Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19162g8.263ON52852827240.0
SAKL0H17006g8.263ON53148620330.0
Skud_12.1578.263ON59248619570.0
YLR089C (ALT1)8.263ON59248619530.0
Suva_10.1738.263ON59248619480.0
TDEL0F039008.263ON55953119410.0
Smik_12.1488.263ON59248619420.0
ZYRO0C01628g8.263ON53448819170.0
KNAG0G020408.263ON59148819100.0
NCAS0B050208.263ON56848618980.0
NDAI0B019908.263ON58848618930.0
CAGL0L12254g8.263ON57452018800.0
Kpol_392.58.263ON51249618120.0
KAFR0B027308.263ON53948518070.0
TPHA0J007508.263ON52248617640.0
Kwal_56.237918.263ON51851917550.0
KLTH0G13662g8.263ON51948217460.0
NCAS0B038408.263ON49748617380.0
Skud_4.3728.263ON50748717230.0
Smik_4.3578.263ON50750317080.0
Suva_2.2718.263ON50748717060.0
KNAG0M012108.263ON52148717030.0
AGR085W8.263ON52151916990.0
Ecym_43078.263ON53448516950.0
YDR111C (ALT2)8.263ON50748716880.0
NDAI0J013608.263ON50148716870.0
KAFR0B055308.263ON51448716860.0
KAFR0B05520singletonON51051116830.0
TBLA0E044408.263ON56251316440.0
TPHA0A018008.263ON49849216370.0
TBLA0F030608.263ON50049416330.0
Kpol_543.398.263ON49248716060.0
TBLA0G01630singletonON50049315460.0
Kwal_56.23794singletonOFF115921803e-15
Kwal_34.160181.472ON3791611472e-09
KAFR0A017101.321ON4351811341e-07
CAGL0J05126g1.321ON4333501294e-07
TDEL0D019001.321ON4431711295e-07
TPHA0O014501.321ON4431701278e-07
Suva_6.1361.321ON4441711261e-06
SAKL0D11528g1.472ON3831521232e-06
KLLA0F03509g2.252ON3871691205e-06
KNAG0B053201.321ON4331651197e-06
NDAI0B045502.102ON5652081199e-06
SAKL0F02156g3.511ON4981571181e-05
Kpol_1035.231.321ON4441681162e-05
NDAI0G057601.321ON4481731162e-05
ZYRO0G20636g1.321ON4531711162e-05
Skud_10.1561.321ON4601711152e-05
Kwal_14.25741.321ON4431371143e-05
YJL060W (BNA3)1.321ON4441861143e-05
Kpol_1039.222.252ON3861691116e-05
Kwal_23.48882.252ON3891531108e-05
NCAS0A092001.321ON4451701091e-04
KNAG0B006603.511ON496601091e-04
Smik_10.1801.321ON4441411082e-04
Ecym_32902.252ON3861271072e-04
KLLA0F01617g1.321ON4441751072e-04
Ecym_6319singletonON3541571062e-04
KNAG0E018502.252ON3841221053e-04
KLTH0G09614g2.252ON3891551044e-04
SAKL0D06886g1.321ON4471391036e-04
AEL170C1.321ON4583611037e-04
TDEL0A016008.204ON4751881037e-04
KLTH0G19646g1.472ON3791511028e-04
Kpol_1032.398.204ON4531871029e-04
KLTH0H10648g1.321ON4431301010.001
TDEL0C040902.252ON3831231000.001
TPHA0F012602.252ON3921771000.001
KLTH0B00176g8.204ON4481831000.001
KLTH0G19624gsingletonON4681831000.002
SAKL0E08492g2.252ON384123980.002
Ecym_62921.321ON430133980.003
SAKL0H21824gna 1ON499125980.003
NDAI0B037302.252ON386126970.003
NCAS0B064402.252ON385126950.005
CAGL0C01243g2.252ON383122930.010
YHR137W (ARO9)2.102ON513191930.011
Kpol_480.11.472ON380363920.013
ZYRO0A01672g2.252ON386123920.013
ADL249W2.252ON387124920.013
Kwal_26.77682.475ON422132910.018
KLLA0A04906gna 1ON480124910.019
KNAG0G005501.472ON38754900.022
ZYRO0G05346g2.102ON504133890.033
Skud_8.1982.102ON517164890.033
KAFR0B023808.204ON443180880.041
Kpol_1035.302.102ON50144880.043
YIL116W (HIS5)2.252ON385123870.051
NCAS0G040501.472ON384152860.067
Ecym_55428.204ON446245860.072
NCAS0B072202.102ON510162860.076
Skud_9.552.252ON385123850.089
TPHA0O015202.102ON50344850.100
TBLA0B009902.102ON546159850.10
Suva_9.782.252ON386123840.12
TBLA0B080808.204ON444176840.13
Smik_8.2182.102ON513175840.13
SAKL0E12188g2.102ON530161840.13
Kwal_8.5858.204ON446194830.17
TBLA0I011802.475ON443235820.22
CAGL0G06028g2.102ON537160820.23
KAFR0J015802.252ON383127810.27
ABL038W2.475ON443342800.38
KLLA0D11110g2.102ON530129800.40
YDR112W (IRC2)singletonOFF10240740.41
Suva_15.3342.102ON560262790.54
SAKL0H20658g4.155ON471105780.68
Smik_9.532.252ON388122770.83
NCAS0A038308.204ON446219770.88
KLLA0F20548g4.155ON472105770.89
ZYRO0B11088g8.204ON450183761.2
KLTH0D05478g2.475ON421145751.5
Skud_4.373singletonON18653731.5
KNAG0G016808.204ON45232751.5
TDEL0E038505.241ON76164751.7
SAKL0E02948g2.475ON423269742.0
Suva_5.2818.204ON45032732.7
TDEL0D029604.155ON47193732.7
Kpol_1004.135.241ON76864733.0
CAGL0I06578g8.204ON436174723.5
Smik_5.3198.204ON44332714.6
CAGL0K08580g2.475ON453183714.6
ZYRO0G10758gsingletonON461171714.7
KLTH0H08976g4.155ON471105714.7
NDAI0H015207.120ON25281704.7
TPHA0M001706.4ON622111715.0
TDEL0E046005.170ON98341715.4
TDEL0D012701.251ON155169715.6
TDEL0H028107.164ON530128706.4
TPHA0D006208.73ON822145706.9
ZYRO0G10626g4.127ON23867688.0
YER152C8.204ON44332698.0
NDAI0C059608.204ON47851698.2
ZYRO0G04136g7.120ON25481688.3
ACR040W5.241ON76342699.0
Ecym_10651.60ON82931699.1
TBLA0B023803.107ON959109699.2
Smik_11.1062.440ON126775699.5
Ecym_42328.340ON137685699.6
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KLLA0F19162g
         (1587 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...  1053   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   787   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   758   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   756   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   754   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   752   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   752   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   743   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   740   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   735   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   733   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   728   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   702   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   700   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   684   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   680   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   677   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   674   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   668   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   662   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   661   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   660   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   659   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   657   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   654   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   654   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            654   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   652   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   637   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   635   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   633   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   623   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              600   0.0  
Kwal_56.23794 s56 complement(707600..707947) [348 bp, 115 aa] {O...    74   3e-15
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    61   2e-09
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    56   1e-07
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    54   4e-07
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    54   5e-07
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    54   8e-07
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    53   1e-06
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    52   2e-06
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    51   5e-06
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    50   7e-06
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    50   9e-06
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    50   1e-05
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    49   2e-05
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    49   2e-05
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    49   2e-05
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    49   2e-05
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    49   3e-05
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    49   3e-05
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    47   6e-05
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    47   8e-05
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    47   1e-04
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    47   1e-04
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    46   2e-04
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    46   2e-04
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    46   2e-04
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    45   2e-04
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    45   3e-04
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    45   4e-04
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    44   6e-04
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    44   7e-04
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    44   7e-04
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    44   8e-04
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    44   9e-04
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    44   0.001
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    43   0.001
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    43   0.001
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    43   0.001
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    43   0.002
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    42   0.002
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    42   0.003
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    42   0.003
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    42   0.003
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    41   0.005
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    40   0.010
YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromat...    40   0.011
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    40   0.013
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    40   0.013
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    40   0.013
Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W...    40   0.018
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    40   0.019
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       39   0.022
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    39   0.033
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    39   0.033
KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {O...    39   0.041
Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON} (69909....    39   0.043
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    38   0.051
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    38   0.067
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    38   0.072
NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2...    38   0.076
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    37   0.089
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    37   0.100
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    37   0.10 
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    37   0.12 
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    37   0.13 
Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W ...    37   0.13 
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    37   0.13 
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    37   0.17 
TBLA0I01180 Chr9 complement(252457..253788) [1332 bp, 443 aa] {O...    36   0.22 
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    36   0.23 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    36   0.27 
ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic ho...    35   0.38 
KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} simila...    35   0.40 
YDR112W Chr4 (679544..679852) [309 bp, 102 aa] {OFF}  IRC2Dubiou...    33   0.41 
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    35   0.54 
SAKL0H20658g Chr8 complement(1811772..1813187) [1416 bp, 471 aa]...    35   0.68 
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    34   0.83 
NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204     34   0.88 
KLLA0F20548g Chr6 (1907637..1909055) [1419 bp, 472 aa] {ON} high...    34   0.89 
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    34   1.2  
KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} simila...    33   1.5  
Skud_4.373 Chr4 (651175..651735) [561 bp, 186 aa] {ON} YDR112W (...    33   1.5  
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    33   1.5  
TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {O...    33   1.7  
SAKL0E02948g Chr5 complement(241418..242689) [1272 bp, 423 aa] {...    33   2.0  
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    33   2.7  
TDEL0D02960 Chr4 complement(558937..560352) [1416 bp, 471 aa] {O...    33   2.7  
Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON} (25289....    33   3.0  
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    32   3.5  
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    32   4.6  
CAGL0K08580g Chr11 complement(865470..866831) [1362 bp, 453 aa] ...    32   4.6  
ZYRO0G10758g Chr7 (866250..867635) [1386 bp, 461 aa] {ON} no sim...    32   4.7  
KLTH0H08976g Chr8 complement(772894..774309) [1416 bp, 471 aa] {...    32   4.7  
NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120      32   4.7  
TPHA0M00170 Chr13 complement(33610..35478) [1869 bp, 622 aa] {ON...    32   5.0  
TDEL0E04600 Chr5 complement(861586..864537) [2952 bp, 983 aa] {O...    32   5.4  
TDEL0D01270 Chr4 complement(242013..246668) [4656 bp, 1551 aa] {...    32   5.6  
TDEL0H02810 Chr8 complement(465456..467048) [1593 bp, 530 aa] {O...    32   6.4  
TPHA0D00620 Chr4 complement(115810..118278) [2469 bp, 822 aa] {O...    32   6.9  
ZYRO0G10626g Chr7 complement(852624..852838,852926..853404,85346...    31   8.0  
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    31   8.0  
NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa] ...    31   8.2  
ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {O...    31   8.3  
ACR040W Chr3 (431343..433634) [2292 bp, 763 aa] {ON} Syntenic ho...    31   9.0  
Ecym_1065 Chr1 (120443..122932) [2490 bp, 829 aa] {ON} similar t...    31   9.1  
TBLA0B02380 Chr2 (554809..557688) [2880 bp, 959 aa] {ON} Anc_3.1...    31   9.2  
Smik_11.106 Chr11 complement(182281..186084) [3804 bp, 1267 aa] ...    31   9.5  
Ecym_4232 Chr4 complement(484651..488781) [4131 bp, 1376 aa] {ON...    31   9.6  

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa] {ON}
            similar to uniprot|P52893 Saccharomyces cerevisiae
            YLR089C ALT1 putative alanine transaminase (glutamyc
            pyruvic transaminase)
          Length = 528

 Score = 1053 bits (2724), Expect = 0.0
 Identities = 528/528 (100%), Positives = 528/528 (100%)
 Frame = +1

Query: 1    MLSVRVNLKTRISSGMIRVNAPALKSTMPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLK 180
            MLSVRVNLKTRISSGMIRVNAPALKSTMPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLK
Sbjct: 1    MLSVRVNLKTRISSGMIRVNAPALKSTMPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLK 60

Query: 181  AKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQH 360
            AKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQH
Sbjct: 61   AKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQH 120

Query: 361  PELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDG 540
            PELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDG
Sbjct: 121  PELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDG 180

Query: 541  EISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLR 720
            EISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLR
Sbjct: 181  EISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLR 240

Query: 721  EEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIV 900
            EEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIV
Sbjct: 241  EEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIV 300

Query: 901  VIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGY 1080
            VIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGY
Sbjct: 301  VIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGY 360

Query: 1081 MELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDAL 1260
            MELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDAL
Sbjct: 361  MELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDAL 420

Query: 1261 DERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLEN 1440
            DERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLEN
Sbjct: 421  DERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLEN 480

Query: 1441 TGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 1584
            TGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD
Sbjct: 481  TGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 528

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
            similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
            KLLA0F19162g and similar to YLR089C uniprot|P52893
            Saccharomyces cerevisiae YLR089C ALT1 putative alanine
            transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  787 bits (2033), Expect = 0.0
 Identities = 377/486 (77%), Positives = 440/486 (90%), Gaps = 1/486 (0%)
 Frame = +1

Query: 130  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 309
            +PA KLSL+D+NENVL+AKYAVRG+IP +AEEL++QL +DP SLPF +II+ANIGNPQQL
Sbjct: 46   QPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQL 105

Query: 310  DQKPLTFYREVLSLLQHPELLEEAD-EALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 486
            DQKPLTFYR+VLSLLQ+P++LEE   E L  +YK D+I RA RLLS +GGSVGAYS SQG
Sbjct: 106  DQKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQG 165

Query: 487  VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 666
            V G R+TVADFITKRD GE +Y EDI+LTAGASAAVSYILSILC+GP TGVLIPIPQYPL
Sbjct: 166  VYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPL 225

Query: 667  YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 846
            YTASLALNNS  LPYYL EE NWST+PEEIE+VV ++I KG++P CLVVINPGNPTGAIL
Sbjct: 226  YTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAIL 285

Query: 847  SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 1026
            S +SI+KIFEVAAKYGIVVIADEVYQENVF G++F+SM+KVL++LQ+ +HG++DNIQLAS
Sbjct: 286  SPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLAS 345

Query: 1027 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 1206
            LHSTSKGVSGECGQRGGYMEL+GF+HD+RQVFLKLASISLCPVVTGQALVDLMV PP+PG
Sbjct: 346  LHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKPG 405

Query: 1207 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 1386
            D SYEQDQ+ER +IHDALD RAS L+ETF+RLEGIEC+KPQGAMYL+P+LDL YK +Q+A
Sbjct: 406  DASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKA 465

Query: 1387 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 1566
            +HL + PDEFYC+ LLE TGICTVPGSGFGQVPGTYHLRTTFL PGT+W++ WE+FHK F
Sbjct: 466  EHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKKF 525

Query: 1567 FDKYRD 1584
            +++YRD
Sbjct: 526  YNEYRD 531

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
            YLR089C (REAL)
          Length = 592

 Score =  758 bits (1957), Expect = 0.0
 Identities = 364/486 (74%), Positives = 428/486 (88%), Gaps = 2/486 (0%)
 Frame = +1

Query: 133  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 312
            PA +L+L+DVNENVLKAKYAVRG IPMRAEEL+ QL+KDP SLPF KII+ANIGNPQQL 
Sbjct: 107  PAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQQLQ 166

Query: 313  QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 486
            QKPLT+YR+VLSLLQ+PELL + ++ L    L+K D+IKRAK L+ ++GGSVGAYS SQG
Sbjct: 167  QKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQG 226

Query: 487  VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 666
            V+GIR++VA+FITKRDDGEISYPEDI+LTAGASAAV+Y+LSI C+GP TGVLIPIPQYPL
Sbjct: 227  VEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPL 286

Query: 667  YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 846
            YTA+LALNNS+ LPYYL E+  WST+PEEIE VV +AIQ  IKPT LVVINPGNPTGA+L
Sbjct: 287  YTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVL 346

Query: 847  SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 1026
            S +S+ +IFEVAAKYG VVIADEVYQEN+F G+KF+SMKK+LR LQ+ + G++DN+QLAS
Sbjct: 347  SPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQLAS 406

Query: 1027 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 1206
            LHSTSKGVSGECGQRGGYMEL GF+H++RQV LKLASISLCPVVTGQALVDLMV PP  G
Sbjct: 407  LHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEG 466

Query: 1207 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 1386
            +ES+E DQ ER  IH+ L  RA  L++TF+ LEGIEC+KPQGAMYL+PK+DLP+K +QEA
Sbjct: 467  EESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEA 526

Query: 1387 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 1566
            +HLE+ PDEFYCK+LLE+TGICTVPGSGFGQ PGTYHLRTTFL PG EW++ WE FHK F
Sbjct: 527  RHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEF 586

Query: 1567 FDKYRD 1584
            FD+YRD
Sbjct: 587  FDQYRD 592

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
            ALT1Alanine transaminase (glutamic pyruvic transaminase);
            involved in alanine biosynthetic and catabolic processes;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 592

 Score =  756 bits (1953), Expect = 0.0
 Identities = 364/486 (74%), Positives = 427/486 (87%), Gaps = 2/486 (0%)
 Frame = +1

Query: 133  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 312
            PA +L+L+DVNENVLKAKYAVRG IPMRAEEL+ QL+KDP SLPF +II+ANIGNPQQL 
Sbjct: 107  PAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQ 166

Query: 313  QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 486
            QKPLT+YR+VLSLLQ+PELL + ++ L    L+K D+IKRAK L+ ++GGSVGAYS SQG
Sbjct: 167  QKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQG 226

Query: 487  VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 666
            V+GIR++VA+FITKRD+GEISYPEDI+LTAGASAAV+Y+LSI C+GP TGVLIPIPQYPL
Sbjct: 227  VEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPL 286

Query: 667  YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 846
            YTA+LALNNS+ LPYYL E   WST+PEEIE VV +AIQ  IKPT LVVINPGNPTGA+L
Sbjct: 287  YTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVL 346

Query: 847  SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 1026
            S +SI +IFEVAAKYG VVIADEVYQEN+F G+KF+SMKK+LR+LQ+ + G++DN+QLAS
Sbjct: 347  SPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLAS 406

Query: 1027 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 1206
            LHSTSKGVSGECGQRGGYMEL GF+H++RQV LKLASISLCPVVTGQALVDLMV PP  G
Sbjct: 407  LHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEG 466

Query: 1207 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 1386
            +ES+E DQ ER  IH+ L  RA  L+ETF+ LEGIEC+KPQGAMYL+PK+DLP+K +QEA
Sbjct: 467  EESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEA 526

Query: 1387 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 1566
            +HLE+ PDEFYCK LLE+TGICTVPGSGFGQ PGTYHLRTTFL PG EW++ WE FHK F
Sbjct: 527  RHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEF 586

Query: 1567 FDKYRD 1584
            FD+YRD
Sbjct: 587  FDQYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
            YDR111C (REAL)
          Length = 592

 Score =  754 bits (1948), Expect = 0.0
 Identities = 365/486 (75%), Positives = 425/486 (87%), Gaps = 2/486 (0%)
 Frame = +1

Query: 133  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 312
            PA +L+LDDVNENVLKA+YAVRG IPMRAEEL+ QL+KDP SLPF+KII+ANIGNPQQL 
Sbjct: 107  PAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQ 166

Query: 313  QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 486
            QKPLT+YR+VLSLLQ+PELL   ++ L    L+K D+IKRAK L+ ++GGSVGAYS SQG
Sbjct: 167  QKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQG 226

Query: 487  VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 666
            V+GIR++VADFITKRD GE +YPEDI+LTAGASAAV+Y+LSI C+GP TGVLIPIPQYPL
Sbjct: 227  VEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYPL 286

Query: 667  YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 846
            YTA+LALNNS+PLPYYL E   WST+PEEIE VV +AIQ  IKPT LVVINPGNPTGA+L
Sbjct: 287  YTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVL 346

Query: 847  SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 1026
            S +SI +IFEVAAKYG VVIADEVYQEN+F G++F SMKKVLR+LQ+ + G++DN+QLAS
Sbjct: 347  SPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLAS 406

Query: 1027 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 1206
            LHSTSKGVSGECGQRGGYMEL GF+H++RQV LKLASISLCPVVTGQALVDLMV PP  G
Sbjct: 407  LHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEG 466

Query: 1207 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 1386
            +ES+E DQ ER  IH+ L+ RA  L+ETF+ LEGIEC+KPQGAMYL+PK+D+P+K IQEA
Sbjct: 467  EESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQEA 526

Query: 1387 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 1566
             HLE+ PDEFYCK LLE+TGICTVPGSGFGQ PGTYHLRTTFL PG EW++ WE FHK F
Sbjct: 527  HHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKEF 586

Query: 1567 FDKYRD 1584
            FD+YRD
Sbjct: 587  FDQYRD 592

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
            Anc_8.263 YDR111C
          Length = 559

 Score =  752 bits (1941), Expect = 0.0
 Identities = 370/531 (69%), Positives = 442/531 (83%), Gaps = 5/531 (0%)
 Frame = +1

Query: 7    SVRVNLKTRISSGMIRVNAPALKSTMPSVTSLTQL---RFSTTVKPAPKLSLDDVNENVL 177
            ++   L+ R   G   +N    +ST  +   L  +   +      PA  L++ D+NENVL
Sbjct: 29   TITTTLQGRSGLGRSYMNIKRARSTSSTAAGLHHIYHKKCHQDFYPAESLTVRDLNENVL 88

Query: 178  KAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQ 357
            KAKYAVRG IPMRAEEL++QLK+DPSSLPF KI++ANIGNPQQL+QKPL+FYR+VLS+LQ
Sbjct: 89   KAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQLNQKPLSFYRQVLSILQ 148

Query: 358  HPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKR 531
            +PE+LE+ +E L  + ++K D+I+RAKR+L +VGGSVGAYS SQGV GIR+TVADFIT+R
Sbjct: 149  YPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSSSQGVYGIRKTVADFITER 208

Query: 532  DDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPY 711
            D GE +YPEDI+LTAGASAAVSY+LSILC+G  TGVLIPIPQYPLYTA+LALNNS  LPY
Sbjct: 209  DSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQYPLYTATLALNNSHVLPY 268

Query: 712  YLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKY 891
            YL EE  WST+  EIE VV ++I+ GI+P+ LVVINPGNPTG++LS ++I+KIF+VAAKY
Sbjct: 269  YLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGSVLSVEAIEKIFQVAAKY 328

Query: 892  GIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQR 1071
            GIVVIADEVYQEN+F GS+F+SMKKVLR LQK + G YDN+QL SLHSTSKGVSGECGQR
Sbjct: 329  GIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQLVSLHSTSKGVSGECGQR 388

Query: 1072 GGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIH 1251
            GGYMEL GF H+IRQV LKLASISLCPVVTGQALVDLMV PP+PGDESYEQD++ERE IH
Sbjct: 389  GGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPPKPGDESYEQDRKEREMIH 448

Query: 1252 DALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKAL 1431
            + LD RA  L +TF+ LEGIEC+KP+GAMYL+P++ LPYK IQ AQHLE  PDEFYC+ L
Sbjct: 449  EELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAIQAAQHLEKTPDEFYCQKL 508

Query: 1432 LENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 1584
            LE TGICTVPGSGFGQ PGTYHLRTTFL PGTEW++ WE FHK F+D+YRD
Sbjct: 509  LEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFHKKFYDQYRD 559

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
            YLR089C (REAL)
          Length = 592

 Score =  752 bits (1942), Expect = 0.0
 Identities = 363/486 (74%), Positives = 425/486 (87%), Gaps = 2/486 (0%)
 Frame = +1

Query: 133  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 312
            PA +L+LDDVNENVLKAKYAVRG IPMRAEEL+ QL+KDP SLPF+KII+ANIGNPQQL 
Sbjct: 107  PAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQ 166

Query: 313  QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 486
            QKPLT+YR+VLSLLQ+PELL + ++ L    L+K D+IKRAK L+ E+GGSVGAYS SQG
Sbjct: 167  QKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGAYSSSQG 226

Query: 487  VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 666
            V+GIR +VA+FITKRD+GEISYPEDI+LTAGASAAV+Y+LSI C+GP TGVLIPIPQYPL
Sbjct: 227  VEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPL 286

Query: 667  YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 846
            YTA+LALNNS+ LPYYL E   WST+PEEIE VV +AI+  IK T LVVINPGNPTGA+L
Sbjct: 287  YTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGNPTGAVL 346

Query: 847  SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 1026
            S +SI +IFEVAAKYG VVIADEVYQEN+F G+KF+SMKK+LR+LQ+ + G++DN+QLAS
Sbjct: 347  SPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLAS 406

Query: 1027 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 1206
            LHSTSKGVSGECGQRGGYMEL GF+H++RQV LKLASISLCPVVTGQALVDLMV PP  G
Sbjct: 407  LHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPLEG 466

Query: 1207 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 1386
            +ES+E DQ ER  IH+ L  RA  L++TF+ LEGIEC+KPQGAMYL+PK+DLP++ +QEA
Sbjct: 467  EESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFRAVQEA 526

Query: 1387 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 1566
            +HLE+ PDEFYCK LLE+TGICTVPGSGFGQ PGTYHLRTTFL PG EW++ WE FHK F
Sbjct: 527  RHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEF 586

Query: 1567 FDKYRD 1584
            FD YRD
Sbjct: 587  FDHYRD 592

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar to
            uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
            putative alanine transaminase (glutamyc pyruvic
            transaminase)
          Length = 534

 Score =  743 bits (1917), Expect = 0.0
 Identities = 366/488 (75%), Positives = 418/488 (85%), Gaps = 2/488 (0%)
 Frame = +1

Query: 127  VKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQ 306
            V PA KL L +VNENVLKAKYAVRG IPM A EL  +LKKDP SLPF  I+SANIGNPQ 
Sbjct: 47   VYPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQH 106

Query: 307  LDQKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQS 480
            L QKPLTFYR+VLSLLQ+P LLEE ++ L    LY+ D+I RA+RLL+++G SVGAYS S
Sbjct: 107  LKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTS 166

Query: 481  QGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQY 660
            QG+QGIRETVA FIT+RD GE +Y EDI+LTAGAS+AVSY+LSILCKG  TGVLIPIPQY
Sbjct: 167  QGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQY 226

Query: 661  PLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGA 840
            PLYTASLALNNS PLPYYL E+  WST+P EIE VV +AI++ IKP+ LVVINPGNPTGA
Sbjct: 227  PLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGA 286

Query: 841  ILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQL 1020
            +LSE+ I +IF +AAKYGIVVIADEVYQENVF G++F+SMKK+LR LQK+  G +DN+QL
Sbjct: 287  VLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQL 346

Query: 1021 ASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQ 1200
            ASLHSTSKGVSGECGQRGGYME+ GFN+DIRQV LKLASISLCPVVTGQALVDLMVSPP+
Sbjct: 347  ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPK 406

Query: 1201 PGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQ 1380
            PGDESYE DQQER+ IH+AL ERA KL  TF+ LEGIEC+KP+GAMYL+P+L LP+K IQ
Sbjct: 407  PGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQ 466

Query: 1381 EAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHK 1560
             A+H  M PD FYCK LLE TGICTVPGSGFGQ PGTYHLRTTFL PGTEW+E WE FHK
Sbjct: 467  SAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHK 526

Query: 1561 AFFDKYRD 1584
            AF+++YRD
Sbjct: 527  AFYEEYRD 534

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
            Anc_8.263 YDR111C
          Length = 591

 Score =  740 bits (1910), Expect = 0.0
 Identities = 359/488 (73%), Positives = 426/488 (87%), Gaps = 4/488 (0%)
 Frame = +1

Query: 133  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 312
            PA ++ + D+NENVLKAKYAVRG IPMRAE+L+ QL++DP SLPF KII+ANIGNPQQL+
Sbjct: 104  PAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLN 163

Query: 313  QKPLTFYREVLSLLQHPELLEEADE---ALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQ 483
            QKPL+FYR+VLSLLQ PELL    E   A  +LYK D+++RA++LL ++GGSVGAYS SQ
Sbjct: 164  QKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQ 223

Query: 484  GVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYP 663
            GV GIR+TVADFIT+RD+ E +YPEDI+LTAGASAAVSY+LSI CKG  TGVLIPIPQYP
Sbjct: 224  GVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYP 283

Query: 664  LYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAI 843
            LYTA+LALNNS  LPYYL E+  WST+ +EI+ VVLDAI + IKP+ LVVINPGNPTGA+
Sbjct: 284  LYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAV 343

Query: 844  LSEQSIQKIFEVAAKYGIVVIADEVYQENVF-KGSKFYSMKKVLRNLQKTYHGQYDNIQL 1020
            LSE++I +IFE+AAKYGIVVIADEVYQEN+F +  KF+SMKKVLR LQ+ + G++D +QL
Sbjct: 344  LSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQL 403

Query: 1021 ASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQ 1200
            ASLHSTSKGVSGECGQRGG+MEL GF+H+IRQV LKLASISLCPVVTGQALVDLMV PPQ
Sbjct: 404  ASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQ 463

Query: 1201 PGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQ 1380
             G+ESYE DQ ER  IH  L +RA+KL+ETF+RLEGI+C+KPQGAMYL+P+L+LP+K +Q
Sbjct: 464  EGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQ 523

Query: 1381 EAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHK 1560
            +AQH+EM  DEFYCK LLENTGICTVPGSGFGQVPGTYHLRTTFL PGTEW++ WEKFHK
Sbjct: 524  KAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHK 583

Query: 1561 AFFDKYRD 1584
             F++KYRD
Sbjct: 584  EFYNKYRD 591

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  735 bits (1898), Expect = 0.0
 Identities = 359/486 (73%), Positives = 423/486 (87%), Gaps = 2/486 (0%)
 Frame = +1

Query: 133  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 312
            PA +L+L ++N+NVLKAKYAVRG IPMRAEEL+ QL++DPSSLPF  I++ANIGNPQQL+
Sbjct: 83   PADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQLN 142

Query: 313  QKPLTFYREVLSLLQHPELLEEADEALQT--LYKTDSIKRAKRLLSEVGGSVGAYSQSQG 486
            QKPL+FYR+VLSLLQ+PE+L++ +  L    L+K D+++RAK LL E+GG+VGAYS SQG
Sbjct: 143  QKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSASQG 202

Query: 487  VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 666
            V GIR+TVA+FITKRD+GE +YPEDI+LTAGASAAV Y+LSILCKGP TGVLIPIPQYPL
Sbjct: 203  VYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQYPL 262

Query: 667  YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 846
            YTASLALNNS  LPYYL E+  WST+P+EIE+VVL A  K I+P+ LVVINPGNPTGA+L
Sbjct: 263  YTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGAVL 322

Query: 847  SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 1026
            SE+SI+ IFE+AAKYGIVVIADEVYQENVF   KF+SMKKVLRNLQK + G YD +QLAS
Sbjct: 323  SEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQLAS 382

Query: 1027 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 1206
            LHSTSKGVSGECGQRGGYMEL GF H++R V LKLASISLCPVVTGQALVDLMVSPP+ G
Sbjct: 383  LHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPPKKG 442

Query: 1207 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 1386
            DES+EQDQ ER+ I   L  RA +L++ F+ LEGIEC+KPQGAMYL+P+LDLP+K +Q+A
Sbjct: 443  DESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAVQKA 502

Query: 1387 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 1566
            QHLEM PDEFYCK+LLE TGICTVPGSGFGQ PGTYHLRTTFL PGTEW+E W+ FH+ F
Sbjct: 503  QHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFHQDF 562

Query: 1567 FDKYRD 1584
            ++ YRD
Sbjct: 563  YNTYRD 568

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
            Anc_8.263 YDR111C
          Length = 588

 Score =  733 bits (1893), Expect = 0.0
 Identities = 355/486 (73%), Positives = 420/486 (86%), Gaps = 2/486 (0%)
 Frame = +1

Query: 133  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 312
            PA +L+L D+NENVLKAKYAVRG IPMRAEEL+ QL+ +PS+LPFS+I++ANIGNPQQL 
Sbjct: 103  PAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLK 162

Query: 313  QKPLTFYREVLSLLQHPELLEEADEAL--QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 486
            QKPL+FYR+VLS+LQ+P++L+E ++ L    +YK D+I RAK LLSE+GGSVGAYS SQG
Sbjct: 163  QKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSASQG 222

Query: 487  VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 666
            V GIR+TVA+FIT+RD GE +YPEDI+LT        Y+LSILC+GP TGVLIPIPQYPL
Sbjct: 223  VYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPL 282

Query: 667  YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 846
            YTA+LALNNS  LPYYL E+  WST+P+EIE+VV DA+++ I P+ LVVINPGNPTGA+L
Sbjct: 283  YTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVL 342

Query: 847  SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 1026
            +E+SI+ IFE+AAKYGIVVIADEVYQEN+  G KFYSMKKVLR LQK++ G++DN+QLAS
Sbjct: 343  TEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLAS 402

Query: 1027 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 1206
            LHSTSKGVSGECGQRGGYMEL+GF H++R+V LKLASISLCPVVTGQALVDLMVSPP+ G
Sbjct: 403  LHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPKKG 462

Query: 1207 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 1386
            D SYEQDQ ER  I   L  RAS+L+ETF  LEGIEC+KPQGAMYL+PKLDLP+K +QEA
Sbjct: 463  DASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEA 522

Query: 1387 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 1566
            QHLEM PDEFYCK+LL+ TGICTVPGSGFGQ PGTYHLRTTFL PGTEW++ WE FHK F
Sbjct: 523  QHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHKEF 582

Query: 1567 FDKYRD 1584
            +D YRD
Sbjct: 583  YDNYRD 588

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
            {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
            YLR089c
          Length = 574

 Score =  728 bits (1880), Expect = 0.0
 Identities = 359/520 (69%), Positives = 427/520 (82%), Gaps = 4/520 (0%)
 Frame = +1

Query: 37   SSGMIRVNAPALKSTMPSVTSLTQLRFST----TVKPAPKLSLDDVNENVLKAKYAVRGR 204
            SS  +R ++ A  S++ S    T++   +       PA + +L DVNE VL AKYAVRG 
Sbjct: 55   SSPNLRFHSSASSSSLRSSFLNTEIHHHSHNNLPFLPAEQATLKDVNECVLNAKYAVRGA 114

Query: 205  IPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEAD 384
            IPMRAEEL+ QL ++P SLPF+ II+ANIGNPQQL QKPL+FYR+VLSLLQ+PEL+   +
Sbjct: 115  IPMRAEELKTQLMENPHSLPFNDIINANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLE 174

Query: 385  EALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDI 564
               QT+ K D+I RAKRLL ++GGSVGAYS SQGV GIR+TVADFIT RDDG I+YPEDI
Sbjct: 175  NNPQTMIKQDAIDRAKRLLDDIGGSVGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDI 234

Query: 565  YLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTD 744
            +LTAGAS+AV Y+LSI C+G  TGVLIPIPQYPLYTA+LAL NS  LPYYL EE  WSTD
Sbjct: 235  FLTAGASSAVDYLLSIFCRGEETGVLIPIPQYPLYTATLALQNSHALPYYLNEETGWSTD 294

Query: 745  PEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQ 924
            PEE+E ++LD+I+  IKP+ LVVINPGNPTGA+LSE++I++IF +AAKYGI+VIADEVYQ
Sbjct: 295  PEELESIILDSIENNIKPSVLVVINPGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQ 354

Query: 925  ENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNH 1104
            ENVF+  KF+SMKKVLR LQ    G YDN+QLASLHSTSKGVSGECGQRGGYMELVGF H
Sbjct: 355  ENVFEDVKFHSMKKVLRQLQMKQPGLYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTH 414

Query: 1105 DIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLF 1284
            DIRQV LKLASISLCPVVTGQALVDLMV PPQ G+ESYEQDQ+ER +IH  L +RA+ L 
Sbjct: 415  DIRQVVLKLASISLCPVVTGQALVDLMVCPPQKGEESYEQDQEERRNIHKELHKRATLLH 474

Query: 1285 ETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPG 1464
            + F +L+GI C+KPQGAMYL+PKL+LPYK IQEA H +M PDEFYCK+LLE TGICTVPG
Sbjct: 475  DAFVKLDGISCQKPQGAMYLFPKLELPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPG 534

Query: 1465 SGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 1584
            SGFGQ PGTYHLRTTFL PGT+W+E W  FH+ F++K+++
Sbjct: 535  SGFGQEPGTYHLRTTFLAPGTKWIEDWVDFHQEFYNKFKN 574

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
            [1539 nt, 513 aa]
          Length = 512

 Score =  702 bits (1812), Expect = 0.0
 Identities = 345/496 (69%), Positives = 410/496 (82%)
 Frame = +1

Query: 97   SLTQLRFSTTVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKI 276
            S T       V PA KL +DD+N+NVLKAKYAVRG IP+RAEEL+  L+     LPF  +
Sbjct: 23   STTLYEHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTV 81

Query: 277  ISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADEALQTLYKTDSIKRAKRLLSEVGG 456
            I+ANIGNPQQL QKPLTFYR+VLS+LQ+PELLE        ++K D+I+RA++LL E+G 
Sbjct: 82   INANIGNPQQLKQKPLTFYRQVLSILQYPELLESGSN----IFKKDAIERARKLLKEIG- 136

Query: 457  SVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTG 636
            SVG+YS SQG+  IR+TVA+FITKRDDGEIS P DI+LTAGAS+AV Y+LSILCK   +G
Sbjct: 137  SVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSG 196

Query: 637  VLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVI 816
            VLIPIPQYPLYTA+LALNN+  LPYYL E + WSTD  EIE+V+ D++ KGIKPT LV+I
Sbjct: 197  VLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVII 256

Query: 817  NPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYH 996
            NPGNPTG+ILS +S++KI EVAA +GIV+IADEVYQENVF  +KF+SMKKVLRNLQK + 
Sbjct: 257  NPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFP 316

Query: 997  GQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALV 1176
            G+YD +QLASLHSTSKGVSGECGQRGGYMEL GFN +I+QV LKL SISLCPVVTGQALV
Sbjct: 317  GEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALV 376

Query: 1177 DLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKL 1356
            DLMVSPPQ GDESYEQDQ ER  I + L  RA  L+E F+ +EG+ C+KP+GAMYL+PK+
Sbjct: 377  DLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKI 436

Query: 1357 DLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWV 1536
            DLP+KV+Q++Q L++ PDEFYCKALLE TGICTVPGSGFGQ PGTYHLRTTFL PGTEW+
Sbjct: 437  DLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWI 496

Query: 1537 ETWEKFHKAFFDKYRD 1584
            + W KFH  F+DKYRD
Sbjct: 497  DRWNKFHAEFYDKYRD 512

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
            Anc_8.263 YDR111C
          Length = 539

 Score =  700 bits (1807), Expect = 0.0
 Identities = 339/485 (69%), Positives = 408/485 (84%), Gaps = 2/485 (0%)
 Frame = +1

Query: 130  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 309
            KPA +L++ D+NENVLKAKYAVRG+IP RAEEL+ QL + P+SLPF KII+ANIGNPQQL
Sbjct: 53   KPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGNPQQL 112

Query: 310  DQKPLTFYREVLSLLQHPELLE--EADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQ 483
             Q+PL+FYR+VLSLLQ+P LL   E       +YK D+I RAK++L ++GGSVGAYS+SQ
Sbjct: 113  QQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAYSESQ 172

Query: 484  GVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYP 663
            GV GIR TVA+FIT+RD GE +YPEDI+LTAGASAAV+Y+LSILCKG  TGVLIPIPQYP
Sbjct: 173  GVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPIPQYP 232

Query: 664  LYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAI 843
            LYTA+LALNNS  LPY+L E   WS +P EIE V+  A+Q  IKP  LVVINPGNPTGA+
Sbjct: 233  LYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNPTGAV 292

Query: 844  LSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLA 1023
            LS+++I  I E+AAKYGIVVIADEVYQEN+F G KF+S+K VLR LQ+   G++DN+QLA
Sbjct: 293  LSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDNVQLA 352

Query: 1024 SLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQP 1203
            SLHSTSKGVSGECGQRGGYME++GF H++RQV LKLASISLCPVVTGQALVDLMVSPP+ 
Sbjct: 353  SLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVSPPKR 412

Query: 1204 GDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQE 1383
            G+ES+  DQ +R+ IH  L +RA  L++TF+ L+GIEC+KP GAMYL+PKL+LPY+ IQE
Sbjct: 413  GEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYRAIQE 472

Query: 1384 AQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKA 1563
            AQ LE+ PDEFYCK LLE+TGICTVPGSGFGQV GTYHLRTTFL PG EW+++W++FH  
Sbjct: 473  AQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQFHIE 532

Query: 1564 FFDKY 1578
            F +KY
Sbjct: 533  FMEKY 537

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
            Anc_8.263 YDR111C
          Length = 522

 Score =  684 bits (1764), Expect = 0.0
 Identities = 329/486 (67%), Positives = 410/486 (84%), Gaps = 1/486 (0%)
 Frame = +1

Query: 130  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 309
            KPA KL+++D+NENVLKAKYAVRG+IP RAE L+ QL  +PSSLPF K+I+ANIGNPQQL
Sbjct: 37   KPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQL 96

Query: 310  DQKPLTFYREVLSLLQHPELLEEADEA-LQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 486
            +QKPLTFYR+VLSLLQ+P +L+E      +TLYK D+I+RAKR+L+++G SVG+YS SQG
Sbjct: 97   NQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIGSSVGSYSSSQG 156

Query: 487  VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 666
            V G+R+TVA++I++RD GE +Y EDI+LTAGAS+AVSY+L+ILCKG  +GVLIPIPQYPL
Sbjct: 157  VFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYPL 216

Query: 667  YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 846
            YTA+LALNN+  LPYYL E   WST+ EEIE VV +AI++ I P  LVVINPGNPTGAIL
Sbjct: 217  YTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAIL 276

Query: 847  SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 1026
            S +SI+KIF+VAA +GIVVIADEVYQEN+F G++F+SMKKVLR+LQ+   G+Y+N+QLAS
Sbjct: 277  SVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYENVQLAS 336

Query: 1027 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 1206
            LHSTSKGVSGECGQRGGYMEL GF+ +I+   LKL SISLCPVVTGQALVDLM  PP+ G
Sbjct: 337  LHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPKKG 396

Query: 1207 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 1386
            + SYEQDQ ER  IH  L ERA+ L++ F+ +EG+ C+KPQG+MYL+PK+D+P+K +++A
Sbjct: 397  EASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALEKA 456

Query: 1387 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 1566
            Q L++ PDE YC  LLE TGICTVPGSGFGQ PGT+HLRTTFL PGT W++ W +FH+ F
Sbjct: 457  QELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQIF 516

Query: 1567 FDKYRD 1584
             +KYRD
Sbjct: 517  CNKYRD 522

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
            Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  680 bits (1755), Expect = 0.0
 Identities = 335/519 (64%), Positives = 418/519 (80%), Gaps = 2/519 (0%)
 Frame = +1

Query: 34   ISSGMIRVNAPALKSTMPSVTSLTQLRFSTTVKP-APKLSLDDVNENVLKAKYAVRGRIP 210
            +S  +IR + P  +  +  +++   LR   + KP   K +L D+NE VL AKYAVRG IP
Sbjct: 2    LSRPIIR-SMPHSRLVLRHLSTRPGLRKDYSQKPLGSKKTLQDINECVLNAKYAVRGLIP 60

Query: 211  MRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADEA 390
            +RAEEL+ +L ++P SLPF KII+ANIGNPQQLDQKPLTFYR+VL+LLQ+P+L+ +    
Sbjct: 61   LRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFYRQVLALLQNPDLISDLSSG 120

Query: 391  -LQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIY 567
             L   +K D+++RAK++L +VGGSVGAYS SQGV G RE+VA+FI +RD GE +  +DI+
Sbjct: 121  ELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIF 179

Query: 568  LTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDP 747
            LT GAS AVSYILS+ C GP  G LIPIPQYPLYTASLALNNS  LPYYL EE  WS D 
Sbjct: 180  LTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDT 239

Query: 748  EEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQE 927
            E+IE+VV D+I+KGI+PTCLVVINPGNPTGA+L+  +I+ + +VAAKY +V+IADEVYQE
Sbjct: 240  EQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQE 299

Query: 928  NVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHD 1107
            N F  ++F SMKKVLR LQKT  G+YDN+QLASLHSTSKGVSGECGQRGGYMELVGF+ +
Sbjct: 300  NGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEE 359

Query: 1108 IRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFE 1287
            ++QVFLKLASISLCPVVTGQAL+DLMV PP+ GD SYEQD+QER DIHDAL +R+  L++
Sbjct: 360  VKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQ 419

Query: 1288 TFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGS 1467
             F  +EG+ C++PQGAMYL+PKL+L  K I +A+   + PDE+YCK LLE TGICTVPGS
Sbjct: 420  AFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGS 479

Query: 1468 GFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 1584
            GFGQVPGT+HLRTTFL PGTEW+++W+KFH+ F + +RD
Sbjct: 480  GFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHRD 518

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
            to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
            putative alanine transaminase (glutamyc pyruvic
            transaminase)
          Length = 519

 Score =  677 bits (1746), Expect = 0.0
 Identities = 335/482 (69%), Positives = 402/482 (83%), Gaps = 1/482 (0%)
 Frame = +1

Query: 142  KLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKP 321
            K +L DVN+ VL AKYAVRG IP+RAEELR +L ++P SLPF+KII+ANIGNPQQLDQKP
Sbjct: 39   KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKP 98

Query: 322  LTFYREVLSLLQHPELLEEADEA-LQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGI 498
            LTFYR+VLSLLQ+P L+E      L  L+K D+++RAK++L +VGGSVGAYS SQGV G 
Sbjct: 99   LTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGF 158

Query: 499  RETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTAS 678
            R++VA+FI +RD GE +   DI+LTAGAS+AVS ILS+ C G   G LIPIPQYPLYTA+
Sbjct: 159  RQSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTAT 217

Query: 679  LALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQS 858
            LALN++  LPYYL E   WS D E++EQVV DAI+KG++PTCLVVINPGNPTGAILS ++
Sbjct: 218  LALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEA 277

Query: 859  IQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHST 1038
            I+KI  VAAKY +VVIADEVYQEN F  + F SMKKVLR LQKT  G+YDN+QLASLHST
Sbjct: 278  IEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHST 337

Query: 1039 SKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESY 1218
            SKGVSGECGQRGGYMELVGF+ +++QVFLKLASISLCPVVTGQALVDLMV PP+ GD SY
Sbjct: 338  SKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASY 397

Query: 1219 EQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLE 1398
            E D+QER  IH++L ++++ L+ETF  LEG+ C+KPQGAMYL+PKLDL  K I++A+ L 
Sbjct: 398  ELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLG 457

Query: 1399 MEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKY 1578
            M PDE+YCK LLE TGICTVPGSGF QVPGTYHLRTTFL PGTEWV++W+KFH+ F D++
Sbjct: 458  MAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEH 517

Query: 1579 RD 1584
            RD
Sbjct: 518  RD 519

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
            YDR111C
          Length = 497

 Score =  674 bits (1738), Expect = 0.0
 Identities = 323/486 (66%), Positives = 402/486 (82%), Gaps = 1/486 (0%)
 Frame = +1

Query: 130  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 309
            +PAPKLSL D+NENV+ AK+A+RG I ++AE+L+ QL K+P  LPF +I  ANIGNPQ+L
Sbjct: 12   QPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQEL 71

Query: 310  DQKPLTFYREVLSLLQHPELLEEADEAL-QTLYKTDSIKRAKRLLSEVGGSVGAYSQSQG 486
            +QKPLTF R+V+S+LQ+PELL   D    + ++ +DS  RA+RLL ++GGSVGAYS SQG
Sbjct: 72   NQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQG 131

Query: 487  VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 666
            V GIR+T A++ITKRD GE SYPEDI+LT GA++A SY+LS+LC+GP TGVLIPIPQYPL
Sbjct: 132  VYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPL 191

Query: 667  YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 846
            YTA+LALN S  +PYYL EE  WST+  EIE++VLD+I+KGIKP+ +VVINPGNPTGA+L
Sbjct: 192  YTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVL 251

Query: 847  SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLAS 1026
            SE +I KIF++AAKYGIVV+ADEVYQEN+F G +F+S KKVLR LQK Y G++DNIQLAS
Sbjct: 252  SELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLAS 311

Query: 1027 LHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPG 1206
            +HSTSKGV GECGQRGGYMELVGF  ++RQ+ LKLA +++C VVTGQA+VDLM+ PP+ G
Sbjct: 312  MHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKKG 371

Query: 1207 DESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEA 1386
            D SYE D++ER++I DA+ ERA KL+  F +L+GIEC+KPQGAMYLYP L L  K I +A
Sbjct: 372  DASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIAKA 431

Query: 1387 QHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAF 1566
            + L + PDEFYC  LL+ TGICTVPGSGFGQ  GTYHLRTTFL PG EW+  WEKFHK F
Sbjct: 432  ESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHKHF 491

Query: 1567 FDKYRD 1584
            ++KY+D
Sbjct: 492  YEKYQD 497

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
            YDR111C (REAL)
          Length = 507

 Score =  668 bits (1723), Expect = 0.0
 Identities = 321/487 (65%), Positives = 403/487 (82%), Gaps = 2/487 (0%)
 Frame = +1

Query: 130  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 309
            KPA K++  D+N +V KA+YAVRG IP RA+EL+++LKK+P  LPF  II+ANIGNPQQL
Sbjct: 21   KPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQL 80

Query: 310  DQKPLTFYREVLSLLQHPELLEEADEALQTL--YKTDSIKRAKRLLSEVGGSVGAYSQSQ 483
            DQKPLTF R+VLS+L++PE+L+   E L +L  +  D++KRA+ LL ++GGSVGAYS SQ
Sbjct: 81   DQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSHSQ 140

Query: 484  GVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYP 663
            GV GIR+TVADFIT RD GE + PEDIYLT GAS+A + +LS+LCK   TG+LIPIPQYP
Sbjct: 141  GVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIPQYP 200

Query: 664  LYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAI 843
            LYTAS +L N++ LPYYL EE NWST+ +EIE+VV DA++KGI+P+ L+VINPGNPTGA+
Sbjct: 201  LYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAV 260

Query: 844  LSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLA 1023
            L+E++I +I  +AAKYGI VI+DEVYQENVF   KF+SMKKVLR LQ  Y G++DN+QLA
Sbjct: 261  LTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLA 320

Query: 1024 SLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQP 1203
            SLHS SKG  GECGQRGGYME+VGF+ DIR    KL SIS+C VVTGQA+VDLMV+PPQP
Sbjct: 321  SLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQP 380

Query: 1204 GDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQE 1383
            GDESYEQD+QER  I + +  RA+ L+ETF+ LEGIEC+ PQGAMYL+P+L LP K  +E
Sbjct: 381  GDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAFRE 440

Query: 1384 AQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKA 1563
            ++ L +EPDEFYC +LLE+TGICTVPGSGFGQ PGTYH+RTTFL PGT+W++ W+ FH++
Sbjct: 441  SERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFHQS 500

Query: 1564 FFDKYRD 1584
            FF++YRD
Sbjct: 501  FFNEYRD 507

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
            YDR111C (REAL)
          Length = 507

 Score =  662 bits (1708), Expect = 0.0
 Identities = 322/503 (64%), Positives = 403/503 (80%), Gaps = 2/503 (0%)
 Frame = +1

Query: 82   MPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSL 261
            + SV +   L F    KPA K++  D+N  V KA+YAVRG IP RA+EL+++LK+ P  L
Sbjct: 9    LKSVFTTKDLNF----KPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVL 64

Query: 262  PFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADEALQTL--YKTDSIKRAKR 435
            PF  II+ANIGNPQQLDQKPLTF R+VLS+L++PE+L    + L +L  ++ D++ RA+ 
Sbjct: 65   PFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEH 124

Query: 436  LLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSIL 615
            LL ++GGS+GAYS SQGV GIR++VA+FITKRDDGE + PE+IYLT GAS+A + +LS+L
Sbjct: 125  LLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLL 184

Query: 616  CKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIK 795
            CK   TG+LIPIPQYPLYTAS +L N++ LPYYL E  NWST  +EIE+VV DA++KGIK
Sbjct: 185  CKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIK 244

Query: 796  PTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLR 975
            P+ L+VINPGNPTGA+LSE +I KI  +AAKYGI +I+DEVYQENVF G KF+SMKKVLR
Sbjct: 245  PSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLR 304

Query: 976  NLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPV 1155
             LQ+ Y G++DN+QLASLHS SKG  GECGQRGGYME+VGF+ DIR    KL SIS+C V
Sbjct: 305  KLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSV 364

Query: 1156 VTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGA 1335
            VTGQA+VDLMV PPQPGDESY+QD  ER  I   +  RA+ L ETF+ LEGIEC+KPQGA
Sbjct: 365  VTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGA 424

Query: 1336 MYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFL 1515
            MYL+P+L LP K ++E++ L +EPDEFYC +LLE+TGICTVPGSGFGQ PGTYH+RTTFL
Sbjct: 425  MYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFL 484

Query: 1516 PPGTEWVETWEKFHKAFFDKYRD 1584
             PGT+W++ W+ FH+ FF+KYRD
Sbjct: 485  APGTQWIQDWKHFHQDFFNKYRD 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
            YDR111C (REAL)
          Length = 507

 Score =  661 bits (1706), Expect = 0.0
 Identities = 315/487 (64%), Positives = 403/487 (82%), Gaps = 2/487 (0%)
 Frame = +1

Query: 130  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 309
            KPA KL+  D+N +V KA+YAVRG IP RAEEL+++LK+  +SLPF+ II+ANIGNPQQL
Sbjct: 21   KPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQQL 80

Query: 310  DQKPLTFYREVLSLLQHPELLEEADEALQTL--YKTDSIKRAKRLLSEVGGSVGAYSQSQ 483
            DQKPLTF R+VLS+L++PE+L    + L +L  +  D++KRA+RLL ++GGSVGAYS SQ
Sbjct: 81   DQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSHSQ 140

Query: 484  GVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYP 663
            GV GIR+TVADFIT+RD GE + PEDIYLT GAS+A + +LS+LCK   TG+L+PIPQYP
Sbjct: 141  GVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLLPIPQYP 200

Query: 664  LYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAI 843
            LYTAS +L N++ LPYYL EE +WST+ +EIE+VVLDA++KGI+P+ LVVINPGNPTGA+
Sbjct: 201  LYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAV 260

Query: 844  LSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLA 1023
            L+E +I KI  +AAKYGI +I+DEVYQEN+F   KF+SMKK+LR LQ  + G++DN+QLA
Sbjct: 261  LTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLA 320

Query: 1024 SLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQP 1203
            SLHS SKG  GECGQRGGYME+VGF+ DIR    KL SIS+C V TGQA++DLMV PPQP
Sbjct: 321  SLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQP 380

Query: 1204 GDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQE 1383
            GDESY+QD++ER  I++ +  RA+ L+ETF+ LEGI+C+KPQGAMYL+PKL LP K ++E
Sbjct: 381  GDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKALRE 440

Query: 1384 AQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKA 1563
            ++ L +EPD  YC +LLE+TGICTVPGSGFGQ  GTYH+RTTFLPPGT+W++ W +FH+ 
Sbjct: 441  SERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFHQD 500

Query: 1564 FFDKYRD 1584
            FF+KYRD
Sbjct: 501  FFNKYRD 507

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
            YDR111C
          Length = 521

 Score =  660 bits (1703), Expect = 0.0
 Identities = 316/487 (64%), Positives = 403/487 (82%), Gaps = 2/487 (0%)
 Frame = +1

Query: 130  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 309
            +PA KL  DD+N+N++ A+YAVRG IPM+AEEL  QL + P  LPF+ I  ANIGNPQQL
Sbjct: 35   EPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQL 94

Query: 310  DQKPLTFYREVLSLLQHPELLEEADEALQT-LYKTDSIKRAKRLLSEVGGSVGAYSQSQG 486
            DQKPLTF R+V+S+LQ+P LL+  ++ + +  YK D+ KRA  LL ++GGSVGAYS +QG
Sbjct: 95   DQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQG 154

Query: 487  VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 666
            V GIRE+VADFIT+RD+GE + P+DI+LT GAS A +Y+LSILC+  +TG++IPIPQYPL
Sbjct: 155  VYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPL 214

Query: 667  YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 846
            YTAS+ + NS  LPYYL EE  WST  EEIEQ V+D+I++G+ P  +VVINPGNPTGA+L
Sbjct: 215  YTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVL 274

Query: 847  SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTY-HGQYDNIQLA 1023
            S  +I +I  +AAKYGIVV+ADEVYQ N++KG KF+SMKKVLR+LQ+ + +G+YDN+QLA
Sbjct: 275  SFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLA 334

Query: 1024 SLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQP 1203
            S+HSTSKGVSGECGQRGGYMELVGF++++RQV LKLASIS+C VVTGQALVDLM++PP+ 
Sbjct: 335  SMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPRE 394

Query: 1204 GDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQE 1383
            GD+SYE D +ER++IH+ +  R   L++TF +LEGIEC++PQGAMYL+PKL L  K I+E
Sbjct: 395  GDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEE 454

Query: 1384 AQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKA 1563
            A+ L ++PDEFYC  LL+ TGICTVPGSGFGQ  GTYH+RTTFL PGT+W++ WE FHKA
Sbjct: 455  AKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKA 514

Query: 1564 FFDKYRD 1584
            F+DKYRD
Sbjct: 515  FYDKYRD 521

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YLR089C (ALT1) and YDR111C
            (ALT2)
          Length = 521

 Score =  659 bits (1699), Expect = 0.0
 Identities = 324/519 (62%), Positives = 404/519 (77%), Gaps = 5/519 (0%)
 Frame = +1

Query: 43   GMIRVNAPA-----LKSTMPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLKAKYAVRGRI 207
            GM+R N+       L+  +     L+ ++  +   PA  ++L DVNENV+KAKYAVRG+I
Sbjct: 4    GMLRRNSSGTAVSVLQGRVLRTRRLSSVKDGSRFVPAEPMTLADVNENVVKAKYAVRGKI 63

Query: 208  PMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADE 387
            P RAEEL  +L++ P SLPFSKII ANIGNPQQL QKPLTFYR+V+SL+Q+P+LLE   E
Sbjct: 64   PTRAEELERRLEEHPGSLPFSKIIQANIGNPQQLGQKPLTFYRQVISLMQNPQLLEMPAE 123

Query: 388  ALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIY 567
             LQ  +K D + RA+R+L + GGSVGAYS SQGV+G R TVA FI +RD G  + P+++Y
Sbjct: 124  WLQQAFKADVVVRARRMLQDAGGSVGAYSASQGVKGYRRTVAQFIERRD-GIPANPDNVY 182

Query: 568  LTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDP 747
            LTAGAS+AVS +LS  CKGP TGVLIPIPQYPLYTA++  NN+  LPYYL E   WST+P
Sbjct: 183  LTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYTATITQNNAVALPYYLNEADGWSTNP 242

Query: 748  EEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQE 927
            +E+E+V+LD+ ++ I P CLVVINPGNPTG++LS + ++ I  +AAKYGIVVIADEVYQ+
Sbjct: 243  DEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQD 302

Query: 928  NVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHD 1107
            NVF  +KF+SM+KVL+NLQ      Y N+QLASLHS SKG+SGECGQRGGYMEL+GF  +
Sbjct: 303  NVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLHSISKGLSGECGQRGGYMELIGFREE 362

Query: 1108 IRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFE 1287
            +R+VF+KLASISLCPVVTGQALVDLMV PP  GD SYEQ  QE   I+  L+ER+  L++
Sbjct: 363  LRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWK 422

Query: 1288 TFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGS 1467
            TF  LEGIEC  PQGA+YL+PKL LP K I+ AQ L +  DE YC  LL+ TGICTVPG+
Sbjct: 423  TFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQKLGIPADELYCSELLDETGICTVPGT 482

Query: 1468 GFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYRD 1584
            GFGQ+PGTYH+RTTFLPPGT+W+E+W+ FHK F+DKYRD
Sbjct: 483  GFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYDKYRD 521

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
            Ashbya gossypii AGR085W
          Length = 534

 Score =  657 bits (1695), Expect = 0.0
 Identities = 315/485 (64%), Positives = 393/485 (81%)
 Frame = +1

Query: 130  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 309
            +P   L L+D+N NVL+AKYAVRG+IP RA EL  QL +DP SLPF KII ANIGNPQQL
Sbjct: 51   EPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQL 110

Query: 310  DQKPLTFYREVLSLLQHPELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGV 489
             QKPL+F REVLSLL+ P LL+   E L  +YK D+++RAKR++ ++  S+GAYS SQGV
Sbjct: 111  GQKPLSFSREVLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGV 170

Query: 490  QGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLY 669
             G R+TVA++++ RD GE +  EDI+LT GAS   S ++ +LCKG  +GVLIPIPQYPLY
Sbjct: 171  LGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLY 229

Query: 670  TASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILS 849
            TA++ LNN+  LPYYL EE  WS + +++E++++++I+KG+KP CLVVINPGNPTGAIL 
Sbjct: 230  TATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILP 289

Query: 850  EQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASL 1029
             +S+++IF +AAKY IVVIADEVYQENVF+G KFYSMKKVLR+LQ+ Y   + N+QL SL
Sbjct: 290  VESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSL 349

Query: 1030 HSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGD 1209
            HSTSKG+SGECGQRGGYMELVGF+ DIR+V LK+ASI LC  V GQALVDLM+S P+PGD
Sbjct: 350  HSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGD 409

Query: 1210 ESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQ 1389
            ESYE+D  ER  I +AL ER+  L+ETF+ LEG+ECRKPQG+MYL+P+L LP K I+ A+
Sbjct: 410  ESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAAE 469

Query: 1390 HLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFF 1569
             L+M+PDEFYC  LL +TGICTVPGSGFGQ P T HLRTTFL PGTEW+E+WE FHK+F+
Sbjct: 470  SLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSFY 529

Query: 1570 DKYRD 1584
            DKYRD
Sbjct: 530  DKYRD 534

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
            ALT2Putative alanine transaminase (glutamic pyruvic
            transaminase)
          Length = 507

 Score =  654 bits (1688), Expect = 0.0
 Identities = 313/487 (64%), Positives = 396/487 (81%), Gaps = 2/487 (0%)
 Frame = +1

Query: 130  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 309
            KPA K++  D+N  V KA+YAVRG IP RA+EL+++LKK+P  LPF  II+ANIGNPQQL
Sbjct: 21   KPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQL 80

Query: 310  DQKPLTFYREVLSLLQHPELLEEADEALQTL--YKTDSIKRAKRLLSEVGGSVGAYSQSQ 483
            DQKPLTF R+VL++L++PE+L      L +L  +  D+++RA+RLL+++GGS+GAYS SQ
Sbjct: 81   DQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHSQ 140

Query: 484  GVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYP 663
            GV GIR+TVADFIT+RD GE + PEDIYLT GAS+A + +LS+LCK   TG+LIPIPQYP
Sbjct: 141  GVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQYP 200

Query: 664  LYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAI 843
            LYTAS +L N++ LPYYL EE NWST+ +EIE+VV DA++K I+P+ L+VINPGNPTGA+
Sbjct: 201  LYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAV 260

Query: 844  LSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLA 1023
            LSE++I +I  +AAKYGI +I+DEVYQEN+F   KF+SMKKVLR LQ  Y G++DN+QLA
Sbjct: 261  LSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLA 320

Query: 1024 SLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQP 1203
            SLHS SKG   ECGQRGGYME++GF+ +IR    KL SIS+C VVTGQA+VDLMV PPQP
Sbjct: 321  SLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQP 380

Query: 1204 GDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQE 1383
            GDESYEQD  ER  I   +  RA+ L+ETF  LEGIEC+KPQGAMYL+P+L LP K + E
Sbjct: 381  GDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALCE 440

Query: 1384 AQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKA 1563
            ++ L +EPDEFYC +LLE+TGICTVPGSGFGQ PGTYH+RTTFL PGT+W++ W++FH+ 
Sbjct: 441  SERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFHQD 500

Query: 1564 FFDKYRD 1584
            FF KYR+
Sbjct: 501  FFSKYRN 507

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  654 bits (1687), Expect = 0.0
 Identities = 314/487 (64%), Positives = 395/487 (81%), Gaps = 4/487 (0%)
 Frame = +1

Query: 130  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 309
            +PAPKLS+ D+N NV+KA++AVRG IPM+A+EL+ QL K+P SLPF++I  ANIGNPQ+L
Sbjct: 14   EPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQEL 73

Query: 310  DQKPLTFYREVLSLLQHPELLEEADEALQT---LYKTDSIKRAKRLLSEVGGSVGAYSQS 480
             QKPLTF R+V+S+LQ+PELL   +E   T   +Y  DS  RA++LL+E+GGSVGAYS S
Sbjct: 74   HQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSAS 133

Query: 481  QGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQY 660
            QGV GIR+T+A++IT+RD GE + P DI++T GA+AA SY+LSIL  GP TGVL+PIPQY
Sbjct: 134  QGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQY 193

Query: 661  PLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVL-DAIQKGIKPTCLVVINPGNPTG 837
            PLYTA LAL+N+  LPYYL EE  WS D  EIE+ +  +A+ KGI+P  +V+INPGNPTG
Sbjct: 194  PLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPTG 253

Query: 838  AILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQ 1017
            +ILSE S+ KIF +AAKYGIV+IADEVYQEN+F G+KF+S KKVLR+LQK +  QY+N+Q
Sbjct: 254  SILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYNNVQ 313

Query: 1018 LASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPP 1197
            LASLHSTSKG+ GECGQRGGYME++GFN+D+R + LKLA I +CPVVTGQA++DLM+ PP
Sbjct: 314  LASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMILPP 373

Query: 1198 QPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVI 1377
            + GD+SY+ D  ER+ IH+ +  RA KL++ FS +EGI+C+KPQGAMYL+P+L L  KVI
Sbjct: 374  KQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTKVI 433

Query: 1378 QEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFH 1557
             EA+  EMEPDEFYC  LL  TGICTVPGSGFGQ P TYHLRTTFL PG +W+  WEKFH
Sbjct: 434  DEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEKFH 493

Query: 1558 KAFFDKY 1578
            KAF  +Y
Sbjct: 494  KAFLKRY 500

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  654 bits (1686), Expect = 0.0
 Identities = 322/487 (66%), Positives = 394/487 (80%), Gaps = 3/487 (0%)
 Frame = +1

Query: 130  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSS--LPFSKIISANIGNPQ 303
            KPA K++LDD+N+NVLK++YAVRG IP RAEEL  +L  + SS  L F  I+ ANIGNPQ
Sbjct: 29   KPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGNPQ 88

Query: 304  QLDQKPLTFYREVLSLLQHPELLEEADEALQT-LYKTDSIKRAKRLLSEVGGSVGAYSQS 480
            QLDQKPLTF R+V+S+LQ+PELL + +  + T ++K+D+++RA+ LL  +GGSVGAYS S
Sbjct: 89   QLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAYSSS 148

Query: 481  QGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQY 660
            QGV GIRETVA++IT RD+GE + P+DI+LT GAS A SY+LS+LCK  NTGVLIPIPQY
Sbjct: 149  QGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPIPQY 208

Query: 661  PLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGA 840
            PLYTA++ L +++ LPYYL EE  WST+  EIE+VVLDAI   +KP+ +VVINPGNPTG+
Sbjct: 209  PLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNPTGS 268

Query: 841  ILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQL 1020
            +LS+  I  I  + AKYGIV+IADEVYQEN+F G +F+SMKKVLR+LQK Y G+YD +QL
Sbjct: 269  VLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDAVQL 327

Query: 1021 ASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQ 1200
            ASLHSTSKGVSGECGQRGGYMELVGF  +IRQ  LKLASISLC V+TGQALVDLMV+PP+
Sbjct: 328  ASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVNPPK 387

Query: 1201 PGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQ 1380
             GDESYE D  ER++IH+ L ERA KL+  F +L+G+EC+KPQGAMYL+PKL  P  +I 
Sbjct: 388  KGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQTLIT 447

Query: 1381 EAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHK 1560
            EA +  M PDEFYC ALLE TGICTVPGSGFGQ  GTYHLRTTFL PG +W E W+ FH+
Sbjct: 448  EAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKLFHE 507

Query: 1561 AFFDKYR 1581
             FF KY+
Sbjct: 508  EFFSKYQ 514

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8.263
            YDR111C
          Length = 510

 Score =  652 bits (1683), Expect = 0.0
 Identities = 322/511 (63%), Positives = 406/511 (79%), Gaps = 11/511 (2%)
 Frame = +1

Query: 82   MPSVTSLTQLRFSTTV--------KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQ 237
            MP +TS T    +T          +PAPK+S+ D+N+ ++ A+YAVRG I MRAEEL  +
Sbjct: 1    MPPITSSTSGTSNTPTSDSNTHDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFE 60

Query: 238  L--KKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADEAL-QTLYK 408
            L  K  P S PF +II ANIGNPQQLDQKPLTF R+V+S+L++P LL+  D  L Q +YK
Sbjct: 61   LYHKTQPHSFPFERIIYANIGNPQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYK 120

Query: 409  TDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASA 588
             D+++RA+ L S++G SVGAYS +QGV GIRET A FI+KRD+ E +  +DI+LT GAS 
Sbjct: 121  KDALERAELLQSQIGASVGAYSLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASK 180

Query: 589  AVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVV 768
            AV+Y++  LC+  +TG+LIPIPQYPLYTAS+ ++N++ LPYYL EE  WST  EEIE  V
Sbjct: 181  AVTYLMMALCQNEHTGILIPIPQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSV 240

Query: 769  LDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSK 948
            ++AI+ GIKP+ +VVINPGNPTGA+LS   IQ+I  VAAKYGIV+IADEVYQ+N+F G +
Sbjct: 241  INAIENGIKPSAMVVINPGNPTGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-E 299

Query: 949  FYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLK 1128
            F+SMKK+LR LQK Y G+YDN+QLASLHSTSKGVSGECGQRGGYME+VGF+ ++R + LK
Sbjct: 300  FHSMKKILRQLQKKYPGKYDNVQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLK 359

Query: 1129 LASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEG 1308
            LASI++C VVTGQALVDLMV PP  GDESYE+DQ+ER +IH  L +RA KL++TFS LEG
Sbjct: 360  LASINICSVVTGQALVDLMVDPPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEG 419

Query: 1309 IECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPG 1488
            IEC+KPQGAMYL+P+L LP + I+EA+ L+ME DEFYC  LLENTGICTVPGSGFGQ  G
Sbjct: 420  IECQKPQGAMYLFPRLILPDRAIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREG 479

Query: 1489 TYHLRTTFLPPGTEWVETWEKFHKAFFDKYR 1581
            TYH+RTTFL PGTEW++ W+KFH+ F  +Y+
Sbjct: 480  TYHVRTTFLSPGTEWIDDWKKFHEKFMKEYQ 510

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] {ON}
            Anc_8.263 YDR111C
          Length = 562

 Score =  637 bits (1644), Expect = 0.0
 Identities = 309/513 (60%), Positives = 403/513 (78%), Gaps = 4/513 (0%)
 Frame = +1

Query: 55   VNAPALKSTMPSVTSLTQLRFSTTVKP---APKLSLDDVNENVLKAKYAVRGRIPMRAEE 225
            +++ ++ S   + +  + L +ST+ +    A +L  +D+N NV+KAKYAVRG IP  A++
Sbjct: 51   ISSSSILSNSSNASVTSPLSYSTSREKSYFAERLEPEDLNPNVVKAKYAVRGAIPSYADK 110

Query: 226  LRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADEALQTL- 402
            L+ QL K P +LPF  +I++NIGNPQQL QKPL+F R+VLS+L++P LL+     + ++ 
Sbjct: 111  LKIQLLKHPGTLPFESVINSNIGNPQQLGQKPLSFGRQVLSILEYPALLDHERTLVDSMG 170

Query: 403  YKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGA 582
            Y  DSI+RAK LL+++G S+GAYS SQGV GIR+TVADFIT RDDGE++YP+DI+LTAGA
Sbjct: 171  YAPDSIERAKTLLTDIG-SIGAYSNSQGVHGIRQTVADFITNRDDGEVAYPDDIFLTAGA 229

Query: 583  SAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQ 762
            S+AVS ILSILCKG  TGVLIPIPQYPLYTA+L LN++  LPYYL E   WSTD  EI +
Sbjct: 230  SSAVSTILSILCKGQQTGVLIPIPQYPLYTATLTLNDATALPYYLDESNGWSTDINEISK 289

Query: 763  VVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKG 942
            V  D+++ GIKPTCLVVINPGNPTG++L+ ++I+ +F+VAAKYG+VVIADEVYQ+N+F G
Sbjct: 290  VAQDSLEAGIKPTCLVVINPGNPTGSVLTVEAIKNVFDVAAKYGLVVIADEVYQDNIFPG 349

Query: 943  SKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVF 1122
            S+F+SMKK+LR LQK    +YDNIQLASLHS SKG+ GECG RGGY E +GF  +++QV 
Sbjct: 350  SEFHSMKKILRILQKEVPNKYDNIQLASLHSCSKGLLGECGHRGGYCEFIGFTPEVKQVI 409

Query: 1123 LKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRL 1302
             KL+SISLC  V GQALVDLM  PP+ G+ SYE DQ ER+ I     +R++KL+E F+ L
Sbjct: 410  TKLSSISLCSSVIGQALVDLMCCPPKKGEPSYELDQHERQTIRTNHKKRSNKLYEMFNSL 469

Query: 1303 EGIECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQV 1482
            EG+ C+KPQGAMY++P + LP+  I+ AQ+L++ PDEFYC+ LL+ TGICTVPGSGFGQ 
Sbjct: 470  EGVTCQKPQGAMYMFPNIQLPFNAIKMAQNLDITPDEFYCRELLKATGICTVPGSGFGQQ 529

Query: 1483 PGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYR 1581
            PGTYH+RTTFL PG EW++ WEKFH  FF+KYR
Sbjct: 530  PGTYHVRTTFLAPGVEWMKRWEKFHIEFFEKYR 562

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
            YDR111C
          Length = 498

 Score =  635 bits (1637), Expect = 0.0
 Identities = 304/492 (61%), Positives = 385/492 (78%), Gaps = 5/492 (1%)
 Frame = +1

Query: 121  TTVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNP 300
            T   P  K++L D+N  ++K +YAVRG IP RAEEL+ QL+KDP SLPF+KII+ANIGNP
Sbjct: 7    TDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNP 66

Query: 301  QQLDQKPLTFYREVLSLLQHPELLEEADEALQTL-----YKTDSIKRAKRLLSEVGGSVG 465
            QQL QKPL+F R+VLS+LQ+P++LE+ +  LQTL     Y+ D ++RA++LL E+GGSVG
Sbjct: 67   QQLGQKPLSFIRKVLSILQYPDILED-ESKLQTLIELRVYQKDVVRRARKLLGEIGGSVG 125

Query: 466  AYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLI 645
            AYS SQGV GI++TVAD+ITKRD GE++YPEDI+LT GAS+AVS+IL + C GP TGVLI
Sbjct: 126  AYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLI 185

Query: 646  PIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPG 825
            PIPQYPLYTA++ L  +  + YYL EE NWS +  E+E  + ++I+ GIKPT +V+INPG
Sbjct: 186  PIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPG 245

Query: 826  NPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQY 1005
            NPTG+IL+E+ I  I  ++AKYG+++IADEVYQENVF G++F+S+KKVLR LQ+ Y G Y
Sbjct: 246  NPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFY 305

Query: 1006 DNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLM 1185
            + +QLASLHSTSKG+ GECGQRGGYMEL+G   D+R   +KL SIS+C VVTGQAL+D++
Sbjct: 306  ETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMV 365

Query: 1186 VSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLP 1365
            VSPP+PGDESYE DQ ER +I + L  R+ KL + F  LEG+EC +PQGAMYL+PK   P
Sbjct: 366  VSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFP 425

Query: 1366 YKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETW 1545
             K I  AQ L  E D  YCK LLE+TGICTVPGSGFGQ P TYHLRTTFL PG  W++ W
Sbjct: 426  QKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLW 485

Query: 1546 EKFHKAFFDKYR 1581
             KFH  F ++YR
Sbjct: 486  RKFHTEFCERYR 497

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
            YDR111C
          Length = 500

 Score =  633 bits (1633), Expect = 0.0
 Identities = 311/494 (62%), Positives = 387/494 (78%), Gaps = 8/494 (1%)
 Frame = +1

Query: 124  TVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQ 303
            T  PAPK SL+D+NE++LKA+YA+RG IP RAEEL  QL ++  SLPF+KI+ ANIGNPQ
Sbjct: 7    TFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQ 66

Query: 304  QLDQKPLTFYREVLSLLQHPELLEEADEAL-QTLYKTDSIKRAKRLLSEVGGSVGAYSQS 480
            QLDQ+PLTF R+V+SL+Q P+LL+  D  L Q +Y  DSI+RA +LL+ +GGSVGAYS S
Sbjct: 67   QLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSS 126

Query: 481  QGVQGIRETVADFITKRD-------DGEISYPEDIYLTAGASAAVSYILSILCKGPNTGV 639
            QGV  IR+ VA FI KRD       D       +++LTAGAS AV +IL +  K  + GV
Sbjct: 127  QGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGV 186

Query: 640  LIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVIN 819
            L+PIPQYPLYTA++ L  S+ LPYYL E  NWSTDP++IEQ+V+DAI++ IKPT LVVIN
Sbjct: 187  LLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVIN 246

Query: 820  PGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHG 999
            PGNPTGAIL++ SI  I ++AA+YGIV+IADEVYQENV++  +F+S KKVL  L+K Y  
Sbjct: 247  PGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPS 306

Query: 1000 QYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVD 1179
            +YDN+QLASLHS SKGV+GECGQRGGYME+ GF++D+++V LK+ASIS+C VVTGQ LVD
Sbjct: 307  KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVD 366

Query: 1180 LMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLD 1359
            LMV+PPQPGDESYE DQ ER  IH  L  +++ L++ F+RL GI C+KPQGAMYL+P+L 
Sbjct: 367  LMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLH 426

Query: 1360 LPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVE 1539
            L    I  A  L ++PDEFYC  LLENTGICTVPGSGFGQ PGTYHLRTTFLPPG EW+ 
Sbjct: 427  LSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWIN 486

Query: 1540 TWEKFHKAFFDKYR 1581
            +WEKFH  F +KY+
Sbjct: 487  SWEKFHLEFMEKYK 500

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
            complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  623 bits (1606), Expect = 0.0
 Identities = 300/487 (61%), Positives = 383/487 (78%), Gaps = 5/487 (1%)
 Frame = +1

Query: 133  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 312
            PA KLS++D+N++ + A YAVRG IPMRAE+L  Q+  DP SLPF KII+ANIGNPQQ+ 
Sbjct: 5    PAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQVG 64

Query: 313  QKPLTFYREVLSLLQHPELLEEAD--EALQTL--YKTDSIKRAKRLLSEVGGSVGAYSQS 480
            QKPLTF R+VLS+L++P +L + +  E L  L  Y+ D I+RA+++L  +GGSVGAYS S
Sbjct: 65   QKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYSAS 124

Query: 481  QGVQGIRETVADFITKRDD-GEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQ 657
            QGV G R+TVADFI KRD   +++ P DI+LT GAS+AV Y+LSILC GP  GVLIPIPQ
Sbjct: 125  QGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQ 184

Query: 658  YPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTG 837
            YPLYTA+L L+NS  +PYYL+E  +WST+ +EIE  + +++  G+KP  +V+INPGNPTG
Sbjct: 185  YPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTG 244

Query: 838  AILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQ 1017
            AILSE  +  I  ++AKYGI +IADEVYQEN+F G +F+SM+KVL NLQ  + G YDN+Q
Sbjct: 245  AILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQ 304

Query: 1018 LASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPP 1197
            LASLHSTSKG  GECGQRGGYMEL+GF  ++  + LKLASIS+C VVTGQAL+DL+  PP
Sbjct: 305  LASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCPP 364

Query: 1198 QPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVI 1377
            QPGD SY+ DQ+ER  I   L  RA +L+  F+ LEG+EC++PQGAMYL+PKL LP K I
Sbjct: 365  QPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDKAI 424

Query: 1378 QEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFH 1557
            ++A  LE+ PDE+YC+ LL+ TGICTVPGSGFGQ PGTYHLRTTFL PGTEW+E W +FH
Sbjct: 425  EKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWREFH 484

Query: 1558 KAFFDKY 1578
            + F++++
Sbjct: 485  QQFYERF 491

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  600 bits (1546), Expect = 0.0
 Identities = 289/493 (58%), Positives = 379/493 (76%), Gaps = 10/493 (2%)
 Frame = +1

Query: 133  PAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLD 312
            PAPK SL+D+++++L  +YA+RG IP RA+EL++QL   P+ LPF KII ANIGNPQQL+
Sbjct: 8    PAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQLE 67

Query: 313  QKPLTFYREVLSLLQHPELLEEADEALQT-LYKTDSIKRAKRLLSEVGGSVGAYSQSQGV 489
            Q+PLTF R+VLSL+++P L+   +  ++  +Y  D+IKRA+ +L+ +GGSVGAYS SQG+
Sbjct: 68   QEPLTFQRQVLSLVEYPNLVNSKNILVENKIYAPDAIKRAETILNSIGGSVGAYSSSQGI 127

Query: 490  QGIRETVADFITKRDDGEISYPED---------IYLTAGASAAVSYILSILCKGPNTGVL 642
              IR+ VA  I +RD+ E+   ++         I+LT GA+ AVSYIL +  K  N GVL
Sbjct: 128  LSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENCGVL 187

Query: 643  IPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINP 822
            +PIPQYPLYTA++ L NS+ LPYYL E++NWSTDPEEIE ++ DAI + IKPT LV+INP
Sbjct: 188  LPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVIINP 247

Query: 823  GNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQ 1002
            GNPTGAILS +SI +I  +AAKYGIV+IADEVYQ N+++  KF+S KK+L +L+  Y  +
Sbjct: 248  GNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQYPKK 307

Query: 1003 YDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDL 1182
            YDN+QLASLHS SKGV+GECGQRGGY EL+GF+ +I+++ LKLASI +C VVTGQ LVDL
Sbjct: 308  YDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQILVDL 367

Query: 1183 MVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDL 1362
            M  PP+ GD SY+ DQ+ER +I   L  +++ L++ FSRL GI C+KPQGAMYL+P+L L
Sbjct: 368  MSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFPRLHL 427

Query: 1363 PYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVET 1542
               +I EA+   +EPDEFYC  LLENTGICTVPGSGFGQ  GTYH+RTTFLP G EW++ 
Sbjct: 428  TSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIEWIKL 487

Query: 1543 WEKFHKAFFDKYR 1581
            WEKFH  F ++Y+
Sbjct: 488  WEKFHLEFMNQYK 500

>Kwal_56.23794 s56 complement(707600..707947) [348 bp, 115 aa] {OFF}
           [contig 173] FULL
          Length = 115

 Score = 73.9 bits (180), Expect = 3e-15
 Identities = 34/92 (36%), Positives = 57/92 (61%)
 Frame = -1

Query: 984 LQVSQNFFH*VEFRAFEYVFLIHFISDDDNTVLGSDFEDLLNGLF*KDGTSWVTWINNN* 805
           L+  Q+FFH  +    E +FL+H ISDD + +  SDF+++ N +  +  +SW+TW++ N 
Sbjct: 17  LKNPQHFFHGDKLGVVEPIFLVHLISDDHHAIFRSDFDNIFNCIGVQKRSSWITWVDYNQ 76

Query: 804 TGGFNSLLNCIQHDLFNFFWVSGPILFFSQVV 709
            G  +SL + + +DL N F + GP  FF ++V
Sbjct: 77  AGWSDSLFDGVLNDLLNLFGIHGPAGFFVKIV 108

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 61.2 bits (147), Expect = 2e-09
 Identities = 49/161 (30%), Positives = 80/161 (49%), Gaps = 10/161 (6%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAA---VSYILS-----ILCKG 624
           Y   QG   +R+ +A+  +  D       E++ LT GA AA     Y L+      +C  
Sbjct: 55  YGAIQGSHALRKLIAEMYSNED--VTLSEENVILTNGAIAANFLTHYTLAGKGDHFICIS 112

Query: 625 PNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPT- 801
           P    L  IPQ  ++ A + L        +LR+E N+  +  E+E++        IKP  
Sbjct: 113 PTYQQLSSIPQ--MFGAEVEL-------LHLRKETNYQPNIVELERM--------IKPNT 155

Query: 802 -CLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
            C+V+  P NP  +++  +++++I E+A K+GIVV  DEVY
Sbjct: 156 KCIVLNTPNNPLSSVIPTETLREIAELADKHGIVVFCDEVY 196

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 56.2 bits (134), Expect = 1e-07
 Identities = 42/181 (23%), Positives = 86/181 (47%), Gaps = 4/181 (2%)
 Frame = +1

Query: 415 SIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV 594
           +IK A+R L      V  YS ++G   + +++  F T   + ++        T    A  
Sbjct: 63  AIKEAQRALEIP--LVNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVFTGANEAIF 120

Query: 595 SYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIE--QVV 768
           S ++ +L   P   V++  P +  Y  ++ L+  + +   +   +N  T   + E  Q+ 
Sbjct: 121 SILIGLL--NPGDEVIVFEPFFDQYIPNIELSGGKVVYVPITPPKNLDTRVTKGEEWQID 178

Query: 769 LDAIQKGI--KPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKG 942
            D++Q  +  K   +++  P NP G + +E  ++++ ++  K  +V+I+DEVY+   FK 
Sbjct: 179 WDSLQAAMNSKTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYFKD 238

Query: 943 S 945
           S
Sbjct: 239 S 239

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] {ON}
            highly similar to uniprot|P47039 Saccharomyces cerevisiae
            YJL060w
          Length = 433

 Score = 54.3 bits (129), Expect = 4e-07
 Identities = 71/350 (20%), Positives = 140/350 (40%), Gaps = 12/350 (3%)
 Frame = +1

Query: 460  VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 636
            V  YS ++G   + +++ + + K   G+    +++ +T GA+  + S ++ IL  G    
Sbjct: 74   VNQYSPTRGRPSLIKSLVE-LYKPVFGDFIDNQNVLVTTGANEGILSCLMGILNAGDEVI 132

Query: 637  VLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI--KPTCLV 810
            V  P     +    L     R +P +  +E        +  Q+  DA++K    K   ++
Sbjct: 133  VFEPFFDQYIPNIELCGGVVRYVPIHPPKEMKTRNTTGDEWQIDWDALEKTFNNKTKAVI 192

Query: 811  VINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKT 990
            +  P NP G + +EQ + K+ ++  ++  VVI+DEVY E+++    F  +  +       
Sbjct: 193  INTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVY-EHLYFTESFPRIANI------- 244

Query: 991  YHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQA 1170
                  N  +A+L  T           G  +  +   +D    ++  A   +C       
Sbjct: 245  ------NEDIANLTLTVGSAGKSFAATGWRIGWIISKNDQLLNYVSKAHTRIC------- 291

Query: 1171 LVDLMVSPPQPGDESYEQDQQE--REDIHDALDERASKLFE----TFSRLEGIECRKPQG 1332
                  + P P  E+     +   + D    + E   K FE     F +L G+   +P+G
Sbjct: 292  -----FASPSPLQEACAGSIEHALKIDYFPKMREEYRKKFEILTTAFDKL-GLNYTQPEG 345

Query: 1333 AMYL---YPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGF 1473
              ++   + K+ +P   +   + LE   D      L+   GI  +P + F
Sbjct: 346  TYFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTEF 395

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 54.3 bits (129), Expect = 5e-07
 Identities = 40/171 (23%), Positives = 77/171 (45%), Gaps = 9/171 (5%)
 Frame = +1

Query: 460 VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 636
           V  YS ++G   + E++    +   + E+   E++ +T GA+  + S ++ IL  G    
Sbjct: 84  VNQYSPTRGRVSLLESLIKLYSPLYNAELK-AENVTVTTGANEGILSCLMGILNPGDEVI 142

Query: 637 VLIP-----IPQYPLYTASLA---LNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI 792
           V  P     IP   L    +    +N  + +   + +   W+ D E+    + D      
Sbjct: 143 VFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRVVKGTEWTVDYEQFANAITD------ 196

Query: 793 KPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGS 945
           K   +++  P NP G + + + + +I E+  K  +V+I+DEVY+   F  S
Sbjct: 197 KTKAVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYEHLYFTDS 247

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 53.5 bits (127), Expect = 8e-07
 Identities = 37/170 (21%), Positives = 81/170 (47%), Gaps = 11/170 (6%)
 Frame = +1

Query: 460 VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 636
           V  YS ++G   + +++ D  +      +  PE++ +T GA+  + + ++ IL    N  
Sbjct: 84  VNQYSPTRGRPTLIKSLTDLYSPLYKLTLK-PENVLVTTGANEGILACLMGIL--NQNDE 140

Query: 637 VLIPIPQYPLYTASLAL----------NNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQK 786
           V++  P +  Y  ++ L          N  + L   + +   W+ D E+ E V+ +    
Sbjct: 141 VIVFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLDFEQFENVITN---- 196

Query: 787 GIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVF 936
             K   +++  P NP G + + + +++I ++  K+ +++I+DEVY    F
Sbjct: 197 --KTKAIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYDNLYF 244

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 53.1 bits (126), Expect = 1e-06
 Identities = 39/171 (22%), Positives = 75/171 (43%), Gaps = 9/171 (5%)
 Frame = +1

Query: 460 VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 636
           V  YS ++G   +  ++ D  T   + E+   E++ +T GA+  + S ++ +L  G    
Sbjct: 85  VNQYSPTRGRPSLINSLIDLYTPIYNKELK-AENVVVTTGANEGILSCLMGLLNSGDEVI 143

Query: 637 VLIP-----IPQYPLYTASLA---LNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI 792
           V  P     IP   L    +    +N  + L       + W+ D E+ E+ +        
Sbjct: 144 VFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITS------ 197

Query: 793 KPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGS 945
           K   +++  P NP G + +   +  +  +  K+ +V+I+DEVY+   F  S
Sbjct: 198 KTKAVIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVYEHLYFTDS 248

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 52.0 bits (123), Expect = 2e-06
 Identities = 37/152 (24%), Positives = 70/152 (46%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIP 648
           Y   +G   +R  VA   +   D E+   +D  L    +   ++++S    GP   V+  
Sbjct: 55  YGAIKGSDELRSLVASLYS---DKEVKLDKDNVLITNGAIGANFLVSYTLAGPGDHVICV 111

Query: 649 IPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGN 828
            P Y   ++   +  +      L  E ++  D  +++ ++     KG    C+V+ NP N
Sbjct: 112 DPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMI-----KG-NTKCIVLNNPNN 165

Query: 829 PTGAILSEQSIQKIFEVAAKYGIVVIADEVYQ 924
           P G+++   ++++I  +A K  I VI DEVY+
Sbjct: 166 PLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar to
            uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
            Histidinol-phosphate aminotransferase catalyzes the
            seventh step in histidine biosynthesis responsive to
            general control of amino acid biosynthesis mutations
            cause histidine auxotrophy and sensitivity to Cu Co and
            Ni salts
          Length = 387

 Score = 50.8 bits (120), Expect = 5e-06
 Identities = 44/169 (26%), Positives = 78/169 (46%), Gaps = 2/169 (1%)
 Frame = +1

Query: 556  EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSR--PLPYYLREEQ 729
            +++ L  G+  ++  ++   C      +LI    Y +YT    +N+     +P  L EE 
Sbjct: 88   DNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEED 147

Query: 730  NWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIA 909
             +  D E+I    L+ +Q       + + +PGNPTG  +    I+KI     + G+VV+ 
Sbjct: 148  KFQIDEEKI----LETLQNDPSIKLVFITSPGNPTGTFIDVNRIEKILS-QWQTGLVVV- 201

Query: 910  DEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSG 1056
            DE Y + V +GS   S+  +          +Y+NI +    S S G++G
Sbjct: 202  DEAYIDFV-EGSDKGSLAPLAT--------KYENIAVLQTLSKSFGLAG 241

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 50.4 bits (119), Expect = 7e-06
 Identities = 38/165 (23%), Positives = 75/165 (45%), Gaps = 9/165 (5%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTGVLI 645
           YS ++G   + + +AD  T     ++S  ++I +  GA+ A+ S ++ +L KG    V  
Sbjct: 77  YSPTRGRPNLIKALADLYTPLYGQQLS-ADNITVHTGANEAIFSCLMGLLNKGDEVIVFE 135

Query: 646 PIPQYPLYTASLA--------LNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPT 801
           P     +    LA        +N  R L   +     W  D + +E+ +        +  
Sbjct: 136 PFFDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEWEIDWDILEKTI------NSRTK 189

Query: 802 CLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVF 936
           C+++  P NP G + + + + ++ ++     IV+I+DEVY+   F
Sbjct: 190 CVIINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYEHLYF 234

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 50.4 bits (119), Expect = 9e-06
 Identities = 54/208 (25%), Positives = 94/208 (45%), Gaps = 15/208 (7%)
 Frame = +1

Query: 343 LSLLQHPELLEEADEALQTLYKTDSIKR---AKRLLSEVGGSVGA-YSQSQGVQGIRETV 510
           L++L  P           T   TDS+ +    KR   E+  S+   YS++QG++ + + +
Sbjct: 91  LNVLNSPSCKINNTSDCTTSTDTDSLSKIHVTKRFPQELPLSMSLQYSETQGMKPLLDFI 150

Query: 511 ADFITKRDD----GEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTAS 678
             FITK ++     E  Y  DI L  G+S ++  +   LC    T ++      P+ +  
Sbjct: 151 KTFITKLNNTPPYNETLY--DIMLANGSSDSMFKVFETLCDESTTVLMEEFTFVPVISNV 208

Query: 679 LALN-NSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKG-----IKPTCLVVINPG-NPTG 837
           +A      PL   L  E     D E +E ++ +   K       KP  L  I+ G NP G
Sbjct: 209 MATGAKCIPLKLNLNYEDQ-GIDIEYLENLLDNWGGKSNTKHLSKPKILYTISTGQNPIG 267

Query: 838 AILSEQSIQKIFEVAAKYGIVVIADEVY 921
             LS +  +KI+ +A ++ ++++ D+ Y
Sbjct: 268 VTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 50.1 bits (118), Expect = 1e-05
 Identities = 48/157 (30%), Positives = 69/157 (43%), Gaps = 6/157 (3%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKRDDGEISYPE-DIYLTAGASAAVSYILSILCKGPNTGVLI 645
           Y  SQG   + E V    +   D  I Y + D+  TAG + A    L + C   N G  I
Sbjct: 106 YGFSQGQPELMEFVRKHTSLVHD--IKYADWDVLATAGNTNAWESTLRVFC---NRGDTI 160

Query: 646 PIPQYP----LYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVV 813
               Y     LY A     N  P+P        +   PE++E ++ +   +  KP  L  
Sbjct: 161 LAEAYSFSSSLYAAEAQGVNVFPVPL-----DEFGIIPEKLESIMDNWNPETPKPKLLYT 215

Query: 814 INPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
           I  G NPTG+ LS+    KI+ +A K+  ++I DE Y
Sbjct: 216 IPTGQNPTGSSLSDDRKAKIYRIAQKHNFIIIEDEPY 252

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 36/168 (21%), Positives = 76/168 (45%), Gaps = 9/168 (5%)
 Frame = +1

Query: 460 VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 636
           V  YS ++G   +  ++ D  +     +++ PE++ +T GA+  + S ++ I+  G    
Sbjct: 85  VNQYSPTRGRPRLINSLIDLYSPFYKKQLT-PENVLVTTGANEGILSCLMGIINPGDEVI 143

Query: 637 VLIP-----IPQYPLYTASLA---LNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI 792
           V  P     IP   L    +    +N  + L   + +   W+ D +E  + +        
Sbjct: 144 VFEPFFDQYIPNIELCGGKVVYVPINPPKELDNRVTKGTEWTVDFDEFTRAITP------ 197

Query: 793 KPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVF 936
           K   +++  P NP G + + + + K+  +  +  +++IADEVY+   F
Sbjct: 198 KTKAVIINTPHNPIGKVFTREELTKLGNICVENNVIIIADEVYEHLYF 245

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 38/173 (21%), Positives = 79/173 (45%), Gaps = 11/173 (6%)
 Frame = +1

Query: 460 VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 636
           V  YS ++G   +  ++    +     E+   E+I +T GA+  + S ++ +L  G    
Sbjct: 89  VNQYSPTRGRASLLNSLIKLYSPFYGKELKQ-ENITITTGANEGILSCLMGLLNAGDE-- 145

Query: 637 VLIPIPQYPLYTASLAL----------NNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQK 786
           V++  P +  Y +++ L          N  + L   + E   W+ D E+    +      
Sbjct: 146 VIVFEPFFDQYISNIELMGGKVVYVPINPPKDLDQRITEGTEWTIDFEQFRNAITP---- 201

Query: 787 GIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGS 945
             K   ++V +P NP G + +++ + K+ E+  +  +++I+DEVY+   F  S
Sbjct: 202 --KTKAVIVNSPHNPIGKVFTKEELTKLGEICVENNVIIISDEVYEFLYFNDS 252

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 49.3 bits (116), Expect = 2e-05
 Identities = 40/171 (23%), Positives = 77/171 (45%), Gaps = 9/171 (5%)
 Frame = +1

Query: 460 VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 636
           V  YS ++G   +  ++    +     E+   E++ +T GA+  + S ++ IL  G    
Sbjct: 92  VNQYSPTKGRPSVINSLKKLYSPLYGQELK-DENVTITTGANEGILSSLMGILNPGDEVI 150

Query: 637 VLIP-----IPQYPLYTASLA---LNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI 792
           V  P     IP   L    +    +N  + +   + E ++W+ D EE+ +          
Sbjct: 151 VFEPFFDQYIPNIELLGGKVVYVPINPPKDMDQRIVEGKDWTIDYEELAKAFTS------ 204

Query: 793 KPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGS 945
           K   L++  P NP G + +++ + KI  +  +  +V+I+DEVY+   F  S
Sbjct: 205 KTKALILNTPHNPIGKVFTKEELTKIGNLCVENNVVIISDEVYEFLYFTDS 255

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 48.9 bits (115), Expect = 2e-05
 Identities = 37/171 (21%), Positives = 75/171 (43%), Gaps = 9/171 (5%)
 Frame = +1

Query: 460 VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 636
           V  YS ++G   +  ++    +   D ++   E++ +T GA+  + S ++ +L  G    
Sbjct: 101 VNQYSPTRGRPSLINSLIKLYSPIYDTDLR-AENVTVTTGANEGILSCLMGLLNSGDEVI 159

Query: 637 VLIP-----IPQYPLYTASLA---LNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI 792
           V  P     IP   L    +    +N  + L     + + W+ D E+ E  +        
Sbjct: 160 VFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTKGEEWTIDFEQFENAITS------ 213

Query: 793 KPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGS 945
           K   +++  P NP G + + + +  +  +  K+ +V+I+DEVY+   F  S
Sbjct: 214 KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLFFTDS 264

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 48.5 bits (114), Expect = 3e-05
 Identities = 31/137 (22%), Positives = 68/137 (49%), Gaps = 11/137 (8%)
 Frame = +1

Query: 559 DIYLTAGASAAV-SYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRP--LPYYLREEQ 729
           ++ +T GA+  + S ++ +L   P   V++  P +  Y +++ +   +   +P +  +E 
Sbjct: 116 NVQVTTGANEGILSCLVGLL--NPGDEVIVFEPFFDQYISNIQIPGGKVTYVPMHPPKEM 173

Query: 730 N--------WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAA 885
           N        W+ + +E+E  +        K   L++  P NP G + + + + +I E+  
Sbjct: 174 NVRNTKGTEWTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEICV 227

Query: 886 KYGIVVIADEVYQENVF 936
           K+ +V+I+DEVY+   F
Sbjct: 228 KHNVVIISDEVYEHLYF 244

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 48.5 bits (114), Expect = 3e-05
 Identities = 41/186 (22%), Positives = 82/186 (44%), Gaps = 9/186 (4%)
 Frame = +1

Query: 415 SIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV 594
           +IK A++ L      V  YS ++G   +  ++    +   + E+   E++ +T GA+  +
Sbjct: 72  AIKEAQKALDIP--MVNQYSPTRGRPSLINSLIKLYSPIYNTELK-AENVTVTTGANEGI 128

Query: 595 -SYILSILCKGPNTGVLIP-----IPQYPLYTASLA---LNNSRPLPYYLREEQNWSTDP 747
            S ++ +L  G    V  P     IP   L    +    +N  + L       + W+ D 
Sbjct: 129 LSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDF 188

Query: 748 EEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQE 927
           E+ E+ +        K   +++  P NP G + + + +  +  +  K+ +V+I+DEVY+ 
Sbjct: 189 EQFEKAITS------KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEH 242

Query: 928 NVFKGS 945
             F  S
Sbjct: 243 LYFTDS 248

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
            (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 47.4 bits (111), Expect = 6e-05
 Identities = 42/169 (24%), Positives = 76/169 (44%), Gaps = 2/169 (1%)
 Frame = +1

Query: 556  EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 732
            +++ L  G+   +  ++   C+     +L   P Y +Y+    +N+   +   L  E N 
Sbjct: 85   DNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVEIVECPLITEDNS 144

Query: 733  -WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIA 909
                 PE     VL  ++   K   L + +PGNPTG +++++ I+ I E     G+VV+ 
Sbjct: 145  FQMNVPE-----VLSTLKNDPKIKLLFITSPGNPTGKLVNKKDIEFILENWTN-GLVVV- 197

Query: 910  DEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSG 1056
            DE Y +        YSM K++         +Y N+ +    S S G++G
Sbjct: 198  DEAYIDFADAEGTTYSMAKLVT--------KYPNLTVLQTLSKSFGLAG 238

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 47.0 bits (110), Expect = 8e-05
 Identities = 38/153 (24%), Positives = 70/153 (45%), Gaps = 7/153 (4%)
 Frame = +1

Query: 556 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 732
           E++ L  G+   +  ++   C      +LI  P Y +Y+    +N+   +   L  E N 
Sbjct: 88  ENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVEDNS 147

Query: 733 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 912
           +  D E+    V++ +Q       + + +PGNPTGA++  ++I+K+     + G VV+ D
Sbjct: 148 FQMDTEK----VIETLQNDPSIKLVFITSPGNPTGALIKPENIEKLLS-QWQSGFVVV-D 201

Query: 913 EVYQENVFKGSKF------YSMKKVLRNLQKTY 993
           E Y +    G         Y    VL+ L K++
Sbjct: 202 EAYIDFCTTGGSVAPLVNKYPNLAVLQTLSKSF 234

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 35/170 (20%), Positives = 75/170 (44%), Gaps = 11/170 (6%)
 Frame = +1

Query: 460 VGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAV-SYILSILCKGPNTG 636
           V  YS ++G   +   +    T     E+   E++ +T GA+  + S ++ +L  G    
Sbjct: 86  VNQYSPTRGRVSLLNALIKQYTPIYGSELKQ-ENVTITTGANEGILSCLMGLLNAGDE-- 142

Query: 637 VLIPIPQYPLYTASLAL----------NNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQK 786
           V++  P +  Y +++ L          N  + L   + E   W+ D E+ +  +      
Sbjct: 143 VIVFEPFFDQYISNIELMGGKIVYVPINPPKELDQRVTEGTEWTVDMEQFKNAITS---- 198

Query: 787 GIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVF 936
             K   +++  P NP G + + + + +I  +  +  +++I+DEVY+   F
Sbjct: 199 --KTKAVIINTPHNPIGKVFTREELLQIGNICVEKNVIIISDEVYEHLYF 246

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 46.6 bits (109), Expect = 1e-04
 Identities = 24/60 (40%), Positives = 38/60 (63%), Gaps = 1/60 (1%)
 Frame = +1

Query: 745 PEEIEQVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
           PE++EQ++ +  +   KP  L  I  G NPTG+ LS+   +KI++VA K+  ++I DE Y
Sbjct: 190 PEKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDEPY 249

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 46.2 bits (108), Expect = 2e-04
 Identities = 30/141 (21%), Positives = 65/141 (46%), Gaps = 11/141 (7%)
 Frame = +1

Query: 556 EDIYLTAGASAAV-SYILSILCKGPNTGVLIPIPQYPLYTASLAL----------NNSRP 702
           E++ +T GA+  + S ++ +L  G    V++  P +  Y +++ L          N  + 
Sbjct: 116 ENVTVTTGANEGILSCLMGLLNAGDE--VIVFEPFFDQYISNIELCGGKVVYVPINPPKE 173

Query: 703 LPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVA 882
           L       + W+ D E+ E+ +        K   +++  P NP G + + + +  +  + 
Sbjct: 174 LDLRNTRGEEWTIDFEQFEKAITP------KTKAVIINTPHNPIGKVFTREELTTLGNIC 227

Query: 883 AKYGIVVIADEVYQENVFKGS 945
            K+ +++I+DEVY+   F  S
Sbjct: 228 VKHNVIIISDEVYEHLYFTDS 248

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 38/127 (29%), Positives = 60/127 (47%), Gaps = 1/127 (0%)
 Frame = +1

Query: 544 ISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLRE 723
           ISY ++I L  G+   V  ++   C      VL+  P Y +Y+    +N++  +   L  
Sbjct: 85  ISY-KNICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLIT 143

Query: 724 EQN-WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIV 900
           E N +  D +     VL+ +        L +  PGNPTGA +S Q I+ +    +  GIV
Sbjct: 144 EDNSFDMDLDN----VLETLSNDDSIKLLFITTPGNPTGASISTQKIEMLLNNWSA-GIV 198

Query: 901 VIADEVY 921
           V+ DE Y
Sbjct: 199 VV-DEAY 204

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 45.8 bits (107), Expect = 2e-04
 Identities = 35/175 (20%), Positives = 85/175 (48%), Gaps = 4/175 (2%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIP 648
           YS ++G   + +++ DF +   +  ++   ++ +T GA+  +   L  L   P   V++ 
Sbjct: 88  YSPTRGRPSLLKSLTDFYSPIYNETLN-ESNVTITTGANEGILASLVGLLN-PGDEVIVF 145

Query: 649 IPQYPLYTASLALNNS--RPLPYYLREEQNWSTDPEEIEQVVLDAIQKGI--KPTCLVVI 816
            P +  Y +++ +     R +P    +E +         ++  D + K I  +  C+++ 
Sbjct: 146 EPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTINERTKCIILN 205

Query: 817 NPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNL 981
            P NP G + + + + ++ ++  K  I +I+DEVY E+++ G +F  +  + + +
Sbjct: 206 TPHNPIGKVFTREELTQLGDICVKNNIYIISDEVY-EHLYFGDEFTRIATISKEI 259

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 45.4 bits (106), Expect = 2e-04
 Identities = 33/157 (21%), Positives = 68/157 (43%), Gaps = 11/157 (7%)
 Frame = +1

Query: 553 PEDIYLTAGASAAV-SYILSILCKGPNTGVLIPIPQYPLYTASLA--------LNNSRPL 705
           PE+I +T GA+  + + ++S+L  G    VL P     +Y   +         L   + L
Sbjct: 99  PENIQVTTGANVGIFACLMSLLNPGDEVIVLEPFFDQYIYNIKVLGGIVKHVPLTPPKDL 158

Query: 706 PYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAA 885
                +   W+ D ++    + +      K   +++ +P NPTG + + + +  +  +  
Sbjct: 159 KTRRTKGSEWTLDFDQFRSAISE------KTKAVIINSPHNPTGKVFTREELLTLGNICV 212

Query: 886 KYGIVVIADEVYQENVFKGS--KFYSMKKVLRNLQKT 990
           +  + +I+DEVY+   F     K  S+   + N+  T
Sbjct: 213 EKNVYIISDEVYENLYFTPECVKLASLSPEISNITLT 249

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 45.1 bits (105), Expect = 3e-04
 Identities = 33/122 (27%), Positives = 59/122 (48%), Gaps = 1/122 (0%)
 Frame = +1

Query: 559 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN-W 735
           +I L  G+  ++  I+   C      +L+  P Y +Y+    +N+   +   L  E N +
Sbjct: 89  NICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITEDNSF 148

Query: 736 STDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADE 915
             D ++    VLD +    +   L + +PGNPTGA +    I+K+ +   + G+VV+ DE
Sbjct: 149 QMDSDK----VLDILNNDQEIKLLFITSPGNPTGAQIETARIEKVLQNWDR-GLVVV-DE 202

Query: 916 VY 921
            Y
Sbjct: 203 AY 204

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 44.7 bits (104), Expect = 4e-04
 Identities = 41/155 (26%), Positives = 68/155 (43%), Gaps = 9/155 (5%)
 Frame = +1

Query: 556 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 732
           +++ L  G+  ++  ++   C      +LI  P Y +Y+    +N+   +   L  E N 
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVEDNS 147

Query: 733 --WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVI 906
              +TD       V++ +Q         V +PGNPTGA++   SI+KI     + GIV I
Sbjct: 148 FQMNTDK------VIETLQGDSNIKIAFVTSPGNPTGALIDIASIEKILS-QWQSGIVAI 200

Query: 907 ADEVYQENVFKGSKF------YSMKKVLRNLQKTY 993
            DE Y +    G         Y    VL+ L K++
Sbjct: 201 -DEAYIDFCSTGGSAAPLVNKYPNLAVLQTLSKSF 234

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 44.3 bits (103), Expect = 6e-04
 Identities = 30/139 (21%), Positives = 65/139 (46%), Gaps = 11/139 (7%)
 Frame = +1

Query: 553 PEDIYLTAGASAAV-SYILSILCKGPNTGVLIPIPQYPLYTASLA----------LNNSR 699
           P ++ +T GA+ A+ S ++ +L +G    V++  P +  Y +++           L+  +
Sbjct: 118 PSNVQVTTGANEAILSCLVGLLNQGDE--VIVFEPFFDQYISNIEIPGGKVTYVPLHPPK 175

Query: 700 PLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEV 879
            L   +     W+ D +E+   +        K   L++  P NP G + + + + +I  +
Sbjct: 176 ELENRVTHGTEWTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNI 229

Query: 880 AAKYGIVVIADEVYQENVF 936
             +  +V+I+DEVY+   F
Sbjct: 230 CVENNVVIISDEVYEHLYF 248

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YJL060W
            (BNA3)
          Length = 458

 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 75/361 (20%), Positives = 140/361 (38%), Gaps = 18/361 (4%)
 Frame = +1

Query: 556  EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNS-------RP---L 705
            E++ +T GA+  +   L+ L   P   V++  P +  Y  ++ L          RP   L
Sbjct: 130  ENVQVTTGANEGIFACLAGLVN-PGDEVIVFEPFFDQYIPNIELLGGVVRYVPIRPPAEL 188

Query: 706  PYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAA 885
               + E   W  D + + Q + +      K   +++ +P NP G + + + + K+  +  
Sbjct: 189  SKRVTEGTEWVIDYDMLRQTINE------KTKAVIINSPHNPIGKVFTREELLKLGNICV 242

Query: 886  KYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECG 1065
            + GI +I+DEVY E+++   +F  +  +   +              S H+ + G +G+  
Sbjct: 243  EKGIYIISDEVY-EHLYFTDEFTRIATLSEEI--------------SQHTLTVGSAGKSF 287

Query: 1066 QRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQERED 1245
               G+   +G+     +  L LAS         +A V +  S P P  E+     +    
Sbjct: 288  AATGWR--IGWVISRNKELLALAS---------KAHVRICFSSPAPLQEACAVAIEHALK 336

Query: 1246 IHDALDERAS--KLFETFSRL---EGIECRKPQGAMYL---YPKLDLPYKVIQEAQHLEM 1401
                 D RA+  K +E F +     G+   + +G+ +L   + +L LP       +  + 
Sbjct: 337  TTYYADTRAAYQKKYERFQKPFDDLGLPYTRAEGSYFLLVDFSRLPLPADYHFPEELADK 396

Query: 1402 EPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKAFFDKYR 1581
              D      L+   G+  +P S F            F+P   E  E   +F     D Y 
Sbjct: 397  GRDFRVAYWLINELGLVAIPCSSF------------FIPDHREASENMLRFAICKDDTYL 444

Query: 1582 D 1584
            D
Sbjct: 445  D 445

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 44.3 bits (103), Expect = 7e-04
 Identities = 53/188 (28%), Positives = 78/188 (41%), Gaps = 37/188 (19%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITK------RDDGEISYPEDIYLTAGASAAVSYIL---SILCK 621
           Y   +G   +RE +  F         RDD   S PE + L++GAS  V  IL   ++   
Sbjct: 51  YGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGVLSILLQATLAHT 110

Query: 622 GPNTGVLIPIPQYPLY----------------------TASLALNNSRPLPYYLREEQNW 735
           G      I  P Y L                       +  LAL     L   L+E ++ 
Sbjct: 111 GYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLAL-----LERKLQEFEDK 165

Query: 736 STDPEEIE--QVVLD---AIQKGI-KPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGI 897
            T+ E+ E  Q + D   A+ K I K     +    NPTG   S ++  K+ E+A KY +
Sbjct: 166 FTEEEDQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDM 225

Query: 898 VVIADEVY 921
           ++IAD+VY
Sbjct: 226 LIIADDVY 233

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 43.9 bits (102), Expect = 8e-04
 Identities = 30/151 (19%), Positives = 64/151 (42%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIP 648
           Y    G   +R+ VA         EI    D  L    +   ++++     GP   ++  
Sbjct: 55  YGSIWGTPVLRDLVAKI---HSSDEIQLTADNVLITNGAIGANFLVHYTAAGPGDHIICV 111

Query: 649 IPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGN 828
            P Y   ++  ++  +     +L  E  ++ + ++++  V            +V+ NP N
Sbjct: 112 DPTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQKLKSKVR------ANTKYIVLNNPNN 165

Query: 829 PTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
           P G+++S + + +I + A +  I ++ DEVY
Sbjct: 166 PLGSVISTEKMTEIIDYAERNEIFIVCDEVY 196

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 43.9 bits (102), Expect = 9e-04
 Identities = 46/187 (24%), Positives = 78/187 (41%), Gaps = 36/187 (19%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITK------RDDGEISYPEDIYLTAGASAAVSYILSILCKGPN 630
           Y  ++G   +R  + +F+ +      RDD   S PE + LT+GAS  V  IL +    P+
Sbjct: 51  YGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGVLNIL-LQATLPH 109

Query: 631 TGV----LIPIPQYPLYT------------ASLALNNSRPLPYYLRE---EQNWSTDPEE 753
           TGV     I  P Y L               ++       +   L E   +   S DP  
Sbjct: 110 TGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESIDPNP 169

Query: 754 IEQ-----------VVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIV 900
           + +           + +  ++K  K    V+    NP+G   + ++  K+ E+A KY ++
Sbjct: 170 VNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYDML 229

Query: 901 VIADEVY 921
           +I D+VY
Sbjct: 230 IITDDVY 236

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 31/130 (23%), Positives = 61/130 (46%), Gaps = 4/130 (3%)
 Frame = +1

Query: 559 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 738
           +I +T GA+  +   L  L   P   V++  P +  Y +++ +   +     L   +  S
Sbjct: 116 NIQVTTGANEGILACLVGLLN-PGDEVIVFEPFFDQYISNIQIPGGKVTYVPLHPPKEMS 174

Query: 739 TDPEEIEQ--VVLDAIQKGIKPT--CLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVI 906
             P E  +  V  D ++  I P    L++  P NP G + + + + +I ++  +  +V+I
Sbjct: 175 VRPTEGTEWTVDYDELRAAITPKTKALILNTPHNPVGKVFTREELLQIGQICVENNVVII 234

Query: 907 ADEVYQENVF 936
           +DEVY+   F
Sbjct: 235 SDEVYEHLYF 244

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 1/123 (0%)
 Frame = +1

Query: 556 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 732
           E++ L  G+  ++  I+   C      ++   P Y +Y+   ++N+   +   L    N 
Sbjct: 85  ENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGMYSVCASVNDVEIVKCPLVTSDNS 144

Query: 733 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 912
           +  D E     VLD ++K      + + +PGNPTGA +    I+KI +     GI+V+ D
Sbjct: 145 FQVDTE----AVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQ-NWDQGILVV-D 198

Query: 913 EVY 921
           E Y
Sbjct: 199 EAY 201

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
            Anc_2.252 YIL116W
          Length = 392

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 40/177 (22%), Positives = 84/177 (47%), Gaps = 10/177 (5%)
 Frame = +1

Query: 556  EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNN----SRPLPYYLRE 723
            +++ L  G+   +  ++   CK     +++  P Y +Y+    +N+    + PL   + E
Sbjct: 85   KNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPL---IVE 141

Query: 724  EQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVV 903
            + ++  D +      L+ ++K      L + +PGNPTG I++ + I  + E   K G+VV
Sbjct: 142  DNSFQMDVKR----TLETLKKDDLIRLLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVV 196

Query: 904  IADEVYQE------NVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSG 1056
            + DE Y +         K ++++S+ K++         +Y N+ +    S S G++G
Sbjct: 197  V-DEAYVDFSTYFNEETKKTEYFSVAKLVT--------KYPNLTVLQTLSKSFGLAG 244

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 43.1 bits (100), Expect = 0.001
 Identities = 52/183 (28%), Positives = 76/183 (41%), Gaps = 32/183 (17%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKR-----DDGEISYPEDIYLTAGASAAVSYILSILCKGPNT 633
           Y    G   +R  +A+F  K           + P+ + LT+GAS  +  IL +    P+T
Sbjct: 49  YGSDNGSAWVRACIAEFSNKVFKLPVHSSAATRPDHLNLTSGASYGIMNIL-VQTTLPHT 107

Query: 634 G----VLIPIPQYPLY-------------TASLALNNSRPLPYYLRE----EQNWSTDPE 750
           G      I  P Y L              TA     +   L +   +    E + + + E
Sbjct: 108 GYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKLFENSANGERE 167

Query: 751 EIEQVVLDAI--QKGIKPTCLVVI----NPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 912
           +  +  LD I  Q G K     VI       NPTGAI S  S  K+ E+A KY I++I+D
Sbjct: 168 QKTEESLDIINAQGGQKKVYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 227

Query: 913 EVY 921
           +VY
Sbjct: 228 DVY 230

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 43.1 bits (100), Expect = 0.002
 Identities = 49/183 (26%), Positives = 76/183 (41%), Gaps = 32/183 (17%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKR-----DDGEISYPEDIYLTAGASAAVSYILSILCKGPNT 633
           Y    G   +R  +A+F  +           + PE + LT+GAS  +  IL +    P+T
Sbjct: 48  YGSDNGSAWVRACIAEFSNRAFKLPVSSNAATRPEHLNLTSGASYGIMNIL-LQTTLPHT 106

Query: 634 G----VLIPIPQYPL---------YTASLALNNSRP-------LPYYLREEQNWSTDP-- 747
           G      I  P Y L         +T  +     +        L   L+  +N S     
Sbjct: 107 GYTKQAFIVTPTYFLVNKAFLDAGFTGKITAVEEKGDGLDLAFLEAKLKSCENSSNGESG 166

Query: 748 ---EEIEQVV--LDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 912
              EE  +++   D  +K  +    +V    NPTGAI S  S  K+ E+A KY I++I+D
Sbjct: 167 QKAEESLRIINAQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISD 226

Query: 913 EVY 921
           +VY
Sbjct: 227 DVY 229

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 42.4 bits (98), Expect = 0.002
 Identities = 29/123 (23%), Positives = 57/123 (46%), Gaps = 1/123 (0%)
 Frame = +1

Query: 556 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 732
           E+I L  G+  ++  ++ + C      ++I  P Y +Y+    +N+   +   L  E N 
Sbjct: 88  ENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAEDNS 147

Query: 733 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 912
           +  D  +    VL+ + +      + + +PGNPT A++    I+K+       G +V+ D
Sbjct: 148 FQMDTSK----VLETLAQDPTIKLIFITSPGNPTAALIDTAEIEKVLNNWT--GGLVVVD 201

Query: 913 EVY 921
           E Y
Sbjct: 202 EAY 204

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 33/133 (24%), Positives = 54/133 (40%), Gaps = 10/133 (7%)
 Frame = +1

Query: 556 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLY----------TASLALNNSRPL 705
           E+I +T GA  A+   L  L K P   V++  P +  Y             + L N    
Sbjct: 99  ENILVTTGAIQALLESLMALIK-PGDEVIVIEPFFDPYIHLIKIAGGVVKYVPLTNPNQG 157

Query: 706 PYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAA 885
              + E  +W  D E +     D      K   +++ NP NP G + +   + ++  +  
Sbjct: 158 KKRILEANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATLCV 211

Query: 886 KYGIVVIADEVYQ 924
             G  +IADEVY+
Sbjct: 212 NNGAYIIADEVYE 224

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 42.4 bits (98), Expect = 0.003
 Identities = 37/125 (29%), Positives = 62/125 (49%), Gaps = 4/125 (3%)
 Frame = +1

Query: 559 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 738
           DI  T G++ A    L I C   N G  + + ++  Y++S+   +++ L        N  
Sbjct: 133 DIITTTGSTQAWDASLRIFC---NKGDTVLLEEFT-YSSSVEAADAQGLNCIPVPMDNQG 188

Query: 739 TDPEEIEQVVLDAIQK--GIK-PTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVI 906
             PE++E+++ +   +  GI  P  L  I  G NPTG  LSE     I+ +A KY I+++
Sbjct: 189 IIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIV 248

Query: 907 ADEVY 921
            D+ Y
Sbjct: 249 EDDPY 253

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 42.0 bits (97), Expect = 0.003
 Identities = 33/126 (26%), Positives = 58/126 (46%), Gaps = 4/126 (3%)
 Frame = +1

Query: 556 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSR----PLPYYLRE 723
           E++ L  G+  ++  I+   C      +L+  P Y +Y+    +N+      PL Y   +
Sbjct: 89  ENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLY---K 145

Query: 724 EQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVV 903
             ++  D E     VL  +Q       L + +PGNPTGA +  + I+ + +     G+VV
Sbjct: 146 NNSFQMDTES----VLTVLQNDPLIKLLFITSPGNPTGARIETERIETVLQNWTD-GLVV 200

Query: 904 IADEVY 921
           + DE Y
Sbjct: 201 V-DEAY 205

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 41.2 bits (95), Expect = 0.005
 Identities = 31/126 (24%), Positives = 61/126 (48%), Gaps = 4/126 (3%)
 Frame = +1

Query: 556 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSR----PLPYYLRE 723
           E++ L  G+  ++  I+   C      +L+  P Y +Y+    +N+      PL Y   E
Sbjct: 88  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIY---E 144

Query: 724 EQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVV 903
           + ++  + ++    VLD ++       + + +PGNPTG  +  + I+K+ +     G+VV
Sbjct: 145 DNSFQLNSDK----VLDILKNDPLIKLVFITSPGNPTGVKIETKRIEKVLQ-NWDNGLVV 199

Query: 904 IADEVY 921
           + DE Y
Sbjct: 200 V-DEAY 204

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 40.4 bits (93), Expect = 0.010
 Identities = 32/122 (26%), Positives = 54/122 (44%)
 Frame = +1

Query: 556 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNW 735
           +++ L  G+  ++  ++   C      +L   P Y +Y+    +N+   L   L  E N 
Sbjct: 87  DNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYEDN- 145

Query: 736 STDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADE 915
           S  P+   Q V+  +        + + +PGNPTGA +    I KI E  +  G  V+ DE
Sbjct: 146 SFQPDS--QKVISILSSDPLIKLVFLTSPGNPTGAKIDSNIIIKILE--SWDGGFVVVDE 201

Query: 916 VY 921
            Y
Sbjct: 202 AY 203

>YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromatic
           aminotransferase II, catalyzes the first step of
           tryptophan, phenylalanine, and tyrosine catabolism
          Length = 513

 Score = 40.4 bits (93), Expect = 0.011
 Identities = 39/191 (20%), Positives = 89/191 (46%), Gaps = 15/191 (7%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITK------RDDGEISYPEDIYLTAGASAAVSYILSILCKGPN 630
           Y++++G+  +   V DF+++       D+ E ++  D+ L+ G++ ++  +   +C   +
Sbjct: 102 YAETKGLPPLLHFVKDFVSRINRPAFSDETESNW--DVILSGGSNDSMFKVFETICD-ES 158

Query: 631 TGVLIPIPQYPLYTASLALNNSRPLPYYLR---EEQNWSTDPEEIEQVVLDAIQKGI--- 792
           T V+I    +    +++    ++ +P  +    + ++   D E + Q+ LD    G    
Sbjct: 159 TTVMIEEFTFTPAMSNVEATGAKVIPIKMNLTFDRESQGIDVEYLTQL-LDNWSTGPYKD 217

Query: 793 --KPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMK 963
             KP  L  I  G NPTG  + +   +KI+++A ++  +++ D+ Y      G  ++   
Sbjct: 218 LNKPRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPY------GYLYFPSY 271

Query: 964 KVLRNLQKTYH 996
                L+  YH
Sbjct: 272 NPQEPLENPYH 282

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [1143
            nt, 381 aa]
          Length = 380

 Score = 40.0 bits (92), Expect = 0.013
 Identities = 75/363 (20%), Positives = 140/363 (38%), Gaps = 18/363 (4%)
 Frame = +1

Query: 466  AYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAA---VSYIL-----SILCK 621
            +Y   +G   +R ++A        G     +DI LT GA  A     Y L      ++C 
Sbjct: 54   SYGAIKGSDELRTSIASLY-----GPDFTMDDILLTNGAIGANFLAFYTLVGAGDHVICV 108

Query: 622  GPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPT 801
             P    L  +P+  ++ A + L         L++E ++  + + ++ ++ +  +      
Sbjct: 109  EPTYSQLYSVPE--MFGAEVDLLT-------LKKEDDFLPNLQTLKSMIKNNTK------ 153

Query: 802  CLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVF----------KGSKF 951
             +++ NP NP G+++ +  +++I ++  +  I + +DEVY+  +F             + 
Sbjct: 154  LIIINNPNNPLGSVIKKDLLKQICKLCEENDIYLHSDEVYRP-IFHSLEDEMVPPSACEL 212

Query: 952  YSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKL 1131
            YS   V  ++ K Y      I+L  L S  K    +   R  Y                +
Sbjct: 213  YSKAIVSGSMSKAY--SVAGIRLGWLVSKDKQFLRDAASRRDY---------------NM 255

Query: 1132 ASISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGI 1311
             S+S+      Q ++D   +       +YE        ++D +DE + K FE +      
Sbjct: 256  ISVSMIDDQIAQYVLD---NREYVIKRNYELCLNNFRLLNDFMDEHSDK-FEFY------ 305

Query: 1312 ECRKPQGAMYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGT 1491
               KP  A     K+    K + +           +   L E  G+  VPG  FG VPGT
Sbjct: 306  --HKPTAATVCLAKV----KGVNDTMK--------FATFLAEKYGVLAVPGEAFG-VPGT 350

Query: 1492 YHL 1500
              +
Sbjct: 351  IRI 353

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 40.0 bits (92), Expect = 0.013
 Identities = 31/123 (25%), Positives = 57/123 (46%), Gaps = 1/123 (0%)
 Frame = +1

Query: 556 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 732
           E++ L  G+  ++  I+   C      +L+  P Y +Y+    +N+   +   L    N 
Sbjct: 87  ENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVKCPLITSDNS 146

Query: 733 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 912
           +  + +E    V+   Q       + + +PGNPTGA +    I+KI +   + G+VV+ D
Sbjct: 147 FQANTDE----VIKTAQNDPSIKLIFITSPGNPTGAKVETSRIEKILQNWDR-GMVVV-D 200

Query: 913 EVY 921
           E Y
Sbjct: 201 EAY 203

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 40.0 bits (92), Expect = 0.013
 Identities = 36/124 (29%), Positives = 59/124 (47%), Gaps = 2/124 (1%)
 Frame = +1

Query: 556 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 732
           ++I L  G+  ++  I+   C      V++  P Y +Y     +N+   +   L    N 
Sbjct: 88  KNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVGYVEVPLISSDNS 147

Query: 733 WSTDPEEI-EQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIA 909
           +  D + I EQ+ LD   K IK   + + +PGNPTGA +    ++K+       GIVV+ 
Sbjct: 148 FQIDEDRILEQLNLD---KSIK--VVFITSPGNPTGACIEVGRVEKLLRNWTA-GIVVV- 200

Query: 910 DEVY 921
           DE Y
Sbjct: 201 DEAY 204

>Kwal_26.7768 s26 (502609..503877) [1269 bp, 422 aa] {ON} YKL106W
           (AAT1) - aspartate aminotransferase, mitochondrial
           [contig 55] FULL
          Length = 422

 Score = 39.7 bits (91), Expect = 0.018
 Identities = 35/132 (26%), Positives = 59/132 (44%), Gaps = 1/132 (0%)
 Frame = +1

Query: 532 DDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPY 711
           D   IS+ + +  T GA A  S +LS+     +  V IP P +P +      N  + + Y
Sbjct: 109 DQNRISFVQTLSGT-GALAVASKLLSLFM---SRSVWIPNPSWPNHANVFQNNGFKEINY 164

Query: 712 YLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVV-INPGNPTGAILSEQSIQKIFEVAAK 888
           Y   +         I+ +   A ++G  P C+V+     NPTG   S++  Q+I +   +
Sbjct: 165 YSYYKDGSLDIEGWIQDLEKHAQKEGEDPQCIVLHACCHNPTGIDPSKEQWQRILDKIHE 224

Query: 889 YGIVVIADEVYQ 924
             ++ I D  YQ
Sbjct: 225 LNLIPIIDMAYQ 236

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 39.7 bits (91), Expect = 0.019
 Identities = 29/124 (23%), Positives = 58/124 (46%), Gaps = 3/124 (2%)
 Frame = +1

Query: 559 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 738
           D+  TAG++ A    L + C   N G  + + +Y  Y++SL    ++ L     +     
Sbjct: 128 DLITTAGSTQAWDACLRLFC---NRGETVLMEEYT-YSSSLEAAVAQGLNCVAMKMDKDG 183

Query: 739 TDPEEIEQVVLD---AIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIA 909
              +++ +++ D   A+Q         + N  NPTG  L E+   ++  +A++Y  ++I 
Sbjct: 184 IKVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIE 243

Query: 910 DEVY 921
           D+ Y
Sbjct: 244 DDPY 247

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 39.3 bits (90), Expect = 0.022
 Identities = 18/54 (33%), Positives = 32/54 (59%), Gaps = 2/54 (3%)
 Frame = +1

Query: 769 LDAIQKGIKPTCLVVI--NPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQ 924
           LD ++K IK    ++I  NP NP G ++S++ +  I E+  +  + +  DEVY+
Sbjct: 142 LDTLKKAIKSNTKLIIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDEVYR 195

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 38.9 bits (89), Expect = 0.033
 Identities = 33/133 (24%), Positives = 66/133 (49%), Gaps = 12/133 (9%)
 Frame = +1

Query: 559 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 738
           ++ +  G+S A+  +  +LC   +T +L      P+ + ++ L  +  +P  ++     S
Sbjct: 123 NVCMANGSSDAMYKVFEVLCDEDSTVMLEEFTFSPVIS-NIKLQGASVVPVKMQ----LS 177

Query: 739 TDPEE----IEQV--VLDAIQKGI-----KPTCLVVINPG-NPTGAILSEQSIQKIFEVA 882
            DPE+    ++++  +LD    G      KP  L  +  G NPTG  LS    ++I+E+A
Sbjct: 178 ADPEQQGIDVDRLADLLDNWSVGPYKHLNKPKALYTVATGQNPTGMTLSPTKRRRIYEIA 237

Query: 883 AKYGIVVIADEVY 921
            K+  +++ D+ Y
Sbjct: 238 QKHDFLIVEDDPY 250

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
           (REAL)
          Length = 517

 Score = 38.9 bits (89), Expect = 0.033
 Identities = 35/164 (21%), Positives = 76/164 (46%), Gaps = 13/164 (7%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKRD----DGEISYPEDIYLTAGASAAVSYILSILCKGPNTG 636
           Y++S+G   +   V D +++ +      E+    D+ L+ G++ ++  +   +C   +T 
Sbjct: 102 YAESKGTPPLLRFVKDMVSRINRPVFSDEMQSNWDVILSGGSNDSMFKVFETICD-ESTT 160

Query: 637 VLIPIPQYPLYTASLALNNSRPLPYYLR---EEQNWSTDPEEIEQVVLDAIQKG-----I 792
           VLI    +    +++    ++ +P  +    +  +   D + + Q+ LD    G      
Sbjct: 161 VLIEEFTFTPAMSNVEATGAKVVPIKINLTLDRDSQGIDVDHLTQL-LDNWSTGPYKHLA 219

Query: 793 KPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
           KP  L  I  G NPTG  + +   +KI+ +A K+  +++ D+ Y
Sbjct: 220 KPRVLYTIATGQNPTGMSVPQWKREKIYRLAQKHDFLIVEDDPY 263

>KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {ON}
           Anc_8.204 YER152C
          Length = 443

 Score = 38.5 bits (88), Expect = 0.041
 Identities = 45/180 (25%), Positives = 71/180 (39%), Gaps = 29/180 (16%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKR------DDGEISYPEDIYLTAGASAAVSYILSILCKGPN 630
           Y  ++G   +R T+  F  +       + G  S PE + LT+GAS  V  IL + C  P+
Sbjct: 53  YGSNEGAHWVRSTICKFNNEEIFKFGENYGARSAPECLNLTSGASYGVLNIL-LQCTLPH 111

Query: 631 TG----VLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVV--LDAIQKGI 792
                   I  P Y L                + E    S D + +E  +  LD+I+  +
Sbjct: 112 NNYTRQAFIISPTYFLINDCFIDAGFHGKLTAINEMGTDSIDFDTLESNLAELDSIKADV 171

Query: 793 KPTCLV-----------------VINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
              C+                  V    NP+G   S  +  ++ E+A KY I++I D+VY
Sbjct: 172 GTQCITKNENSKGKKIYRYVLYCVPTYSNPSGHTYSLTTKLRLLELARKYDILIITDDVY 231

>Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON}
           (69909..71414) [1506 nt, 502 aa]
          Length = 501

 Score = 38.5 bits (88), Expect = 0.043
 Identities = 18/44 (40%), Positives = 28/44 (63%), Gaps = 1/44 (2%)
 Frame = +1

Query: 793 KPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
           KPT L  I  G NPTG  LS +  +KI+++  K+ I+++ D+ Y
Sbjct: 208 KPTVLYTIATGQNPTGMTLSMEKRRKIYKICQKHDIIIVEDDPY 251

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 38.1 bits (87), Expect = 0.051
 Identities = 30/123 (24%), Positives = 57/123 (46%), Gaps = 1/123 (0%)
 Frame = +1

Query: 556 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLR-EEQN 732
           +++ L  G+  ++  I+   C      +L+  P Y +Y+    +N+   +   L   + +
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSDGS 147

Query: 733 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 912
           +  D E     VL  ++       + V +PGNPTGA +    I+K+ +     G+VV+ D
Sbjct: 148 FQMDTE----AVLTILKNDSLIKLMFVTSPGNPTGAKIKTSLIEKVLQ-NWDNGLVVV-D 201

Query: 913 EVY 921
           E Y
Sbjct: 202 EAY 204

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 37.7 bits (86), Expect = 0.067
 Identities = 30/152 (19%), Positives = 68/152 (44%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIP 648
           Y   +G   +R  +A        G     +++ +T GA AA ++++     GP   V+  
Sbjct: 55  YGSIKGSDKLRSLIASMY-----GPEFNKDNVLVTNGAIAA-NFLIYYTLVGPGDHVICV 108

Query: 649 IPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGN 828
            P Y    +   +  +      L++E  +  + E +++++    +       +++ NP N
Sbjct: 109 DPTYAQLYSVPKMFGAEVSLLKLQKEDGFIPNIETLKKMIKSNTK------LIIINNPNN 162

Query: 829 PTGAILSEQSIQKIFEVAAKYGIVVIADEVYQ 924
           P G+ +S +++  I ++  +  I +  DEVY+
Sbjct: 163 PLGSAISTETLNDICQLCEENNIYLHCDEVYK 194

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
            Ashbya gossypii AGR141C
          Length = 446

 Score = 37.7 bits (86), Expect = 0.072
 Identities = 61/245 (24%), Positives = 100/245 (40%), Gaps = 33/245 (13%)
 Frame = +1

Query: 466  AYSQSQGVQGIRETVADFITKRDDGEI-SYPEDIYLTAGASAAVSYILSILCKGPNTG-- 636
            +Y   +G   +R  ++ F+ K     + + PE I LT GAS  +  IL   C  P+TG  
Sbjct: 50   SYGPKEGSLWVRCVISQFVNKCFKPLMPTKPEYINLTGGASYGIMNILE-QCTLPHTGYT 108

Query: 637  --VLIPIPQYPLYTASL----------ALNNSRP------LPYYLRE-EQNWSTDPEEIE 759
                +  P Y L   +           A+N ++       L   L E E +   +P+  E
Sbjct: 109  RQAFLISPTYFLINETFIDAGFGGKLTAVNETQNGLDVEFLEAKLAEFEYDALLNPQHGE 168

Query: 760  QVVLDAI--------QKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADE 915
            +  L+ I        +K  +    +V    NP+G   S  +  K+ E+A KY I++I+D+
Sbjct: 169  ERGLNLINMSGRSRTKKVYRYVMYLVPTFSNPSGKTYSVSTRLKLVELARKYDILLISDD 228

Query: 916  VYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGEC---GQRGGYME 1086
            VY   V+      ++ K L  L       Y+  +    ++ S     +    G R GY E
Sbjct: 229  VYDLLVY-DQPCDALPKCLPRLTHLDRASYEYGENGYGNTISNATFSKVIAPGLRCGYQE 287

Query: 1087 LVGFN 1101
             V  N
Sbjct: 288  SVNMN 292

>NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON}
           Anc_2.102
          Length = 510

 Score = 37.7 bits (86), Expect = 0.076
 Identities = 35/162 (21%), Positives = 81/162 (50%), Gaps = 11/162 (6%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKRDDGEISYPEDIY---LTAGASAAVSYILSILCKGPNTGV 639
           YS+++G+  + + +  FI K       Y + ++   L  G+S ++  +   LC   +T +
Sbjct: 109 YSETRGLNPLLDFIRYFI-KWIGNSPPYEDSLWEVMLANGSSDSMFKVFETLCDESDTVL 167

Query: 640 LIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQV--VLDAIQKG-----IKP 798
           +      P+ +  +A   ++ +P  ++   N+     +I+ +  +L+  ++G      KP
Sbjct: 168 MEEFTFVPVISNVMA-TGAKCIP--IKVNLNYEDQGIDIDYLSNLLNNWKEGPYKHLSKP 224

Query: 799 TCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
             L  I+ G NP G  LS +  +KI+++A ++ ++++ D+ Y
Sbjct: 225 KILYTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPY 266

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 37.4 bits (85), Expect = 0.089
 Identities = 31/123 (25%), Positives = 56/123 (45%), Gaps = 1/123 (0%)
 Frame = +1

Query: 556 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 732
           +++ L  G+  ++  I+   C      +L+  P Y +Y+    +N+   +   L    N 
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS 147

Query: 733 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 912
           +  D E      L  ++       + V +PGNPTGA +    I+KI +   + G+VV+ D
Sbjct: 148 FQMDTE----AALTILKNDPLIKLIFVTSPGNPTGAKIKTCLIEKILQ-NWENGLVVV-D 201

Query: 913 EVY 921
           E Y
Sbjct: 202 EAY 204

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 37.4 bits (85), Expect = 0.100
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +1

Query: 793 KPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
           KP  L  I  G NPTG  LS +  +KI+E+  K+ I+++ D+ Y
Sbjct: 208 KPKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPY 251

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 37.4 bits (85), Expect = 0.10
 Identities = 37/159 (23%), Positives = 73/159 (45%), Gaps = 8/159 (5%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIP 648
           YSQ+QG+  I + +   +   ++       D+ L  G+S ++  +   L     T VL+ 
Sbjct: 112 YSQTQGLAPILDFLKLIVANCNNPPYQN-WDLLLANGSSDSMFKLFDTLTDETTT-VLVE 169

Query: 649 IPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIE--QVVLDAIQKGI-----KPTCL 807
              +    +++    +  +P  L    N S     +   Q +L+  Q G      +P+ L
Sbjct: 170 EFTFSPVLSNITATGASCVPLQLNFTSNPSNQGINVTYLQHLLENWQSGPYKHLNRPSIL 229

Query: 808 VVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
             I+ G NPTG  +S ++  +I+++A KY  +++ D+ Y
Sbjct: 230 YTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 37.0 bits (84), Expect = 0.12
 Identities = 30/123 (24%), Positives = 57/123 (46%), Gaps = 1/123 (0%)
 Frame = +1

Query: 556 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQN- 732
           +++ L  G+  ++  I+   C      +L+  P Y +Y+    +N+   +   L    N 
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVVSDNS 147

Query: 733 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 912
           +  D E     VL  ++       + V +PGNPTGA +    I+++ +   + G+VV+ D
Sbjct: 148 FQMDVE----AVLTILENDPLIKLVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNGLVVV-D 201

Query: 913 EVY 921
           E Y
Sbjct: 202 EAY 204

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 37.0 bits (84), Expect = 0.13
 Identities = 42/176 (23%), Positives = 71/176 (40%), Gaps = 25/176 (14%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTG---- 636
           Y   +G   +R+ V + I +      S PE I LT+GAS  +  IL +    P+TG    
Sbjct: 51  YGSDEGALWVRQEVCNMINQIGSDINSKPEYINLTSGASYGILNIL-LQTTLPHTGYTKQ 109

Query: 637 VLIPIPQYPL---------------------YTASLALNNSRPLPYYLREEQNWSTDPEE 753
             I  P Y L                     YT+         L Y+ +E  +   +  +
Sbjct: 110 AFIVSPTYFLINDCFIDAGFGSKMTAIKEKGYTSIDLEYLKEKLEYFEQEIPDVPQNSTD 169

Query: 754 IEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
           I Q   +  +K  K     +    NP+G     ++  ++ ++A KY +++I D+VY
Sbjct: 170 IIQNKNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDVY 225

>Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W
           (REAL)
          Length = 513

 Score = 37.0 bits (84), Expect = 0.13
 Identities = 37/175 (21%), Positives = 77/175 (44%), Gaps = 24/175 (13%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITK------RDDGEISYPEDIYLTAGASAAVSYILSILCKGPN 630
           Y++++G+  +   V D + +       D+ E ++  D+ L+ G++ ++  +   +C   +
Sbjct: 102 YAETKGLPPLLHFVKDMVCRINRPVFSDETESNW--DVILSGGSNDSMFKVFETICD-ES 158

Query: 631 TGVLIPIPQYPLYTASLALNNSRPLPYYL-----REEQ------------NWSTDPEEIE 759
           T V+I    +    +++    ++ +P  +     RE Q            NWST P +  
Sbjct: 159 TTVMIEEFTFTPAMSNVEATGAKVIPIKMDLTFDRERQGIDVEDLTRLLDNWSTGPYKHL 218

Query: 760 QVVLDAIQKGIKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
                      KP  L  I  G NPTG  +     +KI+++A K+  +++ D+ Y
Sbjct: 219 N----------KPKVLYTIATGQNPTGMSVPRWKREKIYQLAQKHDFLIVEDDPY 263

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 37.0 bits (84), Expect = 0.13
 Identities = 37/161 (22%), Positives = 71/161 (44%), Gaps = 10/161 (6%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIP 648
           YS+++G+  + E  +  I KR +       D+ L  G+S ++  I   LC   + GV + 
Sbjct: 132 YSETRGLPSVVE-FSKKIVKRFNPPAYDNWDVLLANGSSDSLFKIFETLC---DEGVTVL 187

Query: 649 IPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIE-QVVLDAIQKG--------IKPT 801
           + ++        +  S      ++ E     + + I+ Q + D ++           KP 
Sbjct: 188 MEEFTFSPTIFNVTASGGKVVPIKVEITHDPETQGIDVQYLCDLLENWEVGPYKHLSKPR 247

Query: 802 CLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
            L  I  G NPTG  LS +  + I+E+A  +  +++ D+ Y
Sbjct: 248 VLYTIATGQNPTGMTLSPEKRKAIYELAETHNFIIVEDDPY 288

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 36.6 bits (83), Expect = 0.17
 Identities = 46/194 (23%), Positives = 85/194 (43%), Gaps = 34/194 (17%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVAD-----FITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNT 633
           Y   +G   +RET+A+     F  ++ +   +  E + LTAGAS  +  IL +    P+T
Sbjct: 48  YGTDKGAAWVRETIAELTNQVFGLEKQERMATDAEFLNLTAGASYGILNIL-LQTTLPHT 106

Query: 634 G----VLIPIPQYPL---------YTASL-ALNNSR----------PLPYYLRE----EQ 729
                  I  P Y L         ++  L A+  +R           + Y+       E+
Sbjct: 107 NYTRQAFIITPTYYLINKVFLDAGFSGKLTAVEETRHGIDLGFLEEKIKYFESSSHSTEK 166

Query: 730 NWSTDPEEIEQV-VLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVI 906
           + S+  + +  +   D  +K  +    +V    NP+GA  S++   K+ ++A +Y I++I
Sbjct: 167 STSSSSQSLSIINAADDKKKFYRYVIYLVPTFSNPSGATYSQECRLKLLDLARRYDILII 226

Query: 907 ADEVYQENVFKGSK 948
           +D+VY    F G +
Sbjct: 227 SDDVYDLLGFHGQR 240

>TBLA0I01180 Chr9 complement(252457..253788) [1332 bp, 443 aa] {ON}
            Anc_2.475 YKL106W
          Length = 443

 Score = 36.2 bits (82), Expect = 0.22
 Identities = 56/235 (23%), Positives = 96/235 (40%), Gaps = 20/235 (8%)
 Frame = +1

Query: 415  SIKRAKRLLSEVGGSVG--AYSQSQGVQGIRETVADFITKRDDGEISYPEDIYL------ 570
            S++ A+ LL  V       +Y    G    R  V +F+      EI  PE IY       
Sbjct: 69   SVQNAQHLLHTVPSLRKDLSYLPIIGHPNYRNKVLNFLFHDGCPEIG-PEIIYQDRVSFV 127

Query: 571  -TAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPL---PYYLREE---Q 729
             T   + A+S     L    +  ++IP   +  +      N  R +   PYY  E+   +
Sbjct: 128  QTLSGTGALSVTARFLSNFISDSIIIPQLSWANHANVFKNNGFRNISYYPYYSNEKIVLK 187

Query: 730  NWSTDPEEIEQVVLDAIQKGIKPTCLVV-INPGNPTGAILSEQSIQKIFEVAAKYGIVVI 906
            +W      I++   + +    KP+C+++     NPTG   +++   +I +      ++ I
Sbjct: 188  DWLNHLINIQKTDRE-VTSNSKPSCILLHACCHNPTGLDPTKEQWDQILDTIYDLNLIPI 246

Query: 907  ADEVYQ----ENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGE 1059
             D  YQ     +V K S  Y ++KVL   +K Y    + I L    + + G+ GE
Sbjct: 247  IDMAYQGLESGDVLKDS--YLLRKVLN--KKRYKNWKNGIYLCQSFAKNMGLYGE 297

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 36.2 bits (82), Expect = 0.23
 Identities = 35/160 (21%), Positives = 73/160 (45%), Gaps = 9/160 (5%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKRDDGEISYPE-DIYLTAGASAAVSYILSILCKGPNTGVLI 645
           Y++  G+  IR      + K +    S  + D+ L++G+  ++       C   +T ++ 
Sbjct: 125 YNEVPGLPQIRNFAKYLVNKINKPAYSADQWDVLLSSGSCDSMFKFFECFCDEKSTVLME 184

Query: 646 PIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQV--VLDAIQKGI-----KPTC 804
                P+ +   A   +  +P  +   ++ ST   +++ +  +LD    G      KP  
Sbjct: 185 EFTFTPVISHVKA-TGAECIPLKMNLTKDPSTQGIDVDYLTQLLDNWSSGPYKHLNKPRI 243

Query: 805 LVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
           L  I  G NPTG  +  ++ +KI+E+A K+  +++ D+ Y
Sbjct: 244 LYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPY 283

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 35.8 bits (81), Expect = 0.27
 Identities = 31/127 (24%), Positives = 60/127 (47%), Gaps = 5/127 (3%)
 Frame = +1

Query: 556 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNN----SRPLPYYLRE 723
           E+  L  G+  ++  I+   C      +L+  P Y +Y+    +N+    + PL   + E
Sbjct: 87  ENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPL---ITE 143

Query: 724 EQNWSTDPEEIEQVVL-DAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIV 900
           + ++  D  EI  ++  D + K      + + +PGNPTGA +    I+ + +     G+V
Sbjct: 144 DNSFQIDATEILNILANDPLIK-----LVFITSPGNPTGAKIEIDRIEYLLK-NWDQGLV 197

Query: 901 VIADEVY 921
           ++ DE Y
Sbjct: 198 IV-DEAY 203

>ABL038W Chr2 (324559..325890) [1332 bp, 443 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YKL106W (AAT1)
          Length = 443

 Score = 35.4 bits (80), Expect = 0.38
 Identities = 74/342 (21%), Positives = 122/342 (35%), Gaps = 16/342 (4%)
 Frame = +1

Query: 415  SIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKR---------DDGEISYPEDIY 567
            S+ RA+ ++    G   AY    G       V+DF+              G +S+ + + 
Sbjct: 84   SVARAQLMVEGQRGGRLAYLPIAGCPSYGARVSDFLYSECAPQGREFLASGCVSFMQTLS 143

Query: 568  LTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDP 747
             T   S A  ++ + + K     + +P P +  +     LN    +  Y   E       
Sbjct: 144  GTGALSLASLFLSNFISKT----IWVPQPSWANHMNIFKLNGFEEVRRYRYYEDGAVDVD 199

Query: 748  EEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQE 927
              + Q+   A  +      L+     NPTG   + +   +I  V    G+V I D  YQ 
Sbjct: 200  SWLAQLERAAADRPYPQCILLHACCHNPTGVDPTREQWSRILSVINGLGMVPIVDMAYQ- 258

Query: 928  NVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHD 1107
                G +   ++     L+     ++DN  L   HS +K + G  G+R G + +V   H 
Sbjct: 259  ----GLESGDLRADAYLLRMCLEHRWDN-GLYVCHSFAKNM-GLYGERVGSLSVV---HP 309

Query: 1108 IRQVFLKLASISLCPVVTGQALVDLMVSPPQPGDESY-------EQDQQEREDIHDALDE 1266
            + Q   K A+ S    +   +      SPP  G           E  QQ  ED+H     
Sbjct: 310  LGQFQAKAATDSQLKCIIRAS----YSSPPSYGSRVATTVLSVPEIKQQWHEDVHGMC-- 363

Query: 1267 RASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQH 1392
                     +RL  + C        L+ KL  P  +   +QH
Sbjct: 364  ---------NRLWSVRC-------MLHEKLRWPKLIDSTSQH 389

>KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 35.4 bits (80), Expect = 0.40
 Identities = 32/129 (24%), Positives = 60/129 (46%), Gaps = 8/129 (6%)
 Frame = +1

Query: 559 DIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWS 738
           D+ L  G+S ++S + + L     T VL+    +    +++  N   P+P  +    + S
Sbjct: 160 DVMLANGSSDSLSKVFTTLTDEDVT-VLMEEFTFTPTISNVTANGGIPIPLKVDITDDAS 218

Query: 739 TDPEEIEQV--VLDAIQKG-----IKPTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYG 894
                +E +  +L+    G      KP  L  I  G NPTG    ++  QKI+++  K+ 
Sbjct: 219 QQGINVEYMDQLLENWSTGEYSHLSKPRLLYTIVTGQNPTGMTQCKEKRQKIYDLCEKHD 278

Query: 895 IVVIADEVY 921
           I+++ D+ Y
Sbjct: 279 IIIVEDDPY 287

>YDR112W Chr4 (679544..679852) [309 bp, 102 aa] {OFF}  IRC2Dubious
           open reading frame, unlikely to encode a protein, based
           on available experimental and comparative sequence data;
           partially overlaps YDR111C; null mutant displays
           increased levels of spontaneous Rad52p foci
          Length = 102

 Score = 33.1 bits (74), Expect = 0.41
 Identities = 20/40 (50%), Positives = 21/40 (52%)
 Frame = -2

Query: 290 MLALIILEKGKEXXXXXXXXXXXSALIGILPLTAYLAFKT 171
           M ALII  KGK            SAL+GI PLTAY A  T
Sbjct: 1   MFALIISSKGKTSGFFFNSSFSSSALVGIAPLTAYSALVT 40

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
            (REAL)
          Length = 560

 Score = 35.0 bits (79), Expect = 0.54
 Identities = 50/262 (19%), Positives = 112/262 (42%), Gaps = 26/262 (9%)
 Frame = +1

Query: 469  YSQSQGVQGIRETVADFITKRD----DGEISYPEDIYLTAGASAAVSYILSILCKGPNTG 636
            Y++++G+  + +   D + + +      E     D+ L+ G++ ++  +    C   +T 
Sbjct: 150  YAETKGMPPLLQFTKDMVARINRPAFSDETDSNWDVILSGGSNDSMYKVFETFCD-ESTT 208

Query: 637  VLIPIPQYPLYTASLALNNSRPLPYYLR---EEQNWSTDPEEIEQVVLD----AIQKGIK 795
            V+I    +    +++    +  +P  +    + +  S D + + Q++ +      +   K
Sbjct: 209  VMIEEFTFTPAVSNVEATGATVVPIKINLSADRETQSVDVDYLSQLLENWSTGPYRHLNK 268

Query: 796  PTCLVVINPG-NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY-------------QENV 933
            P  L  I  G NPTG  + +   +KI+E+A ++  +++ D+ Y              EN 
Sbjct: 269  PRVLYTIATGQNPTGMSVPQWKREKIYELAQRHDFLIVEDDPYGYLYFPPFDPENPLENP 328

Query: 934  FKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIR 1113
            ++ S   + + +   L K++     + ++  L + SK  +      G  +  +  N  I 
Sbjct: 329  YQSSSVTTERYLNEFLMKSFLTLDTDARVIRLETFSKIFA-----PGLRLSFIVANKFIL 383

Query: 1114 QVFLKLASISL-CPVVTGQALV 1176
            +  L LA I+   P  T QA+V
Sbjct: 384  EKVLDLADITTRAPSGTSQAIV 405

>SAKL0H20658g Chr8 complement(1811772..1813187) [1416 bp, 471 aa]
           {ON} highly similar to uniprot|P17649 Saccharomyces
           cerevisiae YGR019W UGA1 Gamma-aminobutyrate (GABA)
           transaminase (4-aminobutyrate aminotransferase) involved
           in the 4-aminobutyrate and glutamate degradation
           pathways required for normal oxidative stress tolerance
           and nitrogen utilization
          Length = 471

 Score = 34.7 bits (78), Expect = 0.68
 Identities = 32/105 (30%), Positives = 46/105 (43%), Gaps = 2/105 (1%)
 Frame = +1

Query: 646 PIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPG 825
           P  +YP Y   L  N          EE N + D +   ++V D I     P   ++I P 
Sbjct: 216 PHAEYPSYQFPLEAN----------EEANRAED-DRCLKIVEDLITSWPIPVAALIIEPI 264

Query: 826 NPTGAI--LSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFY 954
              G     S+  +QK+ +V  K+G+V I DEV Q  V    KF+
Sbjct: 265 QSEGGDNHASKYFLQKLRDVTLKHGVVYIIDEV-QTGVGATGKFW 308

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 34.3 bits (77), Expect = 0.83
 Identities = 28/122 (22%), Positives = 53/122 (43%)
 Frame = +1

Query: 556 EDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNW 735
           +++ L  G+  ++  I+   C      +L+  P Y +Y+    +N+   +   L    N 
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDN- 146

Query: 736 STDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADE 915
               +   + VL  +        +   +PGNPTGA +    I+++ +     GIVV+ DE
Sbjct: 147 --SFQMNTEAVLTILNNDPLIKIMFATSPGNPTGAKIKTCLIEEVLQ-KWDNGIVVV-DE 202

Query: 916 VY 921
            Y
Sbjct: 203 AY 204

>NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204
          Length = 446

 Score = 34.3 bits (77), Expect = 0.88
 Identities = 53/219 (24%), Positives = 87/219 (39%), Gaps = 28/219 (12%)
 Frame = +1

Query: 349 LLQHPELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITK 528
           LL + E+LE   E L    +        R     G  +GA         +RE +A F  +
Sbjct: 20  LLPNKEILEATTELLTPATRPYDADTENRHPLTYGSDLGAL-------WVREQIARFNNE 72

Query: 529 RD-DGEISYPEDIYLTAGASAAVSYILSILCKGPNTG----VLIPIPQY----------- 660
           +      + PE + LT+GAS  +  +L +    P+TG      I  P Y           
Sbjct: 73  KIFHVNHTKPEFLNLTSGASYGILNVL-LQTSLPHTGYTKQAFIVTPTYFLINDCFIDAG 131

Query: 661 ---PLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQK---GIKPTCLV---- 810
               L      + +   L   L E    S   EE E+  +  IQ+   G++   +     
Sbjct: 132 FGGKLTAIDETMGDEYDLNLELLETNLKSFAEEEDEKESISCIQRDKIGVENKKIYRFVM 191

Query: 811 --VINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
             V    NP+G   S ++  K+ E+A +Y +++I+D+VY
Sbjct: 192 YCVPTFSNPSGNTYSLKTKLKLIELARRYDMLIISDDVY 230

>KLLA0F20548g Chr6 (1907637..1909055) [1419 bp, 472 aa] {ON} highly
           similar to uniprot|P17649 Saccharomyces cerevisiae
           YGR019W UGA1 Gamma-aminobutyrate (GABA) transaminase
           (4-aminobutyrate aminotransferase) involved in the
           4-aminobutyrate and glutamate degradation pathways
           required for normal oxidative stress tolerance and
           nitrogen utilization
          Length = 472

 Score = 34.3 bits (77), Expect = 0.89
 Identities = 30/105 (28%), Positives = 47/105 (44%), Gaps = 2/105 (1%)
 Frame = +1

Query: 646 PIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPG 825
           P  +YP+Y   L+ N          EE+N   D +    +V D I+    P   ++I P 
Sbjct: 217 PHGEYPVYKYPLSEN----------EEENKKED-DRCLAIVEDLIKSWPTPVAALIIEPI 265

Query: 826 NPTGAI--LSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFY 954
              G     S+  +Q + ++ +KY +V I DEV Q  V    KF+
Sbjct: 266 QSEGGDNHASKYFLQSLRDLTSKYNVVYIIDEV-QTGVGATGKFW 309

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 33.9 bits (76), Expect = 1.2
 Identities = 44/183 (24%), Positives = 71/183 (38%), Gaps = 32/183 (17%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKR------DDGEISYPEDIYLTAGASAAVSYIL---SILCK 621
           Y   +G   +RET+  F           D   S PE + L +GAS  V  IL   ++   
Sbjct: 54  YGSDEGALWVRETICHFNNDEAFRLSPGDRARSKPEHLNLNSGASYGVLSILLETTLAHT 113

Query: 622 GPNTGVLIPIPQYPLY-------------TASLALNNSR----PLPYYLRE------EQN 732
           G      +  P Y L              TA   L + +     L   L E       Q+
Sbjct: 114 GYTRQAFVITPTYFLINDCFIDAGFANKTTAIDELGDGKVDLDSLEKKLEELEKQHEGQD 173

Query: 733 WSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIAD 912
            S D E I        +K  +     +    NP+G   + ++ +++ E+A KY ++++AD
Sbjct: 174 DSKDLELINNPWKSTHKKVYRYVLYCIPTFANPSGQTYTLETRRRLIEIARKYDMLILAD 233

Query: 913 EVY 921
           +VY
Sbjct: 234 DVY 236

>KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} similar
           to uniprot|Q01802 Saccharomyces cerevisiae YKL106W AAT1
           Mitochondrial aspartate aminotransferase catalyzes the
           conversion of oxaloacetate to aspartate in aspartate and
           asparagine biosynthesis
          Length = 421

 Score = 33.5 bits (75), Expect = 1.5
 Identities = 39/145 (26%), Positives = 63/145 (43%), Gaps = 7/145 (4%)
 Frame = +1

Query: 511 ADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALN 690
           A+F++K     IS+ + +  T GA A  S +LS+     +  V IP P +P +      N
Sbjct: 105 AEFLSKN---RISFVQTLSGT-GALAVASKLLSLFM---SKAVWIPNPSWPNHANVFQNN 157

Query: 691 NSRPLPYYLR------EEQNWSTDPEEIEQVVLDAIQKGIKPTCLVV-INPGNPTGAILS 849
             + + YY        +  +W  D   +EQ V D       P C+V+     NPTG   S
Sbjct: 158 GFKRINYYTYYRDGGLDVDSWLQD---LEQAVRDGDGS---PQCIVLHACCHNPTGVDPS 211

Query: 850 EQSIQKIFEVAAKYGIVVIADEVYQ 924
            +  + I +   +  ++ I D  YQ
Sbjct: 212 LEQWRTILDKINELNLIPIIDMAYQ 236

>Skud_4.373 Chr4 (651175..651735) [561 bp, 186 aa] {ON} YDR112W
           (REAL)
          Length = 186

 Score = 32.7 bits (73), Expect = 1.5
 Identities = 22/53 (41%), Positives = 24/53 (45%)
 Frame = -2

Query: 290 MLALIILEKGKEXXXXXXXXXXXSALIGILPLTAYLAFKTFSLTSSSESFGAG 132
           M ALII  KG +           SAL+GI PLTAY A  T    S      AG
Sbjct: 1   MFALIISSKGNKPGFFFSSSFSSSALVGIEPLTAYSALVTLPFKSFLVILAAG 53

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 33.5 bits (75), Expect = 1.5
 Identities = 13/32 (40%), Positives = 24/32 (75%)
 Frame = +1

Query: 826 NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
           NP+G   S ++ +K+ ++A KY +++IAD+VY
Sbjct: 206 NPSGMSFSLETKKKLLDLARKYDMLIIADDVY 237

>TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {ON}
           Anc_5.241 YJL033W
          Length = 761

 Score = 33.5 bits (75), Expect = 1.7
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 3/64 (4%)
 Frame = +2

Query: 395 KLYIRLTPLSVP---KDFCLRLVDPSVLTLNHRVFKEFEKPLQTSLRREMTVKYLTQKIF 565
           K  I LTP       K    R ++PS+LT+     K  +  LQ+ L ++  +KYL QK F
Sbjct: 391 KSLIMLTPTEEEGFLKRLKARKIEPSMLTIKQSKKKSIKPQLQSLLFKDPELKYLGQKAF 450

Query: 566 TSLL 577
            S +
Sbjct: 451 ISYI 454

>SAKL0E02948g Chr5 complement(241418..242689) [1272 bp, 423 aa] {ON}
            similar to uniprot|Q01802 Saccharomyces cerevisiae
            YKL106W AAT1 Mitochondrial aspartate aminotransferase
            catalyzes the conversion of oxaloacetate to aspartate in
            aspartate and asparagine biosynthesis
          Length = 423

 Score = 33.1 bits (74), Expect = 2.0
 Identities = 56/269 (20%), Positives = 107/269 (39%), Gaps = 9/269 (3%)
 Frame = +1

Query: 577  GASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEI 756
            GA A  S +L +     +  V IP P +  +T     N  + + YY     N + D +  
Sbjct: 122  GALAVASKLLYLFV---SKTVWIPAPSWANHTNVFQSNGFKDIRYYTYYN-NGTLDVDSW 177

Query: 757  EQVVLDAIQKGIKPTCLVV-INPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENV 933
             Q +  A +K   P C+V+     NPTG   + +   KI +      ++ I D  YQ  +
Sbjct: 178  LQDLRSATRKYRAPQCIVLHACCHNPTGVDPTIEQWSKILDAIHDLNMIPILDMAYQ-GL 236

Query: 934  FKGSKFYSMKKVLRNLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELV------- 1092
              G+ +     +   L  + +   + + L    + + G+ GE   R G + +V       
Sbjct: 237  ESGNLYRDAYLLRMCLDSSRYHWSNGLYLCQSFAKNMGLYGE---RVGSLSVVVPSSVTH 293

Query: 1093 GFNHDIRQVFLKLA-SISLCPVVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDER 1269
            G   +I     K+   I   P   G  + +L++S  +  D+ +    ++  ++   L   
Sbjct: 294  GLKLNIDSQLKKIVRGIYSSPPGYGSRVANLVLSDQKLKDQWF----RDVRNMSQRLWHV 349

Query: 1270 ASKLFETFSRLEGIECRKPQGAMYLYPKL 1356
             S++F+   +   +  R  Q  M+ +  L
Sbjct: 350  RSEMFKKLPQWSNLVDRTQQHGMFYFTGL 378

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 32.7 bits (73), Expect = 2.7
 Identities = 13/32 (40%), Positives = 23/32 (71%)
 Frame = +1

Query: 826 NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
           NP+G   S ++ +++ E+A KY ++VI D+VY
Sbjct: 203 NPSGNTYSLETRRRLIEIARKYDMLVITDDVY 234

>TDEL0D02960 Chr4 complement(558937..560352) [1416 bp, 471 aa] {ON}
           Anc_4.155 YGR019W
          Length = 471

 Score = 32.7 bits (73), Expect = 2.7
 Identities = 27/93 (29%), Positives = 42/93 (45%), Gaps = 2/93 (2%)
 Frame = +1

Query: 646 PIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPG 825
           P  +YP Y          PL  Y  E++N   D E   ++V + I+    P   ++I P 
Sbjct: 216 PHAEYPSY--------QYPLEKY--EDENHKED-ERCLKIVEELIKTWKYPVAALIIEPI 264

Query: 826 NPTGAI--LSEQSIQKIFEVAAKYGIVVIADEV 918
              G     S+  +QK+ ++  KY +V I DEV
Sbjct: 265 QSEGGDNHASKYFLQKLRDITLKYNVVYIVDEV 297

>Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON}
           (25289..27595) [2307 nt, 769 aa]
          Length = 768

 Score = 32.7 bits (73), Expect = 3.0
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 3/64 (4%)
 Frame = +2

Query: 395 KLYIRLTPLSVP---KDFCLRLVDPSVLTLNHRVFKEFEKPLQTSLRREMTVKYLTQKIF 565
           K  I LTP       K    R ++PS LT+     K  +  LQ+ L ++  +KYL QK F
Sbjct: 394 KSMIMLTPQEEEGFLKRLASRKIEPSKLTIKQSKKKSIKPQLQSLLFKDPELKYLGQKAF 453

Query: 566 TSLL 577
            S +
Sbjct: 454 ISYI 457

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 32.3 bits (72), Expect = 3.5
 Identities = 43/174 (24%), Positives = 69/174 (39%), Gaps = 23/174 (13%)
 Frame = +1

Query: 469 YSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGAS-AAVSYILSILCKGPN--TGV 639
           Y   +G   +R+ + DF   R  G  S PE + L++G+S   +S +L       N     
Sbjct: 53  YGPDEGALWVRQQICDF-NNRLFGSDSKPEFLNLSSGSSYGCLSVLLHTTLPHTNFTRQA 111

Query: 640 LIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVV-------------LDAI 780
            I  P Y L                + EE   S + E++   +             +  I
Sbjct: 112 FIISPTYFLINDCFIDAGFGSKLTAIDEEGEDSINFEQLLSKLRHFEELYGNSNGDVSII 171

Query: 781 QKGIKPTCLV-------VINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
           Q   KPT  V       V    NP+G   S ++  K+ E+A +Y +++I D+VY
Sbjct: 172 QNPNKPTKKVYKYVMYCVPTFANPSGKSYSLETRTKLIEIARRYDMLIICDDVY 225

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 32.0 bits (71), Expect = 4.6
 Identities = 12/32 (37%), Positives = 24/32 (75%)
 Frame = +1

Query: 826 NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
           NP+G   S ++ +++ ++A KY ++VI+D+VY
Sbjct: 196 NPSGNTYSLETRRRLIDIARKYDMLVISDDVY 227

>CAGL0K08580g Chr11 complement(865470..866831) [1362 bp, 453 aa] {ON}
            similar to uniprot|Q01802 Saccharomyces cerevisiae
            YKL106w Aspartate aminotransferase
          Length = 453

 Score = 32.0 bits (71), Expect = 4.6
 Identities = 48/183 (26%), Positives = 79/183 (43%), Gaps = 7/183 (3%)
 Frame = +1

Query: 577  GASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALN---NSRPLPYYLREEQNWSTDP 747
            GA A  S +LS      +  + IP P +P +T     N   N R   YY R +       
Sbjct: 146  GALAVASRLLSSFI---SRKIWIPKPSWPNHTNIFTQNGFTNPRFYSYYDRGDLTIGRWL 202

Query: 748  EEIE-QVVLDAIQKGIKPTCLVV-INPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
            +E+  +V  D+  K   P C+V+     NPTG   +++  + I +   + G++ I D  Y
Sbjct: 203  QELRHEVGKDSNTK--TPHCIVLHACCHNPTGLDPTKKQWEDIMDTIYELGMIPIIDMAY 260

Query: 922  QENVFKGSKFYSMKKVLR-NLQKTYHGQYDN-IQLASLHSTSKGVSGECGQRGGYMELVG 1095
            Q    +  K      +LR  L  + +  +DN + L    + + G+ GE   R G + +V 
Sbjct: 261  QG--LESGKLIDDAYLLRLCLDTSRYRSWDNGLYLCQSFAKNMGLYGE---RVGSLSIVA 315

Query: 1096 FNH 1104
              H
Sbjct: 316  PEH 318

>ZYRO0G10758g Chr7 (866250..867635) [1386 bp, 461 aa] {ON} no
            similarity
          Length = 461

 Score = 32.0 bits (71), Expect = 4.7
 Identities = 38/171 (22%), Positives = 71/171 (41%), Gaps = 4/171 (2%)
 Frame = +1

Query: 805  LVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQ 984
            + V+N  +    +L E++   I  V   + I+  +  +  +     S+  S K    N +
Sbjct: 16   IFVLNNFDQLNTVLLEEA--DILTVEKIWEIITTSGSLASDKSNGNSRVISQKNATHNSK 73

Query: 985  KTYHG----QYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCP 1152
             +  G       + +L +     +G SGE     G+           + FL+LA     P
Sbjct: 74   NSTTGFTPGYVSDFELNAFGEFWQGASGEKSDTLGFSS---------RCFLELA-----P 119

Query: 1153 VVTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLE 1305
            VV G  +VDL     Q   ++ E+ ++  +DI+ A     + +FE  S++E
Sbjct: 120  VVGGPVMVDLREFMEQVKPDAIEEQKRPLQDINIA----GNPIFENSSQIE 166

>KLTH0H08976g Chr8 complement(772894..774309) [1416 bp, 471 aa] {ON}
           highly similar to uniprot|P17649 Saccharomyces
           cerevisiae YGR019W UGA1 Gamma-aminobutyrate (GABA)
           transaminase (4-aminobutyrate aminotransferase) involved
           in the 4-aminobutyrate and glutamate degradation
           pathways required for normal oxidative stress tolerance
           and nitrogen utilization
          Length = 471

 Score = 32.0 bits (71), Expect = 4.7
 Identities = 30/105 (28%), Positives = 45/105 (42%), Gaps = 2/105 (1%)
 Frame = +1

Query: 646 PIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPG 825
           P  +YP Y   L  N          EE N + D +   ++V D I     P   ++I P 
Sbjct: 216 PHAEYPSYKFPLTEN----------EEANRAED-DRCLKIVEDLITSWSIPVAALIIEPI 264

Query: 826 NPTGAI--LSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFY 954
              G     S+  +Q + ++  K+G+V I DEV Q  V    KF+
Sbjct: 265 QSEGGDNHASKYFLQSLRDLTLKHGVVYIVDEV-QTGVGATGKFW 308

>NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120
          Length = 252

 Score = 31.6 bits (70), Expect = 4.7
 Identities = 18/81 (22%), Positives = 38/81 (46%), Gaps = 7/81 (8%)
 Frame = +1

Query: 658 YPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVV-------LDAIQKGIKPTCLVVI 816
           Y  +TA     NS+ +  +L +  N    PE +++ V       L+ +Q G K   + V+
Sbjct: 156 YSSWTAQTIGRNSKTVREFLEKNYNREEPPENVDECVRLTVRSLLEVVQTGAKNIEITVV 215

Query: 817 NPGNPTGAILSEQSIQKIFEV 879
            P +   ++ +E+  + + E+
Sbjct: 216 KPDSEIISLTNEEIAKHVEEI 236

>TPHA0M00170 Chr13 complement(33610..35478) [1869 bp, 622 aa] {ON}
           Anc_6.4 YPL269W
          Length = 622

 Score = 32.0 bits (71), Expect = 5.0
 Identities = 24/111 (21%), Positives = 55/111 (49%), Gaps = 10/111 (9%)
 Frame = +1

Query: 70  LKSTMPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLKAKYAVRGRIPM----------RA 219
           ++  +    S+ + +FS+ ++ AP  +L+++ E + K  Y+   +IP           R 
Sbjct: 168 VEKKIQETVSIQEEKFSSPIRHAPNFTLNEIIEILDKNSYSNESKIPAFSPLEESLVERY 227

Query: 220 EELRDQLKKDPSSLPFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELL 372
            +L++++K  P  L  ++++   I + +  DQ  +     +  LL+H +LL
Sbjct: 228 LQLKEEIK--PIELSLTEVLIKRINDFKNRDQNNIEALHAL--LLKHFKLL 274

>TDEL0E04600 Chr5 complement(861586..864537) [2952 bp, 983 aa] {ON}
            Anc_5.170 YJL020C
          Length = 983

 Score = 32.0 bits (71), Expect = 5.4
 Identities = 15/41 (36%), Positives = 23/41 (56%)
 Frame = +1

Query: 1186 VSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEG 1308
            V  P   DE+ E+D+ E ED  D+ + R + L E  ++L G
Sbjct: 280  VEKPNEEDENEEEDENEEEDEEDSEEARRAALRERMAKLAG 320

>TDEL0D01270 Chr4 complement(242013..246668) [4656 bp, 1551 aa] {ON}
            Anc_1.251 YKR031C
          Length = 1551

 Score = 32.0 bits (71), Expect = 5.6
 Identities = 21/69 (30%), Positives = 34/69 (49%)
 Frame = +1

Query: 1168 ALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLY 1347
            A++ + V P  PG  S E+D+  R ++    D  A+   ++ S  EG+  +   G   LY
Sbjct: 173  AMLGVRVEPLAPGYMSREEDEGNRNEVPKTEDNNANDDDDSSSIFEGVFKKGEDGPKGLY 232

Query: 1348 PKLDLPYKV 1374
             KL L Y +
Sbjct: 233  -KLHLEYGI 240

>TDEL0H02810 Chr8 complement(465456..467048) [1593 bp, 530 aa] {ON}
            Anc_7.164 YER014W
          Length = 530

 Score = 31.6 bits (70), Expect = 6.4
 Identities = 27/128 (21%), Positives = 66/128 (51%)
 Frame = +1

Query: 823  GNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQ 1002
            G+    + ++++++K+F++  KYG ++   + +  +    ++ + + ++L + Q+ ++  
Sbjct: 189  GDDIDNMSAKRTVRKLFDLETKYGSIM---KGFYNSKSDPNEKHQLSQLLSDYQRAFN-- 243

Query: 1003 YDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDL 1182
             D  +L  L ST        G +GG   L  F H +RQ   KL++++L   ++G+ ++ +
Sbjct: 244  KDEAELKGL-STKLHKYPMLGLKGG---LEMFPHLVRQSLNKLSNVNL---ISGEKVIKI 296

Query: 1183 MVSPPQPG 1206
                 Q G
Sbjct: 297  NQGKEQEG 304

>TPHA0D00620 Chr4 complement(115810..118278) [2469 bp, 822 aa] {ON}
           Anc_8.73 YFL003C
          Length = 822

 Score = 31.6 bits (70), Expect = 6.9
 Identities = 31/145 (21%), Positives = 58/145 (40%)
 Frame = +1

Query: 355 QHPELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQGVQGIRETVADFITKRD 534
           ++ + L E   +L+ L   D  K   +LLS    S+    +   +  ++E+++  +T R 
Sbjct: 316 KNTDSLSEIRNSLKKLQDLD--KLFSKLLSNQKSSISPEQKINYILSLKESISIILTLRT 373

Query: 535 DGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPLYTASLALNNSRPLPYY 714
           +                     I+ ++ K      +  I + PL T    L NS     Y
Sbjct: 374 E---------------------IIKLVPKSKILNEIKEILENPLVTELFTLFNS-----Y 407

Query: 715 LREEQNWSTDPEEIEQVVLDAIQKG 789
           + E+  W+T P E++     AI+ G
Sbjct: 408 INEDARWATSPYELQNQRTYAIKSG 432

>ZYRO0G10626g Chr7
            complement(852624..852838,852926..853404,853465..853487)
            [717 bp, 238 aa] {ON} uniprot|Q96WU1 Zygosaccharomyces
            rouxii orf Hypothetical protein, highly similar to
            YGR001C uniprot|P53200 Saccharomyces cerevisiae YGR001C
            Protein with similarity to methyltransferase family
            members; required for replication of Brome mosaic virus
            in S. cerevisiae, which is a model system for studying
            replication of positive-strand RNA viruses in their
            natural hosts
          Length = 238

 Score = 30.8 bits (68), Expect = 8.0
 Identities = 17/67 (25%), Positives = 36/67 (53%)
 Frame = +1

Query: 1210 ESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQEAQ 1389
            + ++Q++Q+R++  + L ++A + FE   R++G+E  K    +  +   D    V+ EA 
Sbjct: 19   QEFKQEEQQRQENFEKLLQQADEEFEEKKRIQGMELFKEDWQLSQFWYADDTADVLAEAL 78

Query: 1390 HLEMEPD 1410
                +PD
Sbjct: 79   LEGADPD 85

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 31.2 bits (69), Expect = 8.0
 Identities = 11/32 (34%), Positives = 23/32 (71%)
 Frame = +1

Query: 826 NPTGAILSEQSIQKIFEVAAKYGIVVIADEVY 921
           NP+G   S ++ +++ ++A KY +++I D+VY
Sbjct: 196 NPSGNTYSLETRRRLIDIARKYDMLIITDDVY 227

>NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa]
           {ON} Anc_8.204 YER152C
          Length = 478

 Score = 31.2 bits (69), Expect = 8.2
 Identities = 15/51 (29%), Positives = 31/51 (60%)
 Frame = +1

Query: 772 DAIQKGIKPTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQ 924
           ++++K  K     V +  NP+G   S ++ +K+ ++A  Y I++I D+VY+
Sbjct: 208 NSMKKIYKYVLYCVPSFANPSGKSYSLKTKRKLIDLACLYDILIITDDVYE 258

>ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 254

 Score = 30.8 bits (68), Expect = 8.3
 Identities = 20/81 (24%), Positives = 36/81 (44%), Gaps = 7/81 (8%)
 Frame = +1

Query: 658 YPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVV-------LDAIQKGIKPTCLVVI 816
           Y  +TA     NS+ +  +L +  N    P   ++ V       L+ +Q G K   + V+
Sbjct: 156 YSAWTAQTIGRNSKTVREFLEKNYNRDEPPATADECVRLTTRSLLEVVQTGAKNIEITVV 215

Query: 817 NPGNPTGAILSEQSIQKIFEV 879
            PG+    + SEQ  + + E+
Sbjct: 216 RPGSKIEILSSEQIGKYVEEI 236

>ACR040W Chr3 (431343..433634) [2292 bp, 763 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL033W (HCA4)
          Length = 763

 Score = 31.2 bits (69), Expect = 9.0
 Identities = 15/42 (35%), Positives = 24/42 (57%)
 Frame = +2

Query: 446 RLVDPSVLTLNHRVFKEFEKPLQTSLRREMTVKYLTQKIFTS 571
           +L++PS L +     K  +  LQ+ L ++  +KYL QK F S
Sbjct: 410 KLIEPSKLNIKQSKRKSIKPQLQSLLFKDPELKYLAQKAFIS 451

>Ecym_1065 Chr1 (120443..122932) [2490 bp, 829 aa] {ON} similar to
            Ashbya gossypii AFR690C
          Length = 829

 Score = 31.2 bits (69), Expect = 9.1
 Identities = 12/31 (38%), Positives = 22/31 (70%)
 Frame = +1

Query: 1210 ESYEQDQQEREDIHDALDERASKLFETFSRL 1302
            ++YE+++Q+ ED +DA+DE+   L   F R+
Sbjct: 755  KAYERNEQQLEDTYDAIDEKHKNLESKFRRV 785

>TBLA0B02380 Chr2 (554809..557688) [2880 bp, 959 aa] {ON} Anc_3.107
           YOL090W
          Length = 959

 Score = 31.2 bits (69), Expect = 9.2
 Identities = 24/109 (22%), Positives = 47/109 (43%)
 Frame = +1

Query: 136 APKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQLDQ 315
           A KL+ +   E+VLK  Y    +IP   +     L+ D        ++ +    P     
Sbjct: 400 AKKLNKNGTLEDVLKV-YQFSRKIPEITQAFESFLEDDSVEPKIKDLVKSEWLQPLTAHI 458

Query: 316 KPLTFYREVLSLLQHPELLEEADEALQTLYKTDSIKRAKRLLSEVGGSV 462
            PLT ++E++      E+ EE +E +  +   + + R ++ L E+   +
Sbjct: 459 DPLTKFQEMIETTVDLEVYEENNEYMIRVEFNEELARIRQKLDELKNDI 507

>Smik_11.106 Chr11 complement(182281..186084) [3804 bp, 1267 aa] {ON}
            YKL129C (REAL)
          Length = 1267

 Score = 31.2 bits (69), Expect = 9.5
 Identities = 19/75 (25%), Positives = 37/75 (49%), Gaps = 4/75 (5%)
 Frame = +1

Query: 376  EADEALQTLYKTDSIKRAKRL----LSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGE 543
            ++D  + TL+KT+ + R K+L    +  +G ++  + Q   +  +R  ++D   K   G+
Sbjct: 889  QSDPLINTLFKTELVTRMKKLNEKIIINIGPTIEYHKQPNKLHTVRSKISDSAPKY--GD 946

Query: 544  ISYPEDIYLTAGASA 588
            I     IY+  G  A
Sbjct: 947  IYRSSTIYVRRGHPA 961

>Ecym_4232 Chr4 complement(484651..488781) [4131 bp, 1376 aa] {ON}
           similar to Ashbya gossypii AGL173W
          Length = 1376

 Score = 31.2 bits (69), Expect = 9.6
 Identities = 21/85 (24%), Positives = 42/85 (49%), Gaps = 4/85 (4%)
 Frame = +1

Query: 715 LREEQNWSTDPEEIEQVVLDAIQKGIKPTCLV-VINPGNPTGAILSEQS---IQKIFEVA 882
           L+   +   + + ++Q  L ++++ +K   LV +IN G P   ILSE S   + K  ++ 
Sbjct: 496 LKHHSHLIPETKPLKQSYLTSVEEKLKSVSLVTLINSGKPNVGILSENSNALLTKAVKIE 555

Query: 883 AKYGIVVIADEVYQENVFKGSKFYS 957
                + ++ E   E++  GS+  S
Sbjct: 556 VTPEPIQVSSEAKTEDIVAGSQLAS 580

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 145,486,020
Number of extensions: 3293161
Number of successful extensions: 11000
Number of sequences better than 10.0: 140
Number of HSP's gapped: 10947
Number of HSP's successfully gapped: 141
Length of query: 529
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 415
Effective length of database: 40,409,475
Effective search space: 16769932125
Effective search space used: 16769932125
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 35 (18.1 bits)