query: 214 LIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVIN 273
           L+PIPQYPLYTA++ L  S+ LPYYL E  NWSTDP++IEQ+V+DAI++ IKPT LVVIN
Sbjct: 187 LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246

Query: 274 PGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHG 333
           PGNPTGAIL++ SI  I ++AA+YGIV+IADEVYQENV++  +F+S KKVL  L+K Y  
Sbjct: 247 PGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306

Query: 334 QYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVD 393
           +YDN+QLASLHS SKGV+GECGQRGGYME+ GF++D+++V LK+ASIS+C VVTGQ LVD
Sbjct: 307 KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366

Query: 394 LMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLD 453
           LMV+PPQPGDESYE DQ ER  IH  L  +++ L++ F+RL GI C+KPQGAMYL+P+L 
Sbjct: 367 LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426

Query: 454 LPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVE 513
           L    I  A  L ++PDEFYC  LLENTGICTVPGSGFGQ PGTYHLRTTFLPPG EW+ 
Sbjct: 427 LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486

Query: 514 TWEKFHKAFFDKYR 527
           +WEKFH  F +KY+
Sbjct: 487 SWEKFHLEFMEKYK 500

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/488 (61%), Positives = 383/488 (78%), Gaps = 7/488 (1%)

Query: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104
           PA KLS++D+N++ + A YAVRG IPMRAE+L  Q+  DP SLPF KII+ANIGNPQQ+ 
Sbjct: 5   PAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQVG 64

Query: 105 QKPLTFYREVLSLLQHPELLEEADEALQTL-----YKTDSIKRAKRLLSEVGGSVGAYSQ 159
           QKPLTF R+VLS+L++P +L +  E L+ L     Y+ D I+RA+++L  +GGSVGAYS 
Sbjct: 65  QKPLTFIRQVLSILEYPNILNDP-ELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYSA 123

Query: 160 SQGVQGIRETVADFITKRDD-GEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIP 218
           SQGV G R+TVADFI KRD   +++ P DI+LT GAS+AV Y+LSILC GP  GVLIPIP
Sbjct: 124 SQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIP 183

Query: 219 QYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPT 278
           QYPLYTA+L L+NS  +PYYL+E  +WST+ +EIE  + +++  G+KP  +V+INPGNPT
Sbjct: 184 QYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPT 243

Query: 279 GAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNI 338
           GAILSE  +  I  ++AKYGI +IADEVYQEN+F G +F+SM+KVL NLQ  + G YDN+
Sbjct: 244 GAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNV 303

Query: 339 QLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSP 398
           QLASLHSTSKG  GECGQRGGYMEL+GF  ++  + LKLASIS+C VVTGQAL+DL+  P
Sbjct: 304 QLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCP 363

Query: 399 PQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKV 458
           PQPGD SY+ DQ+ER  I   L  RA +L+  F+ LEG+EC++PQGAMYL+PKL LP K 
Sbjct: 364 PQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDKA 423

Query: 459 IQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKF 518
           I++A  LE+ PDE+YC+ LL+ TGICTVPGSGFGQ PGTYHLRTTFL PGTEW+E W +F
Sbjct: 424 IEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWREF 483

Query: 519 HKAFFDKY 526
           H+ F++++
Sbjct: 484 HQQFYERF 491

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/493 (58%), Positives = 379/493 (76%), Gaps = 10/493 (2%)

Query: 45  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 104
           PAPK SL+D+++++L  +YA+RG IP RA+EL++QL   P+ LPF KII ANIGNPQQL+
Sbjct: 8   PAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQLE 67

Query: 105 QKPLTFYREVLSLLQHPELLEEADEALQT-LYKTDSIKRAKRLLSEVGGSVGAYSQSQGV 163
           Q+PLTF R+VLSL+++P L+   +  ++  +Y  D+IKRA+ +L+ +GGSVGAYS SQG+
Sbjct: 68  QEPLTFQRQVLSLVEYPNLVNSKNILVENKIYAPDAIKRAETILNSIGGSVGAYSSSQGI 127

Query: 164 QGIRETVADFITKRDDGEISYPE---------DIYLTAGASAAVSYILSILCKGPNTGVL 214
             IR+ VA  I +RD+ E+   +         +I+LT GA+ AVSYIL +  K  N GVL
Sbjct: 128 LSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENCGVL 187

Query: 215 IPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINP 274
           +PIPQYPLYTA++ L NS+ LPYYL E++NWSTDPEEIE ++ DAI + IKPT LV+INP
Sbjct: 188 LPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVIINP 247

Query: 275 GNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQ 334
           GNPTGAILS +SI +I  +AAKYGIV+IADEVYQ N+++  KF+S KK+L +L+  Y  +
Sbjct: 248 GNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQYPKK 307

Query: 335 YDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDL 394
           YDN+QLASLHS SKGV+GECGQRGGY EL+GF+ +I+++ LKLASI +C VVTGQ LVDL
Sbjct: 308 YDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQILVDL 367

Query: 395 MVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDL 454
           M  PP+ GD SY+ DQ+ER +I   L  +++ L++ FSRL GI C+KPQGAMYL+P+L L
Sbjct: 368 MSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFPRLHL 427

Query: 455 PYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVET 514
              +I EA+   +EPDEFYC  LLENTGICTVPGSGFGQ  GTYH+RTTFLP G EW++ 
Sbjct: 428 TSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIEWIKL 487

Query: 515 WEKFHKAFFDKYR 527
           WEKFH  F ++Y+
Sbjct: 488 WEKFHLEFMNQYK 500

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 83/161 (51%), Gaps = 29/161 (18%)

Query: 157 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAA---VSYILS-----ILCKG 208
           Y   QG   +R+ +A+  +  +D  +S  E++ LT GA AA     Y L+      +C  
Sbjct: 55  YGAIQGSHALRKLIAEMYSN-EDVTLS-EENVILTNGAIAANFLTHYTLAGKGDHFICIS 112

Query: 209 PNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPT- 267
           P    L  IPQ  ++ A + L        +LR+E N+  +  E+E++        IKP  
Sbjct: 113 PTYQQLSSIPQ--MFGAEVEL-------LHLRKETNYQPNIVELERM--------IKPNT 155

Query: 268 -CLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
            C+V+  P NP  +++  +++++I E+A K+GIVV  DEVY
Sbjct: 156 KCIVLNTPNNPLSSVIPTETLREIAELADKHGIVVFCDEVY 196

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 74/352 (21%), Positives = 145/352 (41%), Gaps = 44/352 (12%)

Query: 154 VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 212
           V  YS ++G   + +++ + + K   G+    +++ +T GA+  + S ++ IL  G    
Sbjct: 74  VNQYSPTRGRPSLIKSLVE-LYKPVFGDFIDNQNVLVTTGANEGILSCLMGILNAGDEVI 132

Query: 213 VLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI--KPTCLV 270
           V  P     +    L     R +P +  +E        +  Q+  DA++K    K   ++
Sbjct: 133 VFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALEKTFNNKTKAVI 192

Query: 271 VINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGS--KFYSMKKVLRNLQ 328
           +  P NP G + +EQ + K+ ++  ++  VVI+DEVY+   F  S  +  ++ + + NL 
Sbjct: 193 INTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYEHLYFTESFPRIANINEDIANLT 252

Query: 329 KTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTG 388
            T            + S  K  +   G R G+  ++  N  +   ++  A   +C     
Sbjct: 253 LT------------VGSAGKSFAA-TGWRIGW--IISKNDQLLN-YVSKAHTRIC----- 291

Query: 389 QALVDLMVSPPQPGDESYEQDQQE--REDIHDALDERASKLFE----TFSRLEGIECRKP 442
                   + P P  E+     +   + D    + E   K FE     F +L G+   +P
Sbjct: 292 -------FASPSPLQEACAGSIEHALKIDYFPKMREEYRKKFEILTTAFDKL-GLNYTQP 343

Query: 443 QGAMYL---YPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGF 491
           +G  ++   + K+ +P   +   + LE   D      L+   GI  +P + F
Sbjct: 344 EGTYFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTEF 395

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 77/171 (45%), Gaps = 16/171 (9%)

Query: 154 VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 212
           V  YS ++G   + E++    +   + E+   E++ +T GA+  + S ++ IL  G    
Sbjct: 84  VNQYSPTRGRVSLLESLIKLYSPLYNAELK-AENVTVTTGANEGILSCLMGILNPGDEVI 142

Query: 213 VLIP-----IPQYPLYTASLA---LNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI 264
           V  P     IP   L    +    +N  + +   + +   W+ D E+    + D      
Sbjct: 143 VFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTVDYEQFANAITD------ 196

Query: 265 KPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGS 315
           K   +++  P NP G + + + + +I E+  K  +V+I+DEVY+   F  S
Sbjct: 197 KTKAVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYEHLYFTDS 247

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/181 (23%), Positives = 88/181 (48%), Gaps = 8/181 (4%)

Query: 139 SIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV 198
           +IK A+R L E+   V  YS ++G   + +++  F T   + ++        T    A  
Sbjct: 63  AIKEAQRAL-EIP-LVNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVFTGANEAIF 120

Query: 199 SYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIE--QVV 256
           S ++ +L   P   V++  P +  Y  ++ L+  + +   +   +N  T   + E  Q+ 
Sbjct: 121 SILIGLL--NPGDEVIVFEPFFDQYIPNIELSGGKVVYVPITPPKNLDTRVTKGEEWQID 178

Query: 257 LDAIQKGI--KPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKG 314
            D++Q  +  K   +++  P NP G + +E  ++++ ++  K  +V+I+DEVY+   FK 
Sbjct: 179 WDSLQAAMNSKTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYFKD 238

Query: 315 S 315
           S
Sbjct: 239 S 239

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 37/168 (22%), Positives = 79/168 (47%), Gaps = 16/168 (9%)

Query: 154 VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 212
           V  YS ++G   + +++ D  +      +  PE++ +T GA+  + + ++ IL +     
Sbjct: 84  VNQYSPTRGRPTLIKSLTDLYSPLYKLTLK-PENVLVTTGANEGILACLMGILNQNDEVI 142

Query: 213 VLIP-----IPQYPLYTASLA---LNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI 264
           V  P     IP   L    +    +N  + L   + +   W+ D E+ E V+ +      
Sbjct: 143 VFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITN------ 196

Query: 265 KPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVF 312
           K   +++  P NP G + + + +++I ++  K+ +++I+DEVY    F
Sbjct: 197 KTKAIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYDNLYF 244

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 37/152 (24%), Positives = 70/152 (46%), Gaps = 9/152 (5%)

Query: 157 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIP 216
           Y   +G   +R  VA   +   D E+   +D  L    +   ++++S    GP   V+  
Sbjct: 55  YGAIKGSDELRSLVASLYS---DKEVKLDKDNVLITNGAIGANFLVSYTLAGPGDHVICV 111

Query: 217 IPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGN 276
            P Y   ++   +  +      L  E ++  D  +++ ++     KG    C+V+ NP N
Sbjct: 112 DPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMI-----KG-NTKCIVLNNPNN 165

Query: 277 PTGAILSEQSIQKIFEVAAKYGIVVIADEVYQ 308
           P G+++   ++++I  +A K  I VI DEVY+
Sbjct: 166 PLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 112/253 (44%), Gaps = 32/253 (12%)

Query: 157 YSQSQGVQGIRETVADFITKRDDGEISYPE-DIYLTAGASAAVSYILSILCKGPNTGVLI 215
           Y  SQG   + E V    +   D  I Y + D+  TAG + A    L + C   N G  I
Sbjct: 106 YGFSQGQPELMEFVRKHTSLVHD--IKYADWDVLATAGNTNAWESTLRVFC---NRGDTI 160

Query: 216 PIPQYP----LYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVV 271
               Y     LY A     N  P+P        +   PE++E ++ +   +  KP  L  
Sbjct: 161 LAEAYSFSSSLYAAEAQGVNVFPVPL-----DEFGIIPEKLESIMDNWNPETPKPKLLYT 215

Query: 272 INPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY----------QENVFKGSKFYSM 320
           I  G NPTG+ LS+    KI+ +A K+  ++I DE Y            +  +   + S 
Sbjct: 216 IPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIEDEPYYFLQMEPYVKDASAREKKTYSSH 275

Query: 321 KKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASI 380
            + +++L K++     + ++  L S SK ++   G R G+  +VG +  I + +L+L  +
Sbjct: 276 DEFIQSLAKSFISLDTDGRVVRLDSFSKVLA--PGTRLGW--IVG-SKKILEPYLRLHEM 330

Query: 381 SL-CPVVTGQALV 392
           ++  P    Q+LV
Sbjct: 331 TIQAPSGFTQSLV 343

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 75/171 (43%), Gaps = 16/171 (9%)

Query: 154 VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 212
           V  YS ++G   +  ++ D  T   + E+   E++ +T GA+  + S ++ +L  G    
Sbjct: 85  VNQYSPTRGRPSLINSLIDLYTPIYNKELK-AENVVVTTGANEGILSCLMGLLNSGDEVI 143

Query: 213 VLIP-----IPQYPLYTASLA---LNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI 264
           V  P     IP   L    +    +N  + L       + W+ D E+ E+ +        
Sbjct: 144 VFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITS------ 197

Query: 265 KPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGS 315
           K   +++  P NP G + +   +  +  +  K+ +V+I+DEVY+   F  S
Sbjct: 198 KTKAVIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVYEHLYFTDS 248

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 78/169 (46%), Gaps = 17/169 (10%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSR--PLPYYLREEQ 243
           +++ L  G+  ++  ++   C      +LI    Y +YT    +N+     +P  L EE 
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEED 147

Query: 244 NWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIA 303
            +  D E+I    L+ +Q       + + +PGNPTG  +    I+KI     + G+VV+ 
Sbjct: 148 KFQIDEEKI----LETLQNDPSIKLVFITSPGNPTGTFIDVNRIEKILS-QWQTGLVVV- 201

Query: 304 DEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSG 352
           DE Y + V +GS   S+  +          +Y+NI +    S S G++G
Sbjct: 202 DEAYIDFV-EGSDKGSLAPL--------ATKYENIAVLQTLSKSFGLAG 241

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 87/180 (48%), Gaps = 15/180 (8%)

Query: 140 IKRAKRLLSEVGGSVG-AYSQSQGVQGIRETVADFITKRDD----GEISYPEDIYLTAGA 194
           I   KR   E+  S+   YS++QG++ + + +  FITK ++     E  Y  DI L  G+
Sbjct: 119 IHVTKRFPQELPLSMSLQYSETQGMKPLLDFIKTFITKLNNTPPYNETLY--DIMLANGS 176

Query: 195 SAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLR-EEQNWSTDPEEIE 253
           S ++  +   LC    T ++      P+ +  +A   ++ +P  L    ++   D E +E
Sbjct: 177 SDSMFKVFETLCDESTTVLMEEFTFVPVISNVMA-TGAKCIPLKLNLNYEDQGIDIEYLE 235

Query: 254 QVVLDAIQKG-----IKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
            ++ +   K       KP  L  I+ G NP G  LS +  +KI+ +A ++ ++++ D+ Y
Sbjct: 236 NLLDNWGGKSNTKHLSKPKILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 75/357 (21%), Positives = 146/357 (40%), Gaps = 54/357 (15%)

Query: 154 VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 212
           V  YS ++G   +  ++ D  +     +++ PE++ +T GA+  + S ++ I+  G    
Sbjct: 85  VNQYSPTRGRPRLINSLIDLYSPFYKKQLT-PENVLVTTGANEGILSCLMGIINPGDEVI 143

Query: 213 VLIP-----IPQYPLYTASLA---LNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI 264
           V  P     IP   L    +    +N  + L   + +   W+ D         D   + I
Sbjct: 144 VFEPFFDQYIPNIELCGGKVVYVPINPPKELDNRVTKGTEWTVD--------FDEFTRAI 195

Query: 265 KP-TCLVVIN-PGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKK 322
            P T  V+IN P NP G + + + + K+  +  +  +++IADEVY E+++   +F  +  
Sbjct: 196 TPKTKAVIINTPHNPIGKVFTREELTKLGNICVENNVIIIADEVY-EHLYFVDEFPRIAT 254

Query: 323 VLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISL 382
           +   +     GQ       S+ S  K  +   G R G+  +V  N D+ Q          
Sbjct: 255 LSEEI-----GQLT----LSVGSAGKSFAA-TGWRIGW--VVSQNPDLLQ---------- 292

Query: 383 CPVVTGQALVDLMVSPPQPGDE--SYEQDQQEREDIHDALDERASKLFETFSRLE---GI 437
                 +A   +  + P P  E  SY  D   + D  + + +   K F+ F+ +    G+
Sbjct: 293 ---YASKAHTRICFASPSPIQEACSYSIDHALKIDYFENMRQEYVKKFKIFTSVFDELGL 349

Query: 438 ECRKPQGAMYL---YPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGF 491
               P+G+ ++   + K+ +P       + +    D      L+   G+  +P + F
Sbjct: 350 PYTIPEGSYFVLADFSKVKIPDSYQFPEEIMSKGKDFRISNWLINELGVVAIPPTEF 406

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 75/165 (45%), Gaps = 16/165 (9%)

Query: 157 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTGVLI 215
           YS ++G   + + +AD  T     ++S  ++I +  GA+ A+ S ++ +L KG    V  
Sbjct: 77  YSPTRGRPNLIKALADLYTPLYGQQLS-ADNITVHTGANEAIFSCLMGLLNKGDEVIVFE 135

Query: 216 PIPQYPLYTASLA--------LNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPT 267
           P     +    LA        +N  R L   +     W  D + +E+ +        +  
Sbjct: 136 PFFDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEWEIDWDILEKTI------NSRTK 189

Query: 268 CLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVF 312
           C+++  P NP G + + + + ++ ++     IV+I+DEVY+   F
Sbjct: 190 CVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYEHLYF 234

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 62/122 (50%), Gaps = 5/122 (4%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           D+  T G + A    L + C   + G +I + +   +++ LA   ++ +  +        
Sbjct: 132 DVVATTGNTNAWESTLRVFC---DKGDVI-LAEAHSFSSCLAAAQAQGIITFPIPIDEHG 187

Query: 247 TDPEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADE 305
             PE++EQ++ +  +   KP  L  I  G NPTG+ LS+   +KI++VA K+  ++I DE
Sbjct: 188 IIPEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDE 247

Query: 306 VY 307
            Y
Sbjct: 248 PY 249

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 65/139 (46%), Gaps = 15/139 (10%)

Query: 186 EDIYLTAGASAAV-SYILSILCKGPNTGVLIP-----IPQYPLYTASLA---LNNSRPLP 236
           E++ +T GA+  + S ++ IL  G    V  P     IP   L    +    +N  + + 
Sbjct: 123 ENVTITTGANEGILSSLMGILNPGDEVIVFEPFFDQYIPNIELLGGKVVYVPINPPKDMD 182

Query: 237 YYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAK 296
             + E ++W+ D EE+ +          K   L++  P NP G + +++ + KI  +  +
Sbjct: 183 QRIVEGKDWTIDYEELAKAFTS------KTKALILNTPHNPIGKVFTKEELTKIGNLCVE 236

Query: 297 YGIVVIADEVYQENVFKGS 315
             +V+I+DEVY+   F  S
Sbjct: 237 NNVVIISDEVYEFLYFTDS 255

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 77/325 (23%), Positives = 143/325 (44%), Gaps = 37/325 (11%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALN----NSRPLPYYLREE 242
           D+  T G + A   +L I C   N G  I   Q+   ++  A      N  P+P  L E 
Sbjct: 134 DVLATIGNTGAWESVLRIFC---NRGDTILAEQFAFSSSISAAEAQGVNVFPIP--LDEH 188

Query: 243 QNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVV 301
                 P ++E ++ +  +   KP  L  +  G NPTG+ LS    ++I+ +A K+  ++
Sbjct: 189 ---GIIPSKLETILDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFII 245

Query: 302 IADEVY---------QENVFKGSKFYS-MKKVLRNLQKTYHGQYDNIQLASLHSTSKGVS 351
           I DE Y         ++   +  K Y+  K+ ++NL+K++       ++  L S SK ++
Sbjct: 246 IEDEPYYFLQMEKYEKDPANRVVKSYADHKEFIQNLEKSFVSIDTEGRVLRLDSLSKVLA 305

Query: 352 GECGQRGGYMELVGFNHDIRQVFLKLASISL-CPVVTGQALVDLMVSPPQPGDESY-EQD 409
              G R G+  +VG   DI    L L  +++  P    Q+++   ++  + G E Y +  
Sbjct: 306 --PGTRFGW--IVG-AKDILARILSLQEMTIQAPAGFTQSIIAGTMN--RWGQEGYLDWL 358

Query: 410 QQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEP 469
              R +     D     L++   +++ I+   P   M+    +D   K  + A     +P
Sbjct: 359 IGLRHEYTKKRDCCIDALYKYLPQVDYIKINPPIAGMFFTVNIDAS-KHPEFATKYGSDP 417

Query: 470 DEFYCKALLEN---TGICTVPGSGF 491
           ++   KA+ +    +G+  VPG+ F
Sbjct: 418 EKVE-KAIFDRSIASGVLVVPGNWF 441

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 66/142 (46%), Gaps = 21/142 (14%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTG--VLIPIPQYPLYTASLAL----------NNSR 233
           E+I +T GA+     ILS L    N G  V++  P +  Y +++ L          N  +
Sbjct: 120 ENITITTGANEG---ILSCLMGLLNAGDEVIVFEPFFDQYISNIELMGGKVVYVPINPPK 176

Query: 234 PLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEV 293
            L   + E   W+ D E+    +        K   ++V +P NP G + +++ + K+ E+
Sbjct: 177 DLDQRITEGTEWTIDFEQFRNAITP------KTKAVIVNSPHNPIGKVFTKEELTKLGEI 230

Query: 294 AAKYGIVVIADEVYQENVFKGS 315
             +  +++I+DEVY+   F  S
Sbjct: 231 CVENNVIIISDEVYEFLYFNDS 252

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 76/169 (44%), Gaps = 17/169 (10%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 244
           +++ L  G+   +  ++   C+     +L   P Y +Y+    +N+   +   L  E N 
Sbjct: 85  DNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVEIVECPLITEDNS 144

Query: 245 -WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIA 303
                PE     VL  ++   K   L + +PGNPTG +++++ I+ I E     G+VV+ 
Sbjct: 145 FQMNVPE-----VLSTLKNDPKIKLLFITSPGNPTGKLVNKKDIEFILENWTN-GLVVV- 197

Query: 304 DEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSG 352
           DE Y +        YSM K++         +Y N+ +    S S G++G
Sbjct: 198 DEAYIDFADAEGTTYSMAKLVT--------KYPNLTVLQTLSKSFGLAG 238

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 75/171 (43%), Gaps = 16/171 (9%)

Query: 154 VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 212
           V  YS ++G   +  ++    +   D ++   E++ +T GA+  + S ++ +L  G    
Sbjct: 101 VNQYSPTRGRPSLINSLIKLYSPIYDTDLR-AENVTVTTGANEGILSCLMGLLNSGDEVI 159

Query: 213 VLIP-----IPQYPLYTASLA---LNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI 264
           V  P     IP   L    +    +N  + L     + + W+ D E+ E  +        
Sbjct: 160 VFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTKGEEWTIDFEQFENAITS------ 213

Query: 265 KPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGS 315
           K   +++  P NP G + + + +  +  +  K+ +V+I+DEVY+   F  S
Sbjct: 214 KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLFFTDS 264

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 70/153 (45%), Gaps = 13/153 (8%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 244
           E++ L  G+   +  ++   C      +LI  P Y +Y+    +N+   +   L  E N 
Sbjct: 88  ENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVEDNS 147

Query: 245 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 304
           +  D E+    V++ +Q       + + +PGNPTGA++  ++I+K+     + G VV+ D
Sbjct: 148 FQMDTEK----VIETLQNDPSIKLVFITSPGNPTGALIKPENIEKLLS-QWQSGFVVV-D 201

Query: 305 EVYQENVFKGSKF------YSMKKVLRNLQKTY 331
           E Y +    G         Y    VL+ L K++
Sbjct: 202 EAYIDFCTTGGSVAPLVNKYPNLAVLQTLSKSF 234

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 60/127 (47%), Gaps = 8/127 (6%)

Query: 182 ISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLRE 241
           ISY ++I L  G+   V  ++   C      VL+  P Y +Y+    +N++  +   L  
Sbjct: 85  ISY-KNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLIT 143

Query: 242 EQN-WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIV 300
           E N +  D +     VL+ +        L +  PGNPTGA +S Q I+ +    +  GIV
Sbjct: 144 EDNSFDMDLDN----VLETLSNDDSIKLLFITTPGNPTGASISTQKIEMLLNNWSA-GIV 198

Query: 301 VIADEVY 307
           V+ DE Y
Sbjct: 199 VV-DEAY 204

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 7/122 (5%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN-W 245
           +I L  G+  ++  I+   C      +L+  P Y +Y+    +N+   +   L  E N +
Sbjct: 89  NICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITEDNSF 148

Query: 246 STDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADE 305
             D ++    VLD +    +   L + +PGNPTGA +    I+K+ +   + G+VV+ DE
Sbjct: 149 QMDSDK----VLDILNNDQEIKLLFITSPGNPTGAQIETARIEKVLQNWDR-GLVVV-DE 202

Query: 306 VY 307
            Y
Sbjct: 203 AY 204

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 66/144 (45%), Gaps = 13/144 (9%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           D+  TAG + A    L + C   N G +I + +   +++ LA   ++ +  +     +  
Sbjct: 133 DVVATAGNTNAWESTLRVFC---NRGDVI-LAEAHSFSSCLAAAQAQGITTFPVPIDDKG 188

Query: 247 TDPEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADE 305
             P ++E ++ +      KP  L  I  G NPTG  L+++   +IF +A K+  ++I D 
Sbjct: 189 IIPAKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDA 248

Query: 306 VYQENVFKGSKFYSMKKVLRNLQK 329
            Y         F  M K  R+LQK
Sbjct: 249 PYY--------FLQMDKYERDLQK 264

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 60/122 (49%), Gaps = 5/122 (4%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           DI LT G +      L + C   N G +I + +   +++SLA   ++ +  +        
Sbjct: 132 DIILTTGNTNGWESTLRVFC---NKGDVI-LAEAHSFSSSLASAEAQGITTFPIPIDEHG 187

Query: 247 TDPEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADE 305
             PE++E+++ +      KP  L  I  G NPTG  L+++   +I+ +A K+  ++I DE
Sbjct: 188 IIPEKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLIIEDE 247

Query: 306 VY 307
            Y
Sbjct: 248 PY 249

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 75/171 (43%), Gaps = 16/171 (9%)

Query: 154 VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 212
           V  YS ++G   +  ++    +   + E+   E++ +T GA+  + S ++ +L  G    
Sbjct: 85  VNQYSPTRGRPSLINSLIKLYSPIYNTELK-AENVTVTTGANEGILSCLMGLLNAGDEVI 143

Query: 213 VLIP-----IPQYPLYTASLA---LNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI 264
           V  P     IP   L    +    +N  + L       + W+ D E+ E+ +        
Sbjct: 144 VFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITS------ 197

Query: 265 KPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGS 315
           K   +++  P NP G + + + +  +  +  K+ +V+I+DEVY+   F  S
Sbjct: 198 KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDS 248

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 78/188 (41%), Gaps = 42/188 (22%)

Query: 157 YSQSQGVQGIRETVADFITK------RDDGEISYPEDIYLTAGASAAVSYIL---SILCK 207
           Y   +G   +RE +  F         RDD   S PE + L++GAS  V  IL   ++   
Sbjct: 51  YGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGVLSILLQATLAHT 110

Query: 208 GPNTGVLIPIPQYPLY----------------------TASLALNNSRPLPYYLREEQNW 245
           G      I  P Y L                       +  LAL     L   L+E ++ 
Sbjct: 111 GYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLAL-----LERKLQEFEDK 165

Query: 246 STDPEEIE--QVVLD---AIQKGIKPTCLVVI-NPGNPTGAILSEQSIQKIFEVAAKYGI 299
            T+ E+ E  Q + D   A+ K I    +  I    NPTG   S ++  K+ E+A KY +
Sbjct: 166 FTEEEDQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDM 225

Query: 300 VVIADEVY 307
           ++IAD+VY
Sbjct: 226 LIIADDVY 233

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 65/129 (50%), Gaps = 6/129 (4%)

Query: 181 EISYPE-DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYL 239
           E +Y + D  LT G +      L I C   N G +I + +   +++SLA   ++ +  + 
Sbjct: 125 EFNYSDWDSILTTGNTNGWESTLRIFC---NKGDVI-LAEAHSFSSSLASAEAQGVITFP 180

Query: 240 REEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYG 298
               +    PE++E ++ +      KP  L  I  G NPTG+ LS++  + I+++A K+ 
Sbjct: 181 VPIDSDGIIPEKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHD 240

Query: 299 IVVIADEVY 307
            ++I DE Y
Sbjct: 241 FIIIEDEPY 249

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 67/144 (46%), Gaps = 25/144 (17%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTG--VLIPIPQYPLYTASLALNNSR--------PL 235
           E++ +T GA+     ILS L    N G  V++  P +  Y +++ L   +        P 
Sbjct: 116 ENVTVTTGANEG---ILSCLMGLLNAGDEVIVFEPFFDQYISNIELCGGKVVYVPINPPK 172

Query: 236 PYYLREE--QNWSTDPEEIEQVVLDAIQKGIKP-TCLVVIN-PGNPTGAILSEQSIQKIF 291
              LR    + W+ D E+ E        K I P T  V+IN P NP G + + + +  + 
Sbjct: 173 ELDLRNTRGEEWTIDFEQFE--------KAITPKTKAVIINTPHNPIGKVFTREELTTLG 224

Query: 292 EVAAKYGIVVIADEVYQENVFKGS 315
            +  K+ +++I+DEVY+   F  S
Sbjct: 225 NICVKHNVIIISDEVYEHLYFTDS 248

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/155 (26%), Positives = 68/155 (43%), Gaps = 17/155 (10%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 244
           +++ L  G+  ++  ++   C      +LI  P Y +Y+    +N+   +   L  E N 
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDNS 147

Query: 245 --WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVI 302
              +TD       V++ +Q         V +PGNPTGA++   SI+KI     + GIV I
Sbjct: 148 FQMNTDK------VIETLQGDSNIKIAFVTSPGNPTGALIDIASIEKILS-QWQSGIVAI 200

Query: 303 ADEVYQENVFKGSKF------YSMKKVLRNLQKTY 331
            DE Y +    G         Y    VL+ L K++
Sbjct: 201 -DEAYIDFCSTGGSAAPLVNKYPNLAVLQTLSKSF 234

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 67/138 (48%), Gaps = 21/138 (15%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTG--VLIPIPQYPLYTASLALNNSRP--LPYYLREE 242
           ++ +T GA+     ILS L    N G  V++  P +  Y +++ +   +   +P +  +E
Sbjct: 116 NVQVTTGANEG---ILSCLVGLLNPGDEVIVFEPFFDQYISNIQIPGGKVTYVPMHPPKE 172

Query: 243 QN--------WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVA 294
            N        W+ + +E+E  +        K   L++  P NP G + + + + +I E+ 
Sbjct: 173 MNVRNTKGTEWTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEIC 226

Query: 295 AKYGIVVIADEVYQENVF 312
            K+ +V+I+DEVY+   F
Sbjct: 227 VKHNVVIISDEVYEHLYF 244

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 75/361 (20%), Positives = 140/361 (38%), Gaps = 63/361 (17%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNS-------RP---L 235
           E++ +T GA+  +   L+ L   P   V++  P +  Y  ++ L          RP   L
Sbjct: 130 ENVQVTTGANEGIFACLAGLVN-PGDEVIVFEPFFDQYIPNIELLGGVVRYVPIRPPAEL 188

Query: 236 PYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAA 295
              + E   W  D + + Q + +      K   +++ +P NP G + + + + K+  +  
Sbjct: 189 SKRVTEGTEWVIDYDMLRQTINE------KTKAVIINSPHNPIGKVFTREELLKLGNICV 242

Query: 296 KYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECG 355
           + GI +I+DEVY E+++   +F  +  +   +              S H+ + G +G+  
Sbjct: 243 EKGIYIISDEVY-EHLYFTDEFTRIATLSEEI--------------SQHTLTVGSAGKSF 287

Query: 356 QRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQERED 415
              G+   +G+     +  L LAS         +A V +  S P P  E+     +    
Sbjct: 288 AATGWR--IGWVISRNKELLALAS---------KAHVRICFSSPAPLQEACAVAIEHALK 336

Query: 416 IHDALDERAS--KLFETFSRLE---GIECRKPQGAMYL---YPKLDLPYKVIQEAQHLEM 467
                D RA+  K +E F +     G+   + +G+ +L   + +L LP       +  + 
Sbjct: 337 TTYYADTRAAYQKKYERFQKPFDDLGLPYTRAEGSYFLLVDFSRLPLPADYHFPEELADK 396

Query: 468 EPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYR 527
             D      L+   G+  +P S F            F+P   E  E   +F     D Y 
Sbjct: 397 GRDFRVAYWLINELGLVAIPCSSF------------FIPDHREASENMLRFAICKDDTYL 444

Query: 528 D 528
           D
Sbjct: 445 D 445

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 63/139 (45%), Gaps = 21/139 (15%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTG--VLIPIPQYPLYTASLAL----------NNSR 233
           E++ +T GA+     ILS L    N G  V++  P +  Y +++ L          N  +
Sbjct: 117 ENVTITTGANEG---ILSCLMGLLNAGDEVIVFEPFFDQYISNIELMGGKIVYVPINPPK 173

Query: 234 PLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEV 293
            L   + E   W+ D E+ +  +        K   +++  P NP G + + + + +I  +
Sbjct: 174 ELDQRVTEGTEWTVDMEQFKNAITS------KTKAVIINTPHNPIGKVFTREELLQIGNI 227

Query: 294 AAKYGIVVIADEVYQENVF 312
             +  +++I+DEVY+   F
Sbjct: 228 CVEKNVIIISDEVYEHLYF 246

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 62/125 (49%), Gaps = 8/125 (6%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           DI  T G++ A    L I C   N G  + + ++  Y++S+   +++ L        N  
Sbjct: 133 DIITTTGSTQAWDASLRIFC---NKGDTVLLEEF-TYSSSVEAADAQGLNCIPVPMDNQG 188

Query: 247 TDPEEIEQVVLDAIQK--GI-KPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVI 302
             PE++E+++ +   +  GI  P  L  I  G NPTG  LSE     I+ +A KY I+++
Sbjct: 189 IIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIV 248

Query: 303 ADEVY 307
            D+ Y
Sbjct: 249 EDDPY 253

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 76/183 (41%), Gaps = 33/183 (18%)

Query: 157 YSQSQGVQGIRETVADFITKR-----DDGEISYPEDIYLTAGASAAVSYILSILCKGPNT 211
           Y    G   +R  +A+F  +           + PE + LT+GAS  +  IL +    P+T
Sbjct: 48  YGSDNGSAWVRACIAEFSNRAFKLPVSSNAATRPEHLNLTSGASYGIMNIL-LQTTLPHT 106

Query: 212 G----VLIPIPQYPL---------YTASLALNNSRP-------LPYYLREEQNWST---- 247
           G      I  P Y L         +T  +     +        L   L+  +N S     
Sbjct: 107 GYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKSCENSSNGESG 166

Query: 248 -DPEEIEQVV--LDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 304
              EE  +++   D  +K  +    +V    NPTGAI S  S  K+ E+A KY I++I+D
Sbjct: 167 QKAEESLRIINAQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 226

Query: 305 EVY 307
           +VY
Sbjct: 227 DVY 229

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 70/351 (19%), Positives = 145/351 (41%), Gaps = 61/351 (17%)

Query: 157 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIP 216
           YS ++G   + +++ DF +   +  ++   ++ +T GA+  +   L  L   P   V++ 
Sbjct: 88  YSPTRGRPSLLKSLTDFYSPIYNETLN-ESNVTITTGANEGILASLVGLLN-PGDEVIVF 145

Query: 217 IPQYPLYTASLAL--NNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI--KPTCLVVI 272
            P +  Y +++ +     R +P    +E +         ++  D + K I  +  C+++ 
Sbjct: 146 EPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTINERTKCIILN 205

Query: 273 NPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYH 332
            P NP G + + + + ++ ++  K  I +I+DEVY E+++ G +F  +  + + +     
Sbjct: 206 TPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYFGDEFTRIATISKEI----- 259

Query: 333 GQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALV 392
               ++ L S+ S  K  +   G R G++  V  N ++      L+ +S       +A  
Sbjct: 260 ---GDLTL-SVGSAGKSFAA-TGWRIGWV--VSRNAEL------LSYVS-------KAHT 299

Query: 393 DLMVSPPQPGDESYEQD------QQEREDIHDALDERASKLFETFSRLEGIECRKPQGAM 446
            +  S P P  E+              E++ +   E+ + L   F  L G+   KP G  
Sbjct: 300 RICFSSPSPFQEACAHSIDIGLHNGYFENMREEYKEKFAILTRVFDEL-GLPYTKPDGTY 358

Query: 447 YL------------YP----------KLDLPYKVIQEAQHLEMEPDEFYCK 475
           ++            YP             L Y ++ E   + + P EFY K
Sbjct: 359 FVCVDFSKVQIPDEYPFPRELNERAKDFKLSYWLVNELGVVAIPPTEFYIK 409

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 61/122 (50%), Gaps = 5/122 (4%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           D+  T G + A    L + C   N G +I + +   +++SLA   ++ +  +        
Sbjct: 132 DVVATTGNTNAWESTLRVFC---NRGDVI-LAEAHSFSSSLASAEAQGIITFPVPIDAHG 187

Query: 247 TDPEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADE 305
             PE++E ++ +  +   KP  L  I  G NPTG+ L+ +  ++I+ +A K+  ++I DE
Sbjct: 188 IIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDE 247

Query: 306 VY 307
            Y
Sbjct: 248 PY 249

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 59/123 (47%), Gaps = 7/123 (5%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 244
           E++ L  G+  ++  I+   C      ++   P Y +Y+   ++N+   +   L    N 
Sbjct: 85  ENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKCPLVTSDNS 144

Query: 245 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 304
           +  D E     VLD ++K      + + +PGNPTGA +    I+KI +   + GI+V+ D
Sbjct: 145 FQVDTE----AVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQNWDQ-GILVV-D 198

Query: 305 EVY 307
           E Y
Sbjct: 199 EAY 201

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 52/183 (28%), Positives = 76/183 (41%), Gaps = 33/183 (18%)

Query: 157 YSQSQGVQGIRETVADFITKR-----DDGEISYPEDIYLTAGASAAVSYILSILCKGPNT 211
           Y    G   +R  +A+F  K           + P+ + LT+GAS  +  IL +    P+T
Sbjct: 49  YGSDNGSAWVRACIAEFSNKVFKLPVHSSAATRPDHLNLTSGASYGIMNIL-VQTTLPHT 107

Query: 212 G----VLIPIPQYPLY-------------TASLALNNSRPLPYYLRE----EQNWSTDPE 250
           G      I  P Y L              TA     +   L +   +    E + + + E
Sbjct: 108 GYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKLFENSANGERE 167

Query: 251 EIEQVVLDAI--QKGIKPTCLVVI----NPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 304
           +  +  LD I  Q G K     VI       NPTGAI S  S  K+ E+A KY I++I+D
Sbjct: 168 QKTEESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 227

Query: 305 EVY 307
           +VY
Sbjct: 228 DVY 230

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 98/222 (44%), Gaps = 29/222 (13%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQY----PLYTASLALNNSRPLPYYLREE 242
           ++  T G + +    L I C   N G  I   QY     +Y A     N  P+P      
Sbjct: 135 NVLATTGNTGSWESTLRIFC---NRGDTILAEQYTFSSSVYAAEAQGINVFPVPLDAD-- 189

Query: 243 QNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVV 301
                 PE +E ++ +      KP  L  I  G NPTG+ LS+    +I+ +A K+ +++
Sbjct: 190 ---GLIPERLEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLI 246

Query: 302 IADE--------VYQENVF--KGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVS 351
           I DE         YQ++V   K + F S +  + +L K++       ++  L S SK + 
Sbjct: 247 IEDEPYYFLQMDAYQKDVSQRKETHFASQEDFVNSLAKSFISLDTEGRVLRLDSFSKVLG 306

Query: 352 GECGQRGGYMELVGFNHDIRQVFLKLASISL-CPVVTGQALV 392
              G R G+  +VG +  I Q + +L  +++  P    QA+V
Sbjct: 307 --PGTRLGW--IVG-SKKILQKYTQLHEMTIQNPSGFSQAIV 343

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 69/149 (46%), Gaps = 13/149 (8%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           D+  TAG + A    L + C   N G +I +  +  +++SLA   ++ +  +        
Sbjct: 134 DVLATAGNTNAWESTLRVFC---NRGDVILVEAHS-FSSSLASAEAQGVITFPVPIDADG 189

Query: 247 TDPEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADE 305
             PE++ +V+ +      KP  L  I  G NPTG  +++   + I+++A KY  +++ DE
Sbjct: 190 IIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDE 249

Query: 306 VYQENVFKGSKFYSMKKVLRNLQKTYHGQ 334
            Y         F  M   +++L++    Q
Sbjct: 250 PYY--------FLQMNPYIKDLKEREKAQ 270

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 57/123 (46%), Gaps = 7/123 (5%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 244
           E+I L  G+  ++  ++ + C      ++I  P Y +Y+    +N+   +   L  E N 
Sbjct: 88  ENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAEDNS 147

Query: 245 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 304
           +  D  +    VL+ + +      + + +PGNPT A++    I+K+       G +V+ D
Sbjct: 148 FQMDTSK----VLETLAQDPTIKLIFITSPGNPTAALIDTAEIEKVLNNWT--GGLVVVD 201

Query: 305 EVY 307
           E Y
Sbjct: 202 EAY 204

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 80/175 (45%), Gaps = 23/175 (13%)

Query: 167 RETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTAS 226
           R T + F   RD   ++  E++ L  G+  ++  I+   C      +L+  P Y +Y+  
Sbjct: 71  RNTTSAF-KDRDLATLT-NENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVC 128

Query: 227 LALNNSR----PLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282
             +N+      PL Y   E+ ++  + ++    VLD ++       + + +PGNPTG  +
Sbjct: 129 ANINDIEVVECPLIY---EDNSFQLNSDK----VLDILKNDPLIKLVFITSPGNPTGVKI 181

Query: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKF------YSMKKVLRNLQKTY 331
             + I+K+ +     G+VV+ DE Y +  F G         Y    VL+ L K++
Sbjct: 182 ETKRIEKVLQ-NWDNGLVVV-DEAYID--FCGGSLAPLVTQYQNLIVLQTLSKSF 232

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/177 (23%), Positives = 85/177 (48%), Gaps = 27/177 (15%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNN----SRPLPYYLRE 241
           +++ L  G+   +  ++   CK     +++  P Y +Y+    +N+    + PL   + E
Sbjct: 85  KNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPL---IVE 141

Query: 242 EQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVV 301
           + ++  D +      L+ ++K      L + +PGNPTG I++ + I  + E   K G+VV
Sbjct: 142 DNSFQMDVKR----TLETLKKDDLIRLLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVV 196

Query: 302 IADEVYQE--NVF----KGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSG 352
           + DE Y +    F    K ++++S+ K++         +Y N+ +    S S G++G
Sbjct: 197 V-DEAYVDFSTYFNEETKKTEYFSVAKLV--------TKYPNLTVLQTLSKSFGLAG 244

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 59/122 (48%), Gaps = 5/122 (4%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           DI  TAG + A    L + C   N G +I + +   +++ LA   ++ +  +     +  
Sbjct: 133 DIIATAGNTNAWESTLRVFC---NRGDVI-LAEAHSFSSCLAAAQAQGITTFPIPIDDNG 188

Query: 247 TDPEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADE 305
             PE++E+++ +      KP  L  I  G NPTG  L    +++I+ +A K+  +++ D 
Sbjct: 189 IIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVEDA 248

Query: 306 VY 307
            Y
Sbjct: 249 PY 250

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 80/190 (42%), Gaps = 41/190 (21%)

Query: 156 AYSQSQGVQGIRETVADFITK------RDDGEISYPEDIYLTAGASAAVSYILSILCKG- 208
            Y  ++G   +R  + +F+ +      RDD   S PE + LT+GAS  V   L+IL +  
Sbjct: 50  TYGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGV---LNILLQAT 106

Query: 209 -PNTGV----LIPIPQYPLYT------------ASLALNNSRPLPYYLRE---EQNWSTD 248
            P+TGV     I  P Y L               ++       +   L E   +   S D
Sbjct: 107 LPHTGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESID 166

Query: 249 PEEIEQ-----------VVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKY 297
           P  + +           + +  ++K  K    V+    NP+G   + ++  K+ E+A KY
Sbjct: 167 PNPVNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKY 226

Query: 298 GIVVIADEVY 307
            +++I D+VY
Sbjct: 227 DMLIITDDVY 236

>KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {ON}
           Anc_8.204 YER152C
          Length = 443

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 71/181 (39%), Gaps = 30/181 (16%)

Query: 156 AYSQSQGVQGIRETVADFITKR------DDGEISYPEDIYLTAGASAAVSYILSILCKGP 209
            Y  ++G   +R T+  F  +       + G  S PE + LT+GAS  V  IL + C  P
Sbjct: 52  TYGSNEGAHWVRSTICKFNNEEIFKFGENYGARSAPECLNLTSGASYGVLNIL-LQCTLP 110

Query: 210 NTG----VLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVV--LDAIQKG 263
           +        I  P Y L                + E    S D + +E  +  LD+I+  
Sbjct: 111 HNNYTRQAFIISPTYFLINDCFIDAGFHGKLTAINEMGTDSIDFDTLESNLAELDSIKAD 170

Query: 264 IKPTCLV-----------------VINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEV 306
           +   C+                  V    NP+G   S  +  ++ E+A KY I++I D+V
Sbjct: 171 VGTQCITKNENSKGKKIYRYVLYCVPTYSNPSGHTYSLTTKLRLLELARKYDILIITDDV 230

Query: 307 Y 307
           Y
Sbjct: 231 Y 231

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/151 (21%), Positives = 74/151 (49%), Gaps = 9/151 (5%)

Query: 157 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIP 216
           Y    G   +R+ VA  I   D+ +++  +++ +T GA  A ++++     GP   ++  
Sbjct: 55  YGSIWGTPVLRDLVAK-IHSSDEIQLT-ADNVLITNGAIGA-NFLVHYTAAGPGDHIICV 111

Query: 217 IPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGN 276
            P Y   ++  ++  +     +L  E  ++ + ++++  V    +       +V+ NP N
Sbjct: 112 DPTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQKLKSKVRANTKY------IVLNNPNN 165

Query: 277 PTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
           P G+++S + + +I + A +  I ++ DEVY
Sbjct: 166 PLGSVISTEKMTEIIDYAERNEIFIVCDEVY 196

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 68/327 (20%), Positives = 137/327 (41%), Gaps = 55/327 (16%)

Query: 185 PEDIYLTAGASAAVSYILSILCKGPNTG--VLIPIPQYPLYTASLA----------LNNS 232
           P ++ +T GA+ A   ILS L    N G  V++  P +  Y +++           L+  
Sbjct: 118 PSNVQVTTGANEA---ILSCLVGLLNQGDEVIVFEPFFDQYISNIEIPGGKVTYVPLHPP 174

Query: 233 RPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFE 292
           + L   +     W+ D +E+   +        K   L++  P NP G + + + + +I  
Sbjct: 175 KELENRVTHGTEWTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGN 228

Query: 293 VAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSG 352
           +  +  +V+I+DEVY E+++  S+F  +         T   +  N+ L S+ S  K  + 
Sbjct: 229 ICVENNVVIISDEVY-EHLYFTSEFTRI--------ATLSPEIGNLTL-SVGSAGKTFAA 278

Query: 353 ECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQ- 411
             G R G+  +V  N ++    LK AS+         A   +  + P P  E+  +  + 
Sbjct: 279 -TGWRIGW--IVSQNAEL----LKYASM---------AHTRICFASPSPFQEACAKSIEI 322

Query: 412 -EREDIHDALDERASKLFETFSRLE---GIECRKPQGAMYL---YPKLDLPYKVIQEAQH 464
             + +  + + +     F+ F+R+    G+   +P+G  ++   + K+ +P       + 
Sbjct: 323 ALQNNYFEKMRQEYINKFDIFTRVFDELGLPYTQPEGTYFVLVDFSKVKIPEDYPFPEEL 382

Query: 465 LEMEPDEFYCKALLENTGICTVPGSGF 491
           L    D      L+   G+  +P + F
Sbjct: 383 LSKAKDFRISYWLINELGVVAIPPTEF 409

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 70/321 (21%), Positives = 133/321 (41%), Gaps = 60/321 (18%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           +I +T GA+  +   L  L   P   V++  P +  Y +++ +   +     L   +  S
Sbjct: 116 NIQVTTGANEGILACLVGLL-NPGDEVIVFEPFFDQYISNIQIPGGKVTYVPLHPPKEMS 174

Query: 247 TDPEEIEQ--VVLDAIQKGIKPT--CLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVI 302
             P E  +  V  D ++  I P    L++  P NP G + + + + +I ++  +  +V+I
Sbjct: 175 VRPTEGTEWTVDYDELRAAITPKTKALILNTPHNPVGKVFTREELLQIGQICVENNVVII 234

Query: 303 ADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYME 362
           +DEVY E+++   +F  +         T   +   I L ++ S  K  +   G R G+  
Sbjct: 235 SDEVY-EHLYFTPEFTRV--------ATLSPEIGQITL-TIGSAGKSFAA-TGWRIGW-- 281

Query: 363 LVGFNHDIRQVFLKLASISLC---PVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDA 419
           +V  N ++ + +  +A   +C   P    +A  + +   P   D  Y +  +E E IH  
Sbjct: 282 IVSLNPELLE-YASMAHTRICFASPSPLQEACANAL---PIALDNGYFKKMRE-EYIHK- 335

Query: 420 LDERASKLFETFSRL---EGIECRKPQGAMYL---YPKLDLP------------------ 455
                   F  F+R+    G+   KP+G  ++   + K+ +P                  
Sbjct: 336 --------FNIFTRVFDELGLPYTKPEGTYFVLVDFSKVKIPEDYPFPEELRSKAKDFRI 387

Query: 456 -YKVIQEAQHLEMEPDEFYCK 475
            Y +I E   + + P EFY K
Sbjct: 388 SYWLINELGVVAIPPTEFYIK 408

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 13/126 (10%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSR----PLPYYLRE 241
           E++ L  G+  ++  I+   C      +L+  P Y +Y+    +N+      PL Y   +
Sbjct: 89  ENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLY---K 145

Query: 242 EQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVV 301
             ++  D E     VL  +Q       L + +PGNPTGA +  + I+ + +     G+VV
Sbjct: 146 NNSFQMDTES----VLTVLQNDPLIKLLFITSPGNPTGARIETERIETVLQNWTD-GLVV 200

Query: 302 IADEVY 307
           + DE Y
Sbjct: 201 V-DEAY 205

>YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromatic
           aminotransferase II, catalyzes the first step of
           tryptophan, phenylalanine, and tyrosine catabolism
          Length = 513

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 58/267 (21%), Positives = 118/267 (44%), Gaps = 42/267 (15%)

Query: 157 YSQSQGVQGIRETVADFITK------RDDGEISYPEDIYLTAGASAAVSYILSILCKGPN 210
           Y++++G+  +   V DF+++       D+ E ++  D+ L+ G++ ++  +   +C   +
Sbjct: 102 YAETKGLPPLLHFVKDFVSRINRPAFSDETESNW--DVILSGGSNDSMFKVFETICD-ES 158

Query: 211 TGVLIPIPQYPLYTASLALNNSRPLPYYL-----REEQNWSTDPEEIEQVVLDAIQKG-- 263
           T V+I    +    +++    ++ +P  +     RE Q    D E + Q+ LD    G  
Sbjct: 159 TTVMIEEFTFTPAMSNVEATGAKVIPIKMNLTFDRESQ--GIDVEYLTQL-LDNWSTGPY 215

Query: 264 ---IKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQ----------- 308
               KP  L  I  G NPTG  + +   +KI+++A ++  +++ D+ Y            
Sbjct: 216 KDLNKPRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPYGYLYFPSYNPQE 275

Query: 309 --ENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGF 366
             EN +  S   + + +   L K++     + ++  L + SK  +      G  +  +  
Sbjct: 276 PLENPYHSSDLTTERYLNDFLMKSFLTLDTDARVIRLETFSKIFAP-----GLRLSFIVA 330

Query: 367 NHDIRQVFLKLASISL-CPVVTGQALV 392
           N  + Q  L LA I+   P  T QA+V
Sbjct: 331 NKFLLQKILDLADITTRAPSGTSQAIV 357

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 70/160 (43%), Gaps = 23/160 (14%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQY----PLYTASLALNNSRPLPYYLREE 242
           D+  T G + +    L I C   N G  I   +Y     +Y A     N  P+P      
Sbjct: 135 DVLATIGNTGSWESTLRIFC---NRGDTILAEKYTFSSSVYAAEAQGVNVFPVPLDAD-- 189

Query: 243 QNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVV 301
                 PE +E ++ +   +  KP  L  I  G NPTG+ LS+   ++I+ +A K+  ++
Sbjct: 190 ---GLIPERLEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFII 246

Query: 302 IADEVY---QENVF-------KGSKFYSMKKVLRNLQKTY 331
           I DE Y   Q + +       K  +F S  + + +L K++
Sbjct: 247 IEDEPYYFLQMDAYEKDPSKRKAIEFASHDEFVNSLAKSF 286

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 60/122 (49%), Gaps = 5/122 (4%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           D++ TAG + A    L + C   N G +I + +   +++SLA   ++ +  +        
Sbjct: 134 DVFATAGNTNAWESTLRLFC---NRGDVI-LAEAHSFSSSLASAEAQGVITFPVPIDADG 189

Query: 247 TDPEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADE 305
             PE++ +++ +      KP  L  I  G NPTG  ++    + I+++A K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDE 249

Query: 306 VY 307
            Y
Sbjct: 250 PY 251

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 90/201 (44%), Gaps = 14/201 (6%)

Query: 115 LSL-LQHPELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADF 173
           LSL L  P  ++   E  QTL  T  +K  + LL E    +    Q    +G +E VA +
Sbjct: 58  LSLELPKPPFVDGIGECKQTLQAT-IMKEQQDLLFEHDVPLARALQYGNSRGQKELVA-Y 115

Query: 174 ITKRDD--GEISYPE-DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALN 230
           + +       I Y + DI  T G++      L I C   N G  + + +Y  Y++S+   
Sbjct: 116 LKEHTSLFHRIPYQDWDIITTTGSTQGWDASLRIFC---NKGDTVLLEEY-TYSSSVEAA 171

Query: 231 NSRPLPYYLREEQNWSTDPEEIEQVVL---DAIQKGIKPTCLVVINPG-NPTGAILSEQS 286
           +++ L             PE++E++++   D       P  L  I  G NPTG  LS+  
Sbjct: 172 DAQGLNCIPMPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSR 231

Query: 287 IQKIFEVAAKYGIVVIADEVY 307
              I+ +A KY +++I DE Y
Sbjct: 232 KPYIYHLAQKYDMIIIEDEPY 252

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 89/196 (45%), Gaps = 23/196 (11%)

Query: 157 YSQSQG----VQGIRETVADFITKR-DDGEISYPEDIYLTAGASAAVSYILSILCKGPNT 211
           Y  SQG    ++ IRE      T + DD E+       +TAG ++A    L I C   N 
Sbjct: 103 YGHSQGQPELLKFIREHTEIIHTMQYDDWEL------LVTAGNTSAWESTLRIFC---NR 153

Query: 212 GVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVV 271
           G  I + +   +++SL+   ++ +  +     +    PE++  ++ +   +  KP  L  
Sbjct: 154 GDTI-LAEAHSFSSSLSAAQAQGIITFPVPIDDKGIIPEKLAAIMDNWNPETPKPKLLYT 212

Query: 272 INPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKT 330
           I  G NPTG+ L  +   +++++A K+  +++ DE Y    F   + Y     LR   K 
Sbjct: 213 IPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDEPY---YFLQMEDYVKDPSLRKEVKL 269

Query: 331 YHGQYDNIQLASLHST 346
            H ++    LASL  T
Sbjct: 270 SHDEF----LASLDQT 281

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 69/324 (21%), Positives = 134/324 (41%), Gaps = 32/324 (9%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           D+  TAG + A    L + C   N G +I + +   +++SLA   ++ +  +        
Sbjct: 134 DVVATAGNTNAWESTLRVFC---NRGDVI-LAEAHSFSSSLAAAEAQGIIAFPVPIDADG 189

Query: 247 TDPEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADE 305
             PE++ +++ +      KP  L  I  G NPTG  +++   + I+++A K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLIVEDE 249

Query: 306 VY---QENVF----------KGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSG 352
            Y   Q N +          + S      + L++L KT+     + ++  + S SK ++ 
Sbjct: 250 PYYFLQMNAYIKDLKEREKAQSSPKQDHDEFLKSLSKTFLSLDTDGRVIRMDSFSKVLA- 308

Query: 353 ECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESY-EQDQQ 411
             G R G+  + G +  +   +         P    Q LV+  +S  + G + Y +    
Sbjct: 309 -PGTRLGW--ITGSSKTLEPYYSLHEMTIQAPAGFTQVLVNATLS--RWGQKGYLDWLLG 363

Query: 412 EREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLP----YKVIQEAQHLEM 467
            R +     D     L+E   +        P   M+    +D      +K    +   ++
Sbjct: 364 LRHEYTLKRDRAIDALYEYLPQNGTFVINPPIAGMFFTVNIDASAHPEFKTKYNSDPYQL 423

Query: 468 EPDEFYCKALLENTGICTVPGSGF 491
           E   +  K ++EN G+  VPGS F
Sbjct: 424 EQTMY--KKVVEN-GVLVVPGSWF 444

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 57/123 (46%), Gaps = 7/123 (5%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 244
           E++ L  G+  ++  I+   C      +L+  P Y +Y+    +N+   +   L    N 
Sbjct: 87  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLITSDNS 146

Query: 245 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 304
           +  + +E    V+   Q       + + +PGNPTGA +    I+KI +   + G+VV+ D
Sbjct: 147 FQANTDE----VIKTAQNDPSIKLIFITSPGNPTGAKVETSRIEKILQNWDR-GMVVV-D 200

Query: 305 EVY 307
           E Y
Sbjct: 201 EAY 203

>Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W
           (AAT1) - aspartate aminotransferase, mitochondrial
           [contig 55] FULL
          Length = 422

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 67/144 (46%), Gaps = 7/144 (4%)

Query: 167 RETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTAS 226
           R++     T  D   IS+ + +  T GA A  S +LS+     +  V IP P +P +   
Sbjct: 98  RDSCPRGATFLDQNRISFVQTLSGT-GALAVASKLLSLFM---SRSVWIPNPSWPNHANV 153

Query: 227 LALNNSRPLPYYLREEQNWSTDPE-EIEQVVLDAIQKGIKPTCLVV-INPGNPTGAILSE 284
              N  + + YY    ++ S D E  I+ +   A ++G  P C+V+     NPTG   S+
Sbjct: 154 FQNNGFKEINYY-SYYKDGSLDIEGWIQDLEKHAQKEGEDPQCIVLHACCHNPTGIDPSK 212

Query: 285 QSIQKIFEVAAKYGIVVIADEVYQ 308
           +  Q+I +   +  ++ I D  YQ
Sbjct: 213 EQWQRILDKIHELNLIPIIDMAYQ 236

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/149 (22%), Positives = 68/149 (45%), Gaps = 13/149 (8%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           D+  TAG +      L + C   N G +I + +   +++SLA   ++ +  +        
Sbjct: 134 DVLATAGNTNGWESTLRVFC---NRGDVI-LAEAHSFSSSLASAEAQGVITFPIPIDAGG 189

Query: 247 TDPEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADE 305
             PE++ +++ +      KP  L  I  G NPTG  +++   + I+++A K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDE 249

Query: 306 VYQENVFKGSKFYSMKKVLRNLQKTYHGQ 334
            Y         F  M   +++L++    Q
Sbjct: 250 PYY--------FLQMNPYIKDLKEREKAQ 270

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 74/156 (47%), Gaps = 11/156 (7%)

Query: 157 YSQSQGVQGIRETVADFITKRDDGEISYPE-DIYLTAGASAAVSYILSILCKGPNTGVLI 215
           Y  S+G + +   + + I K    +I Y + D+ +TAG++ A    L + C  P   VL+
Sbjct: 100 YGNSRGQRELVSFLKEHIVKFH--QIPYSDWDVLITAGSTQAWDASLRLFCN-PGDSVLL 156

Query: 216 PIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVV--LDAIQKGIK-PTCLVVI 272
              +   Y++S+    ++ +     E       PE++E ++   D +  G   P  L VI
Sbjct: 157 ---ESWTYSSSVEAAEAQGMYCVGVEIDGHGVVPEKLEWLLQNWDDLHPGRSLPKLLYVI 213

Query: 273 NPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
             G NP G  L+++    I+ +  KY +V+I D+ Y
Sbjct: 214 PTGQNPMGVTLADERKPLIYNIIQKYDMVLIEDDPY 249

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 64/137 (46%), Gaps = 15/137 (10%)

Query: 185 PEDIYLTAGASAAV-SYILSILCKGPNTGVLIPIPQYPLYTASL--ALNNSRPL--PYYL 239
           PE+I +T GA+  + + ++S+L  G    VL P     +Y   +   +    PL  P  L
Sbjct: 99  PENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDL 158

Query: 240 REEQN----WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAA 295
           +  +     W+ D ++    + +      K   +++ +P NPTG + + + +  +  +  
Sbjct: 159 KTRRTKGSEWTLDFDQFRSAISE------KTKAVIINSPHNPTGKVFTREELLTLGNICV 212

Query: 296 KYGIVVIADEVYQENVF 312
           +  + +I+DEVY+   F
Sbjct: 213 EKNVYIISDEVYENLYF 229

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 59/124 (47%), Gaps = 9/124 (7%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 244
           ++I L  G+  ++  I+   C      V++  P Y +Y     +N+   +   L    N 
Sbjct: 88  KNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVGYVEVPLISSDNS 147

Query: 245 WSTDPEEI-EQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIA 303
           +  D + I EQ+ LD   K IK   + + +PGNPTGA +    ++K+       GIVV+ 
Sbjct: 148 FQIDEDRILEQLNLD---KSIK--VVFITSPGNPTGACIEVGRVEKLLR-NWTAGIVVV- 200

Query: 304 DEVY 307
           DE Y
Sbjct: 201 DEAY 204

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 257 LDAIQKGIKP-TCLVVIN-PGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQ 308
           LD ++K IK  T L++IN P NP G ++S++ +  I E+  +  + +  DEVY+
Sbjct: 142 LDTLKKAIKSNTKLIIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDEVYR 195

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 38.5 bits (88), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 54/122 (44%), Gaps = 5/122 (4%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNW 245
           +++ L  G+  ++  ++   C      +L   P Y +Y+    +N+   L   L  E N 
Sbjct: 87  DNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYEDN- 145

Query: 246 STDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADE 305
           S  P+   Q V+  +        + + +PGNPTGA +    I KI E  +  G  V+ DE
Sbjct: 146 SFQPDS--QKVISILSSDPLIKLVFLTSPGNPTGAKIDSNIIIKILE--SWDGGFVVVDE 201

Query: 306 VY 307
            Y
Sbjct: 202 AY 203

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 54/133 (40%), Gaps = 17/133 (12%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLY----------TASLALNNSRPL 235
           E+I +T GA  A+   L  L K P   V++  P +  Y             + L N    
Sbjct: 99  ENILVTTGAIQALLESLMALIK-PGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQG 157

Query: 236 PYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAA 295
              + E  +W  D E +     D      K   +++ NP NP G + +   + ++  +  
Sbjct: 158 KKRILEANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATLCV 211

Query: 296 KYGIVVIADEVYQ 308
             G  +IADEVY+
Sbjct: 212 NNGAYIIADEVYE 224

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 75/360 (20%), Positives = 139/360 (38%), Gaps = 81/360 (22%)

Query: 156 AYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAA---VSYIL-----SILCK 207
           +Y   +G   +R ++A        G     +DI LT GA  A     Y L      ++C 
Sbjct: 54  SYGAIKGSDELRTSIASLY-----GPDFTMDDILLTNGAIGANFLAFYTLVGAGDHVICV 108

Query: 208 GPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPT 267
            P    L  +P+  ++ A + L         L++E ++  + + ++ ++ +  +      
Sbjct: 109 EPTYSQLYSVPE--MFGAEVDL-------LTLKKEDDFLPNLQTLKSMIKNNTK------ 153

Query: 268 CLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVF----------KGSKF 317
            +++ NP NP G+++ +  +++I ++  +  I + +DEVY+  +F             + 
Sbjct: 154 LIIINNPNNPLGSVIKKDLLKQICKLCEENDIYLHSDEVYRP-IFHSLEDEMVPPSACEL 212

Query: 318 YSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKL 377
           YS   V  ++ K Y      I+L  L S  K    +   R  Y                +
Sbjct: 213 YSKAIVSGSMSKAY--SVAGIRLGWLVSKDKQFLRDAASRRDY---------------NM 255

Query: 378 ASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGI 437
            S+S+      Q ++D   +       +YE        ++D +DE + K FE +      
Sbjct: 256 ISVSMIDDQIAQYVLD---NREYVIKRNYELCLNNFRLLNDFMDEHSDK-FEFY------ 305

Query: 438 ECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGT 497
              KP  A     K+    K + +           +   L E  G+  VPG  FG VPGT
Sbjct: 306 --HKPTAATVCLAKV----KGVNDTMK--------FATFLAEKYGVLAVPGEAFG-VPGT 350

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 38.5 bits (88), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 66/133 (49%), Gaps = 17/133 (12%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           ++ +  G+S A+  +  +LC   +T +L      P+  +++ L  +  +P  ++     S
Sbjct: 123 NVCMANGSSDAMYKVFEVLCDEDSTVMLEEFTFSPV-ISNIKLQGASVVPVKMQ----LS 177

Query: 247 TDPE----EIEQV--VLDAIQKG-----IKPTCLVVINPG-NPTGAILSEQSIQKIFEVA 294
            DPE    +++++  +LD    G      KP  L  +  G NPTG  LS    ++I+E+A
Sbjct: 178 ADPEQQGIDVDRLADLLDNWSVGPYKHLNKPKALYTVATGQNPTGMTLSPTKRRRIYEIA 237

Query: 295 AKYGIVVIADEVY 307
            K+  +++ D+ Y
Sbjct: 238 QKHDFLIVEDDPY 250

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 38.5 bits (88), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 20/114 (17%)

Query: 249 PEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
           PE++E+++ +      +P  L  I  G NPTG  L++   ++I+ +A K+  ++I DE Y
Sbjct: 189 PEKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

Query: 308 Q--------ENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGE 353
                    E+V K       ++ LRN  K  H ++    L SL  T   V  E
Sbjct: 249 YFLQMDPYVEDVGK-------REELRNKPKQTHDEF----LKSLARTFLSVDTE 291

>Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON}
           (69909..71414) [1506 nt, 502 aa]
          Length = 501

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 265 KPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
           KPT L  I  G NPTG  LS +  +KI+++  K+ I+++ D+ Y
Sbjct: 208 KPTVLYTIATGQNPTGMTLSMEKRRKIYKICQKHDIIIVEDDPY 251

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 58/125 (46%), Gaps = 8/125 (6%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           D+  T G ++A    L + C   N G  I   +Y   ++ +A        Y +  ++N  
Sbjct: 132 DVLATVGNTSAWESTLRVFC---NRGDTILAEEYTFSSSLVAAEAQGVRAYPVPLDEN-G 187

Query: 247 TDPEEIEQVV--LDAIQKGI-KPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVI 302
             PE + +++   +    G+ +P  L  +  G NPTG  LS    Q ++ +A ++ ++++
Sbjct: 188 MVPERLGELLDNWERWHDGVPRPKLLYTVPTGQNPTGTCLSNDRRQAVYRLAQQHDLLIV 247

Query: 303 ADEVY 307
            DE Y
Sbjct: 248 EDEPY 252

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
           (REAL)
          Length = 517

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 75/173 (43%), Gaps = 33/173 (19%)

Query: 157 YSQSQGVQGIRETVADFITKRD----DGEISYPEDIYLTAGASAAVSYILSILCKGPNTG 212
           Y++S+G   +   V D +++ +      E+    D+ L+ G++ ++  +   +C   +T 
Sbjct: 102 YAESKGTPPLLRFVKDMVSRINRPVFSDEMQSNWDVILSGGSNDSMFKVFETIC-DESTT 160

Query: 213 VLIPIPQYPLYTASLALNNSRPLPYYL-----REEQ------------NWSTDPEEIEQV 255
           VLI    +    +++    ++ +P  +     R+ Q            NWST P      
Sbjct: 161 VLIEEFTFTPAMSNVEATGAKVVPIKINLTLDRDSQGIDVDHLTQLLDNWSTGP------ 214

Query: 256 VLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
                +   KP  L  I  G NPTG  + +   +KI+ +A K+  +++ D+ Y
Sbjct: 215 ----YKHLAKPRVLYTIATGQNPTGMSVPQWKREKIYRLAQKHDFLIVEDDPY 263

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 37.4 bits (85), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 29/124 (23%), Positives = 58/124 (46%), Gaps = 7/124 (5%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           D+  TAG++ A    L + C   N G  + + +Y  Y++SL    ++ L     +     
Sbjct: 128 DLITTAGSTQAWDACLRLFC---NRGETVLMEEYT-YSSSLEAAVAQGLNCVAMKMDKDG 183

Query: 247 TDPEEIEQVVLD---AIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIA 303
              +++ +++ D   A+Q         + N  NPTG  L E+   ++  +A++Y  ++I 
Sbjct: 184 IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243

Query: 304 DEVY 307
           D+ Y
Sbjct: 244 DDPY 247

>Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W
           (REAL)
          Length = 513

 Score = 37.4 bits (85), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 57/274 (20%), Positives = 112/274 (40%), Gaps = 56/274 (20%)

Query: 157 YSQSQGVQGIRETVADFITK------RDDGEISYPEDIYLTAGASAAVSYILSILCKGPN 210
           Y++++G+  +   V D + +       D+ E ++  D+ L+ G++ ++  +   +C   +
Sbjct: 102 YAETKGLPPLLHFVKDMVCRINRPVFSDETESNW--DVILSGGSNDSMFKVFETIC-DES 158

Query: 211 TGVLIPIPQYPLYTASLALNNSRPLPYYL-----REEQ------------NWSTDPEEIE 253
           T V+I    +    +++    ++ +P  +     RE Q            NWST P    
Sbjct: 159 TTVMIEEFTFTPAMSNVEATGAKVIPIKMDLTFDRERQGIDVEDLTRLLDNWSTGP---- 214

Query: 254 QVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQ---- 308
                  +   KP  L  I  G NPTG  +     +KI+++A K+  +++ D+ Y     
Sbjct: 215 ------YKHLNKPKVLYTIATGQNPTGMSVPRWKREKIYQLAQKHDFLIVEDDPYGYMYF 268

Query: 309 ---------ENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGG 359
                    EN +  S     + +   L K++     + ++  L + SK  +      G 
Sbjct: 269 PSYNPQNPLENPYDSSDLTIERYLNDFLMKSFLTLDTDARVIRLETFSKIFAP-----GL 323

Query: 360 YMELVGFNHDIRQVFLKLASISL-CPVVTGQALV 392
            +  +  N  + Q  L LA I+   P  T QA+V
Sbjct: 324 RLSFIVANKFLLQKILDLADITTRAPSGTSQAIV 357

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 37.4 bits (85), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 265 KPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
           KP  L  I  G NPTG  LS +  +KI+E+  K+ I+++ D+ Y
Sbjct: 208 KPKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPY 251

>TBLA0I01180 Chr9 complement(252457..253788) [1332 bp, 443 aa] {ON}
           Anc_2.475 YKL106W
          Length = 443

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 73/345 (21%), Positives = 135/345 (39%), Gaps = 51/345 (14%)

Query: 139 SIKRAKRLLSEVGGSVG--AYSQSQGVQGIRETVADFITKRDDGEISYPEDIYL------ 190
           S++ A+ LL  V       +Y    G    R  V +F+      EI  PE IY       
Sbjct: 69  SVQNAQHLLHTVPSLRKDLSYLPIIGHPNYRNKVLNFLFHDGCPEIG-PEIIYQDRVSFV 127

Query: 191 -TAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPL---PYYLREE---Q 243
            T   + A+S     L    +  ++IP   +  +      N  R +   PYY  E+   +
Sbjct: 128 QTLSGTGALSVTARFLSNFISDSIIIPQLSWANHANVFKNNGFRNISYYPYYSNEKIVLK 187

Query: 244 NWSTDPEEIEQVVLDAIQKGIKPTCLVV-INPGNPTGAILSEQSIQKIFEVAAKYGIVVI 302
           +W      I++   +      KP+C+++     NPTG   +++   +I +      ++ I
Sbjct: 188 DWLNHLINIQKTDREVTSNS-KPSCILLHACCHNPTGLDPTKEQWDQILDTIYDLNLIPI 246

Query: 303 ADEVYQ----ENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRG 358
            D  YQ     +V K S  Y ++KVL   +K Y    + I L    + + G+ GE   R 
Sbjct: 247 IDMAYQGLESGDVLKDS--YLLRKVLN--KKRYKNWKNGIYLCQSFAKNMGLYGE---RV 299

Query: 359 GYMELV---------------GFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGD 403
           G + ++                 +  ++Q+   + S    P   G  +V L++S     D
Sbjct: 300 GSLSIILPETNSGNKSTSIRENIDSQLKQIIRSMYS---SPPGYGARIVSLILSDKDLKD 356

Query: 404 ESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYL 448
           + +     + +++ D L++   KL +  +    I+  +  G  Y 
Sbjct: 357 QWF----LDVKEMVDRLNDVRYKLSQKLNWNSIIDLNQQHGMFYF 397

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 57/123 (46%), Gaps = 7/123 (5%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLR-EEQN 244
           +++ L  G+  ++  I+   C      +L+  P Y +Y+    +N+   +   L   + +
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDGS 147

Query: 245 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 304
           +  D E     VL  ++       + V +PGNPTGA +    I+K+ +     G+VV+ D
Sbjct: 148 FQMDTE----AVLTILKNDSLIKLMFVTSPGNPTGAKIKTSLIEKVLQ-NWDNGLVVV-D 201

Query: 305 EVY 307
           E Y
Sbjct: 202 EAY 204

>NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON}
           Anc_2.102
          Length = 510

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/162 (21%), Positives = 81/162 (50%), Gaps = 15/162 (9%)

Query: 157 YSQSQGVQGIRETVADFITKRDDGEISYPEDIY---LTAGASAAVSYILSILCKGPNTGV 213
           YS+++G+  + + +  FI K       Y + ++   L  G+S ++  +   LC   +T +
Sbjct: 109 YSETRGLNPLLDFIRYFI-KWIGNSPPYEDSLWEVMLANGSSDSMFKVFETLCDESDTVL 167

Query: 214 LIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQV--VLDAIQKG-----IKP 266
           +      P+ +  +A   ++ +P  ++   N+     +I+ +  +L+  ++G      KP
Sbjct: 168 MEEFTFVPVISNVMA-TGAKCIP--IKVNLNYEDQGIDIDYLSNLLNNWKEGPYKHLSKP 224

Query: 267 TCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
             L  I+ G NP G  LS +  +KI+++A ++ ++++ D+ Y
Sbjct: 225 KILYTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPY 266

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 249 PEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
           PE++E ++ +      KP  L  I  G NPTG  L     + I+ +A K+  +++ DE Y
Sbjct: 189 PEKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDEPY 248

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 56/123 (45%), Gaps = 7/123 (5%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 244
           +++ L  G+  ++  I+   C      +L+  P Y +Y+    +N+   +   L    N 
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS 147

Query: 245 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 304
           +  D E      L  ++       + V +PGNPTGA +    I+KI +   + G+VV+ D
Sbjct: 148 FQMDTE----AALTILKNDPLIKLIFVTSPGNPTGAKIKTCLIEKILQ-NWENGLVVV-D 201

Query: 305 EVY 307
           E Y
Sbjct: 202 EAY 204

>SAKL0G02838g Chr7 complement(232634..233365) [732 bp, 243 aa] {ON}
           similar to uniprot|P41734 Saccharomyces cerevisiae
           YOR126C IAH1 Isoamyl acetate-hydrolyzing esterase
           required in balance with alcohol acetyltransferase to
           maintain optimal amounts of isoamyl acetate which is
           particularly important in sake brewing
          Length = 243

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 63/142 (44%), Gaps = 17/142 (11%)

Query: 311 VFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGY--MELVGFNH 368
           V +G   Y+ +  L+ L +    +   I +++L+    G +  C   GG+  +EL  F  
Sbjct: 49  VQRGFSGYNTRWALKLLPRILENESPGIVMSTLYF---GSNDAC--HGGHQKVELPEFKD 103

Query: 369 DIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDE---SYEQDQQEREDIHDALDERAS 425
           ++ ++     S  + P++ G AL D     P+  DE    Y +  +  +   DAL E A 
Sbjct: 104 NVERLLDIFKSKGIKPILVGPALFDKDNWNPRKADEVAQGYVRSNENNKLYSDALQEIAD 163

Query: 426 K-------LFETFSRLEGIECR 440
           K       L++ FSR  G E R
Sbjct: 164 KEQIPFVNLYDAFSREGGNEWR 185

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 27/41 (65%)

Query: 276 NPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSK 316
           NP+GA  S++   K+ ++A +Y I++I+D+VY    F G +
Sbjct: 200 NPSGATYSQECRLKLLDLARRYDILIISDDVYDLLGFHGQR 240

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 81/187 (43%), Gaps = 31/187 (16%)

Query: 156 AYSQSQGVQGIRETVADFITKRDDGEI-SYPEDIYLTAGASAAVSYILSILCKGPNTG-- 212
           +Y   +G   +R  ++ F+ K     + + PE I LT GAS  +  IL   C  P+TG  
Sbjct: 50  SYGPKEGSLWVRCVISQFVNKCFKPLMPTKPEYINLTGGASYGIMNILE-QCTLPHTGYT 108

Query: 213 --VLIPIPQYPLYTASL----------ALNNSRP------LPYYLRE-EQNWSTDPEEIE 253
               +  P Y L   +           A+N ++       L   L E E +   +P+  E
Sbjct: 109 RQAFLISPTYFLINETFIDAGFGGKLTAVNETQNGLDVEFLEAKLAEFEYDALLNPQHGE 168

Query: 254 QVVLDAI--------QKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADE 305
           +  L+ I        +K  +    +V    NP+G   S  +  K+ E+A KY I++I+D+
Sbjct: 169 ERGLNLINMSGRSRTKKVYRYVMYLVPTFSNPSGKTYSVSTRLKLVELARKYDILLISDD 228

Query: 306 VYQENVF 312
           VY   V+
Sbjct: 229 VYDLLVY 235

>SAKL0E02948g Chr5 complement(241418..242689) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q01802 Saccharomyces cerevisiae
           YKL106W AAT1 Mitochondrial aspartate aminotransferase
           catalyzes the conversion of oxaloacetate to aspartate in
           aspartate and asparagine biosynthesis
          Length = 423

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 54/268 (20%), Positives = 103/268 (38%), Gaps = 17/268 (6%)

Query: 192 AGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEE 251
            GA A  S +L +     +  V IP P +  +T     N  + + YY     N + D + 
Sbjct: 121 TGALAVASKLLYLFV---SKTVWIPAPSWANHTNVFQSNGFKDIRYYTYYN-NGTLDVDS 176

Query: 252 IEQVVLDAIQKGIKPTCLVV-INPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQEN 310
             Q +  A +K   P C+V+     NPTG   + +   KI +      ++ I D  YQ  
Sbjct: 177 WLQDLRSATRKYRAPQCIVLHACCHNPTGVDPTIEQWSKILDAIHDLNMIPILDMAYQG- 235

Query: 311 VFKGSKFYSMKKVLRNLQKTYHGQYDN-IQLASLHSTSKGVSGECGQRGGYMELVGFNHD 369
             +    Y    +LR    +    + N + L    + + G+ GE       +      H 
Sbjct: 236 -LESGNLYRDAYLLRMCLDSSRYHWSNGLYLCQSFAKNMGLYGERVGSLSVVVPSSVTHG 294

Query: 370 IR-----QVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERA 424
           ++     Q+   +  I   P   G  + +L++S  +  D+ +    ++  ++   L    
Sbjct: 295 LKLNIDSQLKKIVRGIYSSPPGYGSRVANLVLSDQKLKDQWF----RDVRNMSQRLWHVR 350

Query: 425 SKLFETFSRLEGIECRKPQGAMYLYPKL 452
           S++F+   +   +  R  Q  M+ +  L
Sbjct: 351 SEMFKKLPQWSNLVDRTQQHGMFYFTGL 378

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/124 (22%), Positives = 61/124 (49%), Gaps = 9/124 (7%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYP-LYTASLALNNSRPLPYYLREEQN 244
           +++ +T GA AA ++++     GP   V+   P Y  LY+          L   L++E  
Sbjct: 79  DNVLVTNGAIAA-NFLIYYTLVGPGDHVICVDPTYAQLYSVPKMFGAEVSL-LKLQKEDG 136

Query: 245 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 304
           +  + E +++++    +       +++ NP NP G+ +S +++  I ++  +  I +  D
Sbjct: 137 FIPNIETLKKMIKSNTK------LIIINNPNNPLGSAISTETLNDICQLCEENNIYLHCD 190

Query: 305 EVYQ 308
           EVY+
Sbjct: 191 EVYK 194

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 73/159 (45%), Gaps = 10/159 (6%)

Query: 157 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIP 216
           YSQ+QG+  I + +   +   ++       D+ L  G+S ++  +   L     T VL+ 
Sbjct: 112 YSQTQGLAPILDFLKLIVANCNNPPYQ-NWDLLLANGSSDSMFKLFDTLTD-ETTTVLVE 169

Query: 217 IPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIE--QVVLDAIQKG-----IKPTCL 269
              +    +++    +  +P  L    N S     +   Q +L+  Q G      +P+ L
Sbjct: 170 EFTFSPVLSNITATGASCVPLQLNFTSNPSNQGINVTYLQHLLENWQSGPYKHLNRPSIL 229

Query: 270 VVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
             I+ G NPTG  +S ++  +I+++A KY  +++ D+ Y
Sbjct: 230 YTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 71/161 (44%), Gaps = 14/161 (8%)

Query: 157 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIP 216
           YS+++G+  + E  +  I KR +       D+ L  G+S ++  I   LC   + GV + 
Sbjct: 132 YSETRGLPSVVE-FSKKIVKRFNPPAYDNWDVLLANGSSDSLFKIFETLC---DEGVTVL 187

Query: 217 IPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIE-QVVLDAIQKG--------IKPT 267
           + ++        +  S      ++ E     + + I+ Q + D ++           KP 
Sbjct: 188 MEEFTFSPTIFNVTASGGKVVPIKVEITHDPETQGIDVQYLCDLLENWEVGPYKHLSKPR 247

Query: 268 CLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
            L  I  G NPTG  LS +  + I+E+A  +  +++ D+ Y
Sbjct: 248 VLYTIATGQNPTGMTLSPEKRKAIYELAETHNFIIVEDDPY 288

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 74/179 (41%), Gaps = 30/179 (16%)

Query: 156 AYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKG--PNTG- 212
            Y   +G   +R+ V + I +      S PE I LT+GAS     IL+IL +   P+TG 
Sbjct: 50  TYGSDEGALWVRQEVCNMINQIGSDINSKPEYINLTSGASYG---ILNILLQTTLPHTGY 106

Query: 213 ---VLIPIPQYPLYTASL-------ALNNSRPLPY------YLRE-----EQNWSTDPEE 251
                I  P Y L             +   +   Y      YL+E     EQ     P+ 
Sbjct: 107 TKQAFIVSPTYFLINDCFIDAGFGSKMTAIKEKGYTSIDLEYLKEKLEYFEQEIPDVPQN 166

Query: 252 IEQVVLDA--IQKGIKPTCLVVI-NPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
              ++ +   +QK I       I    NP+G     ++  ++ ++A KY +++I D+VY
Sbjct: 167 STDIIQNKNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDVY 225

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 57/123 (46%), Gaps = 7/123 (5%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 244
           +++ L  G+  ++  I+   C      +L+  P Y +Y+    +N+   +   L    N 
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVVSDNS 147

Query: 245 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 304
           +  D E     VL  ++       + V +PGNPTGA +    I+++ +   + G+VV+ D
Sbjct: 148 FQMDVE----AVLTILENDPLIKLVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNGLVVV-D 201

Query: 305 EVY 307
           E Y
Sbjct: 202 EAY 204

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 73/160 (45%), Gaps = 10/160 (6%)

Query: 157 YSQSQGVQGIRETVADFITKRDDGEISYPE-DIYLTAGASAAVSYILSILCKGPNTGVLI 215
           Y++  G+  IR      + K +    S  + D+ L++G+  ++       C   +T ++ 
Sbjct: 125 YNEVPGLPQIRNFAKYLVNKINKPAYSADQWDVLLSSGSCDSMFKFFECFCDEKSTVLME 184

Query: 216 PIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQV--VLDAIQKG-----IKPTC 268
                P+  + +    +  +P  +   ++ ST   +++ +  +LD    G      KP  
Sbjct: 185 EFTFTPV-ISHVKATGAECIPLKMNLTKDPSTQGIDVDYLTQLLDNWSSGPYKHLNKPRI 243

Query: 269 LVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
           L  I  G NPTG  +  ++ +KI+E+A K+  +++ D+ Y
Sbjct: 244 LYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPY 283

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
           (REAL)
          Length = 560

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 70/165 (42%), Gaps = 30/165 (18%)

Query: 243 QNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVV 301
           +NWST P           +   KP  L  I  G NPTG  + +   +KI+E+A ++  ++
Sbjct: 256 ENWSTGP----------YRHLNKPRVLYTIATGQNPTGMSVPQWKREKIYELAQRHDFLI 305

Query: 302 IADEVYQ-------------ENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSK 348
           + D+ Y              EN ++ S   + + +   L K++     + ++  L + SK
Sbjct: 306 VEDDPYGYLYFPPFDPENPLENPYQSSSVTTERYLNEFLMKSFLTLDTDARVIRLETFSK 365

Query: 349 GVSGECGQRGGYMELVGFNHDIRQVFLKLASISL-CPVVTGQALV 392
             +      G  +  +  N  I +  L LA I+   P  T QA+V
Sbjct: 366 IFAP-----GLRLSFIVANKFILEKVLDLADITTRAPSGTSQAIV 405

>KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} similar
           to uniprot|Q01802 Saccharomyces cerevisiae YKL106W AAT1
           Mitochondrial aspartate aminotransferase catalyzes the
           conversion of oxaloacetate to aspartate in aspartate and
           asparagine biosynthesis
          Length = 421

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 63/145 (43%), Gaps = 20/145 (13%)

Query: 171 ADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALN 230
           A+F++K     IS+ + +  T GA A  S +LS+     +  V IP P +P +      N
Sbjct: 105 AEFLSK---NRISFVQTLSGT-GALAVASKLLSLFM---SKAVWIPNPSWPNHANVFQNN 157

Query: 231 NSRPLPYYLR------EEQNWSTDPEEIEQVVLDAIQKGIKPTCLVV-INPGNPTGAILS 283
             + + YY        +  +W  D   +EQ V D       P C+V+     NPTG   S
Sbjct: 158 GFKRINYYTYYRDGGLDVDSWLQD---LEQAVRDG---DGSPQCIVLHACCHNPTGVDPS 211

Query: 284 EQSIQKIFEVAAKYGIVVIADEVYQ 308
            +  + I +   +  ++ I D  YQ
Sbjct: 212 LEQWRTILDKINELNLIPIIDMAYQ 236

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 35.0 bits (79), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 42/183 (22%), Positives = 69/183 (37%), Gaps = 32/183 (17%)

Query: 157 YSQSQGVQGIRETVADFITKR------DDGEISYPEDIYLTAGASAAVSYIL---SILCK 207
           Y   +G   +RET+  F           D   S PE + L +GAS  V  IL   ++   
Sbjct: 54  YGSDEGALWVRETICHFNNDEAFRLSPGDRARSKPEHLNLNSGASYGVLSILLETTLAHT 113

Query: 208 GPNTGVLIPIPQYPLY-------------TASLALNNSR----------PLPYYLREEQN 244
           G      +  P Y L              TA   L + +                 E Q+
Sbjct: 114 GYTRQAFVITPTYFLINDCFIDAGFANKTTAIDELGDGKVDLDSLEKKLEELEKQHEGQD 173

Query: 245 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 304
            S D E I        +K  +     +    NP+G   + ++ +++ E+A KY ++++AD
Sbjct: 174 DSKDLELINNPWKSTHKKVYRYVLYCIPTFANPSGQTYTLETRRRLIEIARKYDMLILAD 233

Query: 305 EVY 307
           +VY
Sbjct: 234 DVY 236

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 61/127 (48%), Gaps = 15/127 (11%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNN----SRPLPYYLRE 241
           E+  L  G+  ++  I+   C      +L+  P Y +Y+    +N+    + PL   + E
Sbjct: 87  ENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPL---ITE 143

Query: 242 EQNWSTDPEEIEQVVL-DAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIV 300
           + ++  D  EI  ++  D + K      + + +PGNPTGA +    I+ + +   + G+V
Sbjct: 144 DNSFQIDATEILNILANDPLIK-----LVFITSPGNPTGAKIEIDRIEYLLKNWDQ-GLV 197

Query: 301 VIADEVY 307
           ++ DE Y
Sbjct: 198 IV-DEAY 203

>CAGL0K08580g Chr11 complement(865470..866831) [1362 bp, 453 aa]
           {ON} similar to uniprot|Q01802 Saccharomyces cerevisiae
           YKL106w Aspartate aminotransferase
          Length = 453

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 49/183 (26%), Positives = 79/183 (43%), Gaps = 15/183 (8%)

Query: 192 AGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALN---NSRPLPYYLREEQNWSTD 248
            GA A  S +LS      +  + IP P +P +T     N   N R   YY R +      
Sbjct: 145 TGALAVASRLLSSFI---SRKIWIPKPSWPNHTNIFTQNGFTNPRFYSYYDRGDLTIGRW 201

Query: 249 PEEI-EQVVLDAIQKGIKPTCLVV-INPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEV 306
            +E+  +V  D+  K   P C+V+     NPTG   +++  + I +   + G++ I D  
Sbjct: 202 LQELRHEVGKDSNTK--TPHCIVLHACCHNPTGLDPTKKQWEDIMDTIYELGMIPIIDMA 259

Query: 307 YQENVFKGSKFYSMKKVLR-NLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVG 365
           YQ    +  K      +LR  L  + +  +DN  L    S +K + G  G+R G + +V 
Sbjct: 260 YQG--LESGKLIDDAYLLRLCLDTSRYRSWDN-GLYLCQSFAKNM-GLYGERVGSLSIVA 315

Query: 366 FNH 368
             H
Sbjct: 316 PEH 318

>KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 60/129 (46%), Gaps = 9/129 (6%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 246
           D+ L  G+S ++S + + L    +  VL+    +    +++  N   P+P  +    + S
Sbjct: 160 DVMLANGSSDSLSKVFTTLTD-EDVTVLMEEFTFTPTISNVTANGGIPIPLKVDITDDAS 218

Query: 247 TDPEEIEQV--VLDAIQKG-----IKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYG 298
                +E +  +L+    G      KP  L  I  G NPTG    ++  QKI+++  K+ 
Sbjct: 219 QQGINVEYMDQLLENWSTGEYSHLSKPRLLYTIVTGQNPTGMTQCKEKRQKIYDLCEKHD 278

Query: 299 IVVIADEVY 307
           I+++ D+ Y
Sbjct: 279 IIIVEDDPY 287

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 53/133 (39%), Gaps = 24/133 (18%)

Query: 187 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYP----------LYTASLALNNSRPLP 236
           DI  T G++      L I C   +T VL+    Y           L    + L+    +P
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDT-VLLEDYTYSSSVEAADAQGLNCVPMPLDGEGIVP 190

Query: 237 YYLREE-QNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVA 294
             L E   NWS+   E+             P  L  I  G NPTG  LS+     I+ +A
Sbjct: 191 SKLEEMLANWSSLYGEMPM-----------PKLLYTIPTGQNPTGCTLSDNRKPHIYRLA 239

Query: 295 AKYGIVVIADEVY 307
            +Y I++I D+ Y
Sbjct: 240 QQYDIIIIEDDPY 252

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 33.9 bits (76), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 24/33 (72%)

Query: 275 GNPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
            NP+G   S ++ +K+ ++A KY +++IAD+VY
Sbjct: 205 ANPSGMSFSLETKKKLLDLARKYDMLIIADDVY 237

>SAKL0H20658g Chr8 complement(1811772..1813187) [1416 bp, 471 aa]
           {ON} highly similar to uniprot|P17649 Saccharomyces
           cerevisiae YGR019W UGA1 Gamma-aminobutyrate (GABA)
           transaminase (4-aminobutyrate aminotransferase) involved
           in the 4-aminobutyrate and glutamate degradation
           pathways required for normal oxidative stress tolerance
           and nitrogen utilization
          Length = 471

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 50/118 (42%), Gaps = 9/118 (7%)

Query: 203 SILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQK 262
           S+ C  P     I    +P +    A   S   P    EE N + D +   ++V D I  
Sbjct: 198 SVTCSKP-----IHKLDFPAFNWPHAEYPSYQFPLEANEEANRAED-DRCLKIVEDLITS 251

Query: 263 GIKPTCLVVINPGNPTGA--ILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFY 318
              P   ++I P    G     S+  +QK+ +V  K+G+V I DEV Q  V    KF+
Sbjct: 252 WPIPVAALIIEPIQSEGGDNHASKYFLQKLRDVTLKHGVVYIIDEV-QTGVGATGKFW 308

>Kpol_431.13 s431 complement(37728..38465,38468..39061) [1332 bp,
           443 aa] {ON} complement(37728..38465,38468..39061) [1332
           nt, 444 aa]
          Length = 443

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 63/325 (19%), Positives = 121/325 (37%), Gaps = 45/325 (13%)

Query: 156 AYSQSQGVQGIRETVADFITKRD----------DGEISYPEDIYLTAGASAAVSYILSIL 205
           +Y    G    R+ V +F+ +            D  +S+ + +  T GA A  S +LS  
Sbjct: 93  SYLPISGCPNYRDNVLNFLFRDSVPKYGDKLIADNRVSFIQSLSGT-GAIAVASKLLSSF 151

Query: 206 CKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIK 265
                  V IP P +P +     +N  + L YY        T    +E    +      K
Sbjct: 152 ISDT---VWIPNPSWPNHDNIFHMNGFKNLKYYSYYNDGKITIDRWLESTETEVRSSNSK 208

Query: 266 PTCLVVINP--GNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKV 323
               ++++    NPTG   +     +I +   +  ++ I D  YQ    +    Y    +
Sbjct: 209 LPQSIILHACCHNPTGFDPTIDQWNEIIDTVYELDMIPIIDMAYQG--LESGSLYDDAYL 266

Query: 324 LRNL--QKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELV----------GFNHDIR 371
           LR+   +  Y G    + L    + + G+ GE   R G + +V            +  ++
Sbjct: 267 LRHCLDESRYKGWKHGLFLCQSFAKNMGLYGE---RVGSLSIVVPPNLEKAKLSIDSQLK 323

Query: 372 QVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETF 431
           ++   + S    P   G  + +L++S P       E   Q  +D+H  +    +   + +
Sbjct: 324 KIVRGIYS---SPPGYGCRIANLVLSQP-------ELRNQWHQDVHSIVGRLTNVRKQMY 373

Query: 432 SRL--EGIECRKPQGAMYLYPKLDL 454
            +L   G+     Q  M+ + +LD+
Sbjct: 374 DKLGWSGLVDSSQQHGMFYFTRLDI 398

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 74/178 (41%), Gaps = 30/178 (16%)

Query: 156 AYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKG--PNTG- 212
            Y   +G   +R+ + DF   R  G  S PE + L++G+S      LS+L     P+T  
Sbjct: 52  TYGPDEGALWVRQQICDF-NNRLFGSDSKPEFLNLSSGSSYGC---LSVLLHTTLPHTNF 107

Query: 213 ---VLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEI-------EQVVLDA--- 259
                I  P Y L                + EE   S + E++       E++  ++   
Sbjct: 108 TRQAFIISPTYFLINDCFIDAGFGSKLTAIDEEGEDSINFEQLLSKLRHFEELYGNSNGD 167

Query: 260 ---IQKGIKPTCLV-------VINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
              IQ   KPT  V       V    NP+G   S ++  K+ E+A +Y +++I D+VY
Sbjct: 168 VSIIQNPNKPTKKVYKYVMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVY 225

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 41/178 (23%), Positives = 73/178 (41%), Gaps = 27/178 (15%)

Query: 157 YSQSQGVQGIRETVADFIT----KRDDGEISYP--EDIYLTAGASAAVSYIL---SILCK 207
           Y   +G   +RE +  F+     K DDG  +    + + L +GAS  +  IL   ++   
Sbjct: 50  YGSDEGALWVREQICTFLNDQVFKFDDGARTRTQVDHLNLNSGASYGMLNILLQTTLPHN 109

Query: 208 GPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTD----------------PEE 251
           G      I  P Y L          +     + E+ + S D                P+ 
Sbjct: 110 GYTRQAFIITPTYFLINDCFRDAGFKGRITAINEKSHDSIDFESLVAALDHHEGESQPDS 169

Query: 252 IEQVVLD-AIQKGIKPTCLVVI-NPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
             +++   A+ K I    L  I    NP+G   S ++ +++ ++A KY ++VI+D+VY
Sbjct: 170 TTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKYDMLVISDDVY 227

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 23/32 (71%)

Query: 276 NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
           NP+G   S ++ +++ E+A KY ++VI D+VY
Sbjct: 203 NPSGNTYSLETRRRLIEIARKYDMLVITDDVY 234

>KLTH0H08976g Chr8 complement(772894..774309) [1416 bp, 471 aa] {ON}
           highly similar to uniprot|P17649 Saccharomyces
           cerevisiae YGR019W UGA1 Gamma-aminobutyrate (GABA)
           transaminase (4-aminobutyrate aminotransferase) involved
           in the 4-aminobutyrate and glutamate degradation
           pathways required for normal oxidative stress tolerance
           and nitrogen utilization
          Length = 471

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 50/118 (42%), Gaps = 9/118 (7%)

Query: 203 SILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQK 262
           S+ C  P   +  P  Q+P      A   S   P    EE N + D +   ++V D I  
Sbjct: 198 SVTCSKPIHKLDFPAFQWPH-----AEYPSYKFPLTENEEANRAED-DRCLKIVEDLITS 251

Query: 263 GIKPTCLVVINPGNPTGA--ILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFY 318
              P   ++I P    G     S+  +Q + ++  K+G+V I DEV Q  V    KF+
Sbjct: 252 WSIPVAALIIEPIQSEGGDNHASKYFLQSLRDLTLKHGVVYIVDEV-QTGVGATGKFW 308

>ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL106W (AAT1)
          Length = 443

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 74/346 (21%), Positives = 128/346 (36%), Gaps = 60/346 (17%)

Query: 139 SIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKR---------DDGEISYPEDIY 189
           S+ RA+ ++    G   AY    G       V+DF+              G +S+ + + 
Sbjct: 84  SVARAQLMVEGQRGGRLAYLPIAGCPSYGARVSDFLYSECAPQGREFLASGCVSFMQTLS 143

Query: 190 LTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDP 249
            T   S A  ++ + + K     + +P P +  +     LN    +  Y R  ++ + D 
Sbjct: 144 GTGALSLASLFLSNFISKT----IWVPQPSWANHMNIFKLNGFEEVRRY-RYYEDGAVDV 198

Query: 250 EEIEQVVLDAIQKGIKPTCLVV-INPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQ 308
           +     +  A      P C+++     NPTG   + +   +I  V    G+V I D  YQ
Sbjct: 199 DSWLAQLERAAADRPYPQCILLHACCHNPTGVDPTREQWSRILSVINGLGMVPIVDMAYQ 258

Query: 309 ENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNH 368
                G +   ++     L+     ++DN  L   HS +K + G  G+R G + +V   H
Sbjct: 259 -----GLESGDLRADAYLLRMCLEHRWDN-GLYVCHSFAKNM-GLYGERVGSLSVV---H 308

Query: 369 DIRQVFLKLASISLCPVV----------TGQALVDLMVSPPQPGDESYEQDQQEREDIHD 418
            + Q   K A+ S    +           G  +   ++S P       E  QQ  ED+H 
Sbjct: 309 PLGQFQAKAATDSQLKCIIRASYSSPPSYGSRVATTVLSVP-------EIKQQWHEDVHG 361

Query: 419 ALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQH 464
             +           RL  + C        L+ KL  P  +   +QH
Sbjct: 362 MCN-----------RLWSVRC-------MLHEKLRWPKLIDSTSQH 389

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 54/123 (43%), Gaps = 7/123 (5%)

Query: 186 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 244
           +++ L  G+  ++  I+   C      +L+  P Y +Y+    +N+   +   L    N 
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS 147

Query: 245 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 304
           +  + E     VL  +        +   +PGNPTGA +    I+++ +     GIVV+ D
Sbjct: 148 FQMNTE----AVLTILNNDPLIKIMFATSPGNPTGAKIKTCLIEEVLQ-KWDNGIVVV-D 201

Query: 305 EVY 307
           E Y
Sbjct: 202 EAY 204

>KNAG0H03730 Chr8 (690872..692443) [1572 bp, 523 aa] {ON} Anc_2.102
           YHR137W
          Length = 523

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 35/173 (20%), Positives = 71/173 (41%), Gaps = 25/173 (14%)

Query: 157 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIP 216
           YS ++G+  +      F+ +  +  +    D  L  G+S ++  +  IL    NT VL+ 
Sbjct: 115 YSATEGLDPLLNFTKSFLQRIGNTPLYNGWDTILANGSSDSLYKVFDILADR-NTTVLVE 173

Query: 217 IPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI------------ 264
              +     ++    +  +P  L  ++  S +    +Q   D   +GI            
Sbjct: 174 EFTFVPVVGTILGTGAHIVPMKLNLDEVTSDNFNNDKQ--FDPNHEGIDVEYLADLLENW 231

Query: 265 ---------KPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
                    KPT +  +  G NPTG  LS +  ++I+ +A ++  +++ D+ Y
Sbjct: 232 AVGPHKHLPKPTLMYTVVTGQNPTGVSLSYEKRRQIYALAQRHNFIIVEDDPY 284

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 23/33 (69%)

Query: 275 GNPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
            NP+G   S ++ +++ ++A KY +++I D+VY
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLIITDDVY 227

>Suva_15.317 Chr15 (551916..554789) [2874 bp, 957 aa] {ON} YHR120W
           (REAL)
          Length = 957

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 46/108 (42%), Gaps = 9/108 (8%)

Query: 28  MPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLKAKYAVRGRIPMRA---EELRDQLKKDP 84
           +  + S  +L F   VK AP+L++       L  +    G++P       +L   LK   
Sbjct: 98  LTQMGSFYELYFEQAVKYAPELNI------ALTNRAYTHGKVPFAGFPVHQLSRHLKMLV 151

Query: 85  SSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADEALQ 132
           ++  +S  I+    N    D +   FYR V  ++     ++EA E L+
Sbjct: 152 NNCGYSVTIAEQFKNNDVADNETNKFYRRVTRIVTPGTFIDEAFENLR 199

>NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa]
           {ON} Anc_8.204 YER152C
          Length = 478

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 31/51 (60%)

Query: 258 DAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQ 308
           ++++K  K     V +  NP+G   S ++ +K+ ++A  Y I++I D+VY+
Sbjct: 208 NSMKKIYKYVLYCVPSFANPSGKSYSLKTKRKLIDLACLYDILIITDDVYE 258

>NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204
          Length = 446

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 23/32 (71%)

Query: 276 NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 307
           NP+G   S ++  K+ E+A +Y +++I+D+VY
Sbjct: 199 NPSGNTYSLKTKLKLIELARRYDMLIISDDVY 230

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,501,766
Number of extensions: 2414299
Number of successful extensions: 8431
Number of sequences better than 10.0: 163
Number of HSP's gapped: 8618
Number of HSP's successfully gapped: 164
Length of query: 528
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 414
Effective length of database: 40,409,475
Effective search space: 16729522650
Effective search space used: 16729522650
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)