Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19140g8.262ON52752727470.0
Ecym_43088.262ON52943811491e-152
AGR086C8.262ON53438010641e-139
Kwal_56.237998.262ON4883828491e-107
SAKL0H17028g8.262ON5503928241e-103
KLTH0G13684g8.262ON5083828031e-100
KAFR0B055408.262ON5193757642e-94
TDEL0F038908.262ON4763797489e-93
ZYRO0C01650g8.262ON5863426742e-80
Skud_4.3718.262ON5803946611e-78
Smik_4.3568.262ON5763946601e-78
Suva_2.2708.262ON6323836606e-78
YDR110W (FOB1)8.262ON5663946433e-76
NDAI0J013808.262ON6243686456e-76
NCAS0B038508.262ON5883656296e-74
Kpol_392.68.262ON4573805935e-70
Kpol_543.388.262ON4423545724e-67
CAGL0B01771g8.262ON5364005463e-62
KNAG0H032408.262ON5194194999e-56
TBLA0E044308.262ON4813884714e-52
TPHA0A018108.262ON4573834337e-47
TPHA0J007408.262ON4083834193e-45
TBLA0F030708.262ON4453873601e-36
NDAI0D03010na 1ON778270880.046
KNAG0F018106.243ON558139780.57
Ecym_82415.259ON1308141770.94
Kpol_1037.226.29ON1496112732.7
KLLA0B07799g4.219ON122798705.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19140g
         (527 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...  1062   0.0  
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   447   e-152
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   414   e-139
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   331   e-107
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   322   e-103
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   313   e-100
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   298   2e-94
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   292   9e-93
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   264   2e-80
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   259   1e-78
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   258   1e-78
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   258   6e-78
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   252   3e-76
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   253   6e-76
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   246   6e-74
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   233   5e-70
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   224   4e-67
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   214   3e-62
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   196   9e-56
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   186   4e-52
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   171   7e-47
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   166   3e-45
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   143   1e-36
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    39   0.046
KNAG0F01810 Chr6 complement(342010..343686) [1677 bp, 558 aa] {O...    35   0.57 
Ecym_8241 Chr8 complement(495524..499450) [3927 bp, 1308 aa] {ON...    34   0.94 
Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON} (46639...    33   2.7  
KLLA0B07799g Chr2 complement(682960..686643) [3684 bp, 1227 aa] ...    32   5.8  

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score = 1062 bits (2747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/527 (97%), Positives = 513/527 (97%)

Query: 1   MNISDTADKTTNKEKSGTTDEMTSEKDKLLGIRSPEGEVALYPASASTESTEPDFKFVLP 60
           MNISDTADKTTNKEKSGTTDEMTSEKDKLLGIRSPEGEVALYPASASTESTEPDFKFVLP
Sbjct: 1   MNISDTADKTTNKEKSGTTDEMTSEKDKLLGIRSPEGEVALYPASASTESTEPDFKFVLP 60

Query: 61  VKGFDLGSFCGELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLLRASDK 120
           VKGFDLGSFCGELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLLRASDK
Sbjct: 61  VKGFDLGSFCGELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLLRASDK 120

Query: 121 VTNSTVENKFVLLKRRYYVQENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIY 180
           VTNSTVENKFVLLKRRYYVQENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIY
Sbjct: 121 VTNSTVENKFVLLKRRYYVQENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIY 180

Query: 181 NELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHVEIFAPF 240
           NELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHVEIFAPF
Sbjct: 181 NELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHVEIFAPF 240

Query: 241 DSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRM 300
           DSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRM
Sbjct: 241 DSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRM 300

Query: 301 PIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQHKEECLH 360
           PIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQHKEECLH
Sbjct: 301 PIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQHKEECLH 360

Query: 361 DWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGHHVVQFE 420
           DWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGHHVVQFE
Sbjct: 361 DWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGHHVVQFE 420

Query: 421 EAGGMIYLEDENSPNLLLXXXXXXXXXXXXXXIFDELASSRDGTPISEQPSPHRTNMNYD 480
           EAGGMIYLEDENSPNLLL              IFDELASSRDGTPISEQPSPHRTNMNYD
Sbjct: 421 EAGGMIYLEDENSPNLLLSGDDNSEESEHDSEIFDELASSRDGTPISEQPSPHRTNMNYD 480

Query: 481 GINQESEKHRITKKRSKKVRRPLDQDKHATRASVYNPYNIADVSMEL 527
           GINQESEKHRITKKRSKKVRRPLDQDKHATRASVYNPYNIADVSMEL
Sbjct: 481 GINQESEKHRITKKRSKKVRRPLDQDKHATRASVYNPYNIADVSMEL 527

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  447 bits (1149), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 225/438 (51%), Positives = 294/438 (67%), Gaps = 30/438 (6%)

Query: 42  YPASASTESTEPDFKFV------LPVKGFDLGSF--CGELDQDMLIEGRLQLEKEINTVK 93
           Y A   ++ +E  F F         V  FDL  +    ELD D L  GR +L K INTVK
Sbjct: 12  YDAQVGSDGSESFFVFQKITEEGFKVPRFDLNVYQLAPELDHDWLDTGRNELIKLINTVK 71

Query: 94  GQLTQPIYDLLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYVQENLLHDVKRKDLV 153
           GQLTQ IY+L+ S+ L+ + LL   DKVT  TVENKFVLLKRRY + +  + D KR+DL 
Sbjct: 72  GQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSILQGNVVDHKREDLP 131

Query: 154 VYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKIS 213
           V EP+ +FD+IM+ H++N H+  + I+  L   YANVT+ F  LVT +CS CN   N   
Sbjct: 132 VIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCNTDRNMKR 191

Query: 214 YKKFKHENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYV 273
           + ++KH N++  ++PL RCHVEIFAPFD    GN+     KIE KY  VLYCRDY+SR+V
Sbjct: 192 FLRYKHYNVYDKVMPLERCHVEIFAPFDD--DGNE-----KIEDKYSHVLYCRDYHSRFV 244

Query: 274 WLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGM 333
           W+ PL+ +T  DL+P +T+LL SMIR+PIF++T TLDRQDMFDVCE IAR YK+KIGLG+
Sbjct: 245 WMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGL 304

Query: 334 NSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQ 393
           NS T FQ+ G+ R+K+LF +HKE+C+ +WNMCL+LV++R+NQNYSDRVRG+PSDLLC+  
Sbjct: 305 NSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEI 364

Query: 394 QDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIYLEDENSPNLLLXXXXXXXXXXXXXXI 453
            ++  KF+  QR +I  L  HHVVQF EAGGMIYLED+NS  ++                
Sbjct: 365 SNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNSAFVVDE-------------- 410

Query: 454 FDELASSRDGTPISEQPS 471
            DE     D  P++E PS
Sbjct: 411 -DEHGPENDNVPVTESPS 427

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  414 bits (1064), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 202/380 (53%), Positives = 267/380 (70%), Gaps = 7/380 (1%)

Query: 54  DFKFVLPVKGFDLGSFCGELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKEN 113
           D  F +P    +L    G L+ + +  GR +L K + TVKGQLTQ IYDL+ SD L+ + 
Sbjct: 26  DEGFKVPQTDLNLYQLDGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQK 85

Query: 114 LLRASDKVTNSTVENKFVLLKRRYYVQENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSH 173
           LL   DKVT +TVENK+VLLKRRY  +  ++ D KRKD  V EP+ LFD+IMS H++N H
Sbjct: 86  LLECCDKVTPNTVENKYVLLKRRYVAKGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDH 145

Query: 174 VSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCH 233
           +  + +Y  +   YANVT+    +VT +CS CN   +   + ++KH N+H  L+PL RCH
Sbjct: 146 MPWRKVYQHMKGLYANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCH 205

Query: 234 VEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKL 293
           VE+FAPFD   +G +     KI+GKY   LYCRDY+SR++WL PL+ +    LLP + +L
Sbjct: 206 VEVFAPFDD--EGVE-----KIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQL 258

Query: 294 LFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQ 353
           L +MIR+PIF++T TLDRQDMFD+CE IAR YK KIGLG+NS T FQK GIKR+K L  +
Sbjct: 259 LCTMIRVPIFLETATLDRQDMFDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSE 318

Query: 354 HKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLG 413
           +KEEC  DWNMCL+LV+SR+NQ Y+DRVRG+PSDLLC+   ++  KF+  Q+ +I +L  
Sbjct: 319 YKEECQDDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNEIPNISMKFKQKQKKIIDQLYA 378

Query: 414 HHVVQFEEAGGMIYLEDENS 433
           HHVV F+EAGGMIYLEDE S
Sbjct: 379 HHVVHFKEAGGMIYLEDEES 398

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  331 bits (849), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 170/382 (44%), Positives = 238/382 (62%), Gaps = 15/382 (3%)

Query: 56  KFVLPVKGFDLGSFCGELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLL 115
           KF +P  G  L  +   L+ ++L  GRL   K   +VKGQLTQ  +DL+ S ALT ENL+
Sbjct: 18  KFRMPKVGETLEKYGNGLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLM 77

Query: 116 RASDKVTNSTVENKFVLLKRRYYV-QENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHV 174
             SDK+ +  +E KF+LLKRR+YV  +  + D K  D VV EP  LFDLIM  H+ N H+
Sbjct: 78  STSDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHI 137

Query: 175 SSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHV 234
             + +++ L   YAN T++F ++   +CS+CN       Y+KF+H NI++ L+PL R HV
Sbjct: 138 HWRRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHV 197

Query: 235 EIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLL 294
           EI APF              IEG Y  VLY RDYYSR+VW++PL S  +S++       L
Sbjct: 198 EIIAPFPKL-----------IEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFL 246

Query: 295 FSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQH 354
            S+ R+PIF++T TL RQD+F+VCENIA  Y + IGLGM+ ST+FQ+ G++R++ L  Q+
Sbjct: 247 LSLPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQN 306

Query: 355 KEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGH 414
           +E CL  W+MCLK  V+  N  Y+ RV G+P +LL ST  D  ++F   +  +I +L   
Sbjct: 307 EEPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFAS 366

Query: 415 HVVQFEEAG---GMIYLEDENS 433
           +VV+    G   GMIYLEDE+S
Sbjct: 367 NVVELRNEGRRRGMIYLEDESS 388

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  322 bits (824), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 169/392 (43%), Positives = 245/392 (62%), Gaps = 10/392 (2%)

Query: 43  PASASTESTEPDFKFVLPVKGFDLGSFCGELDQDMLIEGRLQLEKEINTVKGQLTQPIYD 102
           P S    S   +  +V P  G    ++  +L+ ++L  G     K + +VKGQLTQ  Y+
Sbjct: 12  PKSKDVCSKPTNNDYVTPKLGESQVTYSTDLNVELLERGGRDFIKYLESVKGQLTQAQYE 71

Query: 103 LLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYV-QENLLHDVKRKDLVVYEPNELF 161
           L+ +D LT E LL  +D +  S  E K++ LKRRYYV  + ++ D KR D +V EP  ++
Sbjct: 72  LIKTDTLTLETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMY 131

Query: 162 DLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHEN 221
           +LI+S H+LN+H+  + ++  L + Y+N+T+ F ++   +CS+CN       + KFKH N
Sbjct: 132 ELIVSGHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTN 191

Query: 222 IHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSV 281
            +  L+PL R HVEIF PF         TDEL IE KY  VLYCRDY+SR+VWL PL  +
Sbjct: 192 AYQGLLPLERIHVEIFKPF--------GTDEL-IEEKYSHVLYCRDYHSRFVWLSPLTGI 242

Query: 282 TLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQK 341
           T  +L+P +T+ L S+ R+PIF++T TLDRQDMFD+CE IAR Y++ IGLG+N+S+ F K
Sbjct: 243 TFQELVPQLTEFLLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYK 302

Query: 342 TGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFR 401
            GI+RMK L   +K++C  DW MCLK      N  Y+ R+ G  +DLLC+      KKF+
Sbjct: 303 NGIERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSSCGKKFK 362

Query: 402 TLQRNVISRLLGHHVVQFEEAGGMIYLEDENS 433
             +  +I  L  H+VV  ++ GGM+Y+E+ENS
Sbjct: 363 LKREKIIHELFAHNVVTLKDTGGMVYVENENS 394

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  313 bits (803), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 162/382 (42%), Positives = 241/382 (63%), Gaps = 15/382 (3%)

Query: 56  KFVLPVKGFDLGSFCGELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLL 115
           +F +P  G  +  +   L+ ++L  GRL   K   +VKGQLTQ  +DL+ S +LT++NL+
Sbjct: 18  EFDMPAVGEPIEKYHNGLNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTEDNLM 77

Query: 116 RASDKVTNSTVENKFVLLKRRYYV-QENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHV 174
             SDK+    VE KF+LLKRRYYV  + ++ D K  D VV EP  +FDLIM  H+ N H+
Sbjct: 78  TTSDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNGHL 137

Query: 175 SSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHV 234
             + +++ L   YAN T++F ++   +CS+CN       YKKF+H NI++ L+PL R HV
Sbjct: 138 HWRRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLPLERVHV 197

Query: 235 EIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLL 294
           EI +PF  A           IEG Y  VL+ RDYYSR+VW++PLK   + D+   +   L
Sbjct: 198 EIISPFSEA-----------IEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGLLATL 246

Query: 295 FSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQH 354
             + R+PIFI+T T+DRQD+F+ CE++A  Y + IGLGM+ S++FQK G++R++ L  ++
Sbjct: 247 LLLPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLRYLLQRN 306

Query: 355 KEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGH 414
           +E+CL  W MCLK   +  N NY+ R+ GVP +LL ST  D  ++F   + ++I +L   
Sbjct: 307 EEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLIEKLFAR 366

Query: 415 HVVQFEEAG---GMIYLEDENS 433
           +VV+ + +G   G+IYLEDE S
Sbjct: 367 NVVEIKVSGRRRGIIYLEDETS 388

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  298 bits (764), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 154/375 (41%), Positives = 221/375 (58%), Gaps = 14/375 (3%)

Query: 57  FVLPVKGFDLGSFCGE-LDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLL 115
           +++P  G    S+    ++ ++L  G  ++ K   ++ G LT+  YDL+ +D+LT E L 
Sbjct: 47  YIVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLA 106

Query: 116 RASDKVTNSTVENKFVLLKRRYYVQEN-LLHDVKRKDLVVYEPNELFDLIMSVHVLNSHV 174
             + K T  T E +++ LKRRYY   N L+HD  RKD +V EP  +FD+IM  H++N+H 
Sbjct: 107 STNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHG 166

Query: 175 SSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHV 234
             K I++ LSTFY+N+T+  C     FCS CN        +KFKH NI+  L+PL R H+
Sbjct: 167 FVKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHI 226

Query: 235 EIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLL 294
           EIF PF +           KIE KY  +LYCRDY+SRY+W+ PLK+     L+P M  L 
Sbjct: 227 EIFEPFPNE----------KIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLF 276

Query: 295 FSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQH 354
            S IR PIFI+T +LD QDMFD+CE IA  Y ++IGLG +   +F   GI++MK+    H
Sbjct: 277 LSFIRQPIFIETASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAH 336

Query: 355 KEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGH 414
           +EECL  WN+CLK      N  ++DR  GVP DLL S  Q+   KF+     ++   +  
Sbjct: 337 REECLLSWNLCLKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSE 396

Query: 415 HVVQFEEAGGMIYLE 429
            V++ +   G+I+LE
Sbjct: 397 SVLRVD--NGLIFLE 409

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  292 bits (748), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 145/379 (38%), Positives = 223/379 (58%), Gaps = 13/379 (3%)

Query: 56  KFVLPVKGFDLGSFCGE-LDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENL 114
           +F+ P  G     +    ++ ++L  G   L K   ++ GQ+  PIY+L+ +++LT E L
Sbjct: 38  QFLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETL 97

Query: 115 LRASDKVTNSTVENKFVLLKRRYYVQENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHV 174
              SDK    + E+K++ L RRYY +  ++ D ++ D +V EP  +FDLIM  H++N H+
Sbjct: 98  ASNSDKWDKDSAESKYMFLMRRYYAENGIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHM 157

Query: 175 SSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHV 234
           + + IY  L+  Y+N+T+ F ++   +CS CN  G+    +K++H+NI   L+PL R H+
Sbjct: 158 TYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHI 217

Query: 235 EIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLL 294
           EIF  FD+            I  K+  VLYCRDY++R+VWL PLK+     L+  +  LL
Sbjct: 218 EIFEVFDNE----------SISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLL 267

Query: 295 FSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQH 354
             M  +PIF+++ TLD+QD+FD+CE +   Y +K+GLG NSS+ F   GIKRMK L    
Sbjct: 268 LGMTYVPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTR 327

Query: 355 KEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGH 414
           K +C+ DWNMCL+     LN+ ++    G+P+DLL  +     K FR  Q  +I  L   
Sbjct: 328 KVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQ 387

Query: 415 HVVQFEEAGGMIYLEDENS 433
           +VV   +  G++YLEDENS
Sbjct: 388 NVVHVNK--GLLYLEDENS 404

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  264 bits (674), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 136/342 (39%), Positives = 203/342 (59%), Gaps = 15/342 (4%)

Query: 91  TVKGQLTQPIYDLLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYVQE--NLLHDVK 148
           TV GQLTQ IY+L+ SD L+  NL R   K    + E ++  L+ RY+V E   ++ D K
Sbjct: 73  TVAGQLTQQIYELIRSDTLSIANLERCH-KWKGESSEIEYYYLRSRYFVSEENGMVCDRK 131

Query: 149 RKDLVVYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNES 208
           R D +V EP  +F L+M  H+ N+HV+S  I+  L   YAN+T+ +     S+CSKCN  
Sbjct: 132 RDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPD 191

Query: 209 GNKISYKKFKHENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDY 268
                ++K +H+N++  L+PL R H+E+F PFD            KI+G++  +LY RDY
Sbjct: 192 LKAKPFQKKRHKNVYWELLPLERVHIEVFEPFDGE----------KIQGRFSHLLYFRDY 241

Query: 269 YSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIK 328
           +SRYVW+ PL++     ++  M+  L  + R+PIF+++ T+DR+ +FD+C  IA  Y +K
Sbjct: 242 FSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLCGQIAEHYSLK 301

Query: 329 IGLGMNSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDL 388
           +GLG+ +S  F   GIK MK L   HKEECL DWN+CLK     +NQN +    G P DL
Sbjct: 302 LGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNINVSSDGRPGDL 361

Query: 389 LCSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIYLED 430
           L ++  D ++KF   + +VI       VV   E  G+++LE+
Sbjct: 362 LFTSVPDCNRKFVKKRNDVILDTPSQQVVHLGE--GVLFLEN 401

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  259 bits (661), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 138/394 (35%), Positives = 218/394 (55%), Gaps = 14/394 (3%)

Query: 44  ASASTESTEP--DFKFVLPVKGFDLGSFCGE-LDQDMLIEGRLQLEKEINTVKGQLTQPI 100
            ++  ES EP  D   +LP  G    ++    L+ ++L  G  +    + ++  QLTQ I
Sbjct: 34  TTSPRESREPLKDRLLILPSMGESYTAYVDSYLNLELLERGERETPIFLESLTRQLTQQI 93

Query: 101 YDLLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYV-QENLLHDVKRKDLVVYEPNE 159
           Y+L+ + +LT + L + SDK      ENK + L+R+YYV  E  + D +  D +  EP  
Sbjct: 94  YELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKH 153

Query: 160 LFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKH 219
           ++D++M+ H++N H+  K +++ L + +AN + +    V  FCSKCN+ G     K++K 
Sbjct: 154 IYDMVMATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKR 213

Query: 220 ENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLK 279
            +++  L+P+ R H+E+F PF              IEGKYP+VL CRDY S ++WL PLK
Sbjct: 214 PDMYDKLLPMERIHIEVFEPFTGG----------AIEGKYPYVLLCRDYRSSFMWLLPLK 263

Query: 280 SVTLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSF 339
           S     L+PV++ L  S  R+PIF+ + TLD+ D++D+CE IA  Y + IGLG+ SS  F
Sbjct: 264 STKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLCIGLGLKSSARF 323

Query: 340 QKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKK 399
              GI  ++     +KEECL DW  CL+    R N+  + R +  P+ +L S     + K
Sbjct: 324 HTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRRRNKRTKRKPAQVLLSEVPGHNAK 383

Query: 400 FRTLQRNVISRLLGHHVVQFEEAGGMIYLEDENS 433
           F T +  VI      ++ +     G+IYLED N+
Sbjct: 384 FETKRERVIENTYSRNMFKMAGGKGLIYLEDVNT 417

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  258 bits (660), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 138/394 (35%), Positives = 220/394 (55%), Gaps = 14/394 (3%)

Query: 44  ASASTES--TEPDFKFVLPVKGFDLGSFCGE-LDQDMLIEGRLQLEKEINTVKGQLTQPI 100
           A++S ES  +  D   +LP  G     +    L+ ++L  G  +    + ++  QLTQ I
Sbjct: 33  ATSSRESRDSSKDRLLILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKI 92

Query: 101 YDLLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYVQ-ENLLHDVKRKDLVVYEPNE 159
           Y+L+ + +LT + L + SDK      ENK + L+R+YYV  E  + D +  D +  EPN 
Sbjct: 93  YELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNH 152

Query: 160 LFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKH 219
           ++D++M+ H++N H+  K +++ L +++AN++ +    V  FCSKCN+ G     K++K 
Sbjct: 153 IYDMVMATHLINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKR 212

Query: 220 ENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLK 279
            +++  L+P+ R H+E+F PF              IEGKY +VL CRDY S ++WL PLK
Sbjct: 213 PDMYDKLLPMERIHIEVFEPFSGE----------TIEGKYSYVLLCRDYRSSFMWLLPLK 262

Query: 280 SVTLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSF 339
           S     L+PV++ L  S  R+PIF+ + TLD+ D++D+CE IA  Y ++IGLG+ SS  F
Sbjct: 263 STKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARF 322

Query: 340 QKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKK 399
              GI  +      +KEECL DW  CL+    R N+  + R +  P+ +L S     + K
Sbjct: 323 HTGGILCIHYALNSYKEECLADWGKCLRYGPYRFNRRRNKRTKRKPAQVLLSEIPGHNAK 382

Query: 400 FRTLQRNVISRLLGHHVVQFEEAGGMIYLEDENS 433
           F T +  VI      ++ +     G+IYLED N+
Sbjct: 383 FETKRERVIENTYSRNMFKTAGGKGLIYLEDVNT 416

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  258 bits (660), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 134/383 (34%), Positives = 213/383 (55%), Gaps = 12/383 (3%)

Query: 57  FVLPVKGFDLGSFCGE-LDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLL 115
            +LP+ G     +    L+ ++L  G  +    + ++  QLTQ IY+L+ + +LT E L 
Sbjct: 99  LILPLMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQ 158

Query: 116 RASDKVTNSTVENKFVLLKRRYYV-QENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHV 174
           + SDK      ENK + L+R+YYV  E  + D +  D +  EP  ++D++M+ H++N H+
Sbjct: 159 QISDKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHL 218

Query: 175 SSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHV 234
             K +++ L + +AN + +    V  FCSKCN+ G     K++K  +++  L+P+ R H+
Sbjct: 219 RGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHI 278

Query: 235 EIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLL 294
           E+F P+              IEGKYP+VL CRDY S ++WL PLKS     L+PV++ L 
Sbjct: 279 EVFEPYGGK----------AIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLF 328

Query: 295 FSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQH 354
            S  R+PIF+ + TLD+ D++D+CE IA  Y ++IGLG+ SS  F   GI  ++     +
Sbjct: 329 LSFARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSY 388

Query: 355 KEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGH 414
           KEECL DW  CL+    R N+  + R +  P+ +L S     + KF T +  VI      
Sbjct: 389 KEECLADWGKCLRYGPYRFNRRRNKRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYAR 448

Query: 415 HVVQFEEAGGMIYLEDENSPNLL 437
           ++       G+IYLED N+  L+
Sbjct: 449 NMFTMAGGKGLIYLEDVNTFALV 471

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  252 bits (643), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 135/394 (34%), Positives = 218/394 (55%), Gaps = 14/394 (3%)

Query: 44  ASASTESTEP--DFKFVLPVKGFDLGSFCGE-LDQDMLIEGRLQLEKEINTVKGQLTQPI 100
           A++  ES E   D   +LP  G     +    L+ ++L  G  +    + ++  QLTQ I
Sbjct: 31  ATSPGESRESSKDRLLILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKI 90

Query: 101 YDLLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYVQ-ENLLHDVKRKDLVVYEPNE 159
           Y+L+ + +LT + L + SDK      ENK + L+R+YYV  E  + D +  D +  EP  
Sbjct: 91  YELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKH 150

Query: 160 LFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKH 219
           ++D++M+ H++N H+  K +++ L + +AN++ +    V  FCSKCN+ G     K++K 
Sbjct: 151 VYDMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKR 210

Query: 220 ENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLK 279
            +++  L+P+ R H+E+F PF+             IEGKY +VL CRDY S ++WL PLK
Sbjct: 211 PDMYDKLLPMERIHIEVFEPFNGE----------AIEGKYSYVLLCRDYRSSFMWLLPLK 260

Query: 280 SVTLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSF 339
           S     L+PV++ L  +  R+PIF+ + TLD+ D++D+CE IA  Y ++IGLG+ SS  F
Sbjct: 261 STKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARF 320

Query: 340 QKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKK 399
              GI  ++     +K+ECL DW  CL+    R N+  + R +  P  +L S     + K
Sbjct: 321 HTGGILCIQYALNSYKKECLADWGKCLRYGPYRFNRRRNKRTKRKPVQVLLSEVPGHNAK 380

Query: 400 FRTLQRNVISRLLGHHVVQFEEAGGMIYLEDENS 433
           F T +  VI      ++ +     G+IYLED N+
Sbjct: 381 FETKRERVIENTYSRNMFKMAGGKGLIYLEDVNT 414

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  253 bits (645), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 139/368 (37%), Positives = 209/368 (56%), Gaps = 19/368 (5%)

Query: 72  ELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLLRASDKVTNSTVENKFV 131
           E+D D+L  G +       ++ GQL + +Y+L+ + +LT+E L   +    +     +  
Sbjct: 107 EVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETL---AANFPHFHAPTRCA 163

Query: 132 LLKRRYYV-QENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANV 190
           L KRRY    E  + D  R + +V +P  L++++M+ H++N H   +  +  LS+ YAN+
Sbjct: 164 LFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQYRRCHVALSSIYANI 223

Query: 191 TQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHVEIFAPFDSAYQGNDNT 250
           T+ F      FCS CN S       KFKH N +  ++PL R H+EIF PF+         
Sbjct: 224 TRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIEIFEPFNGK------- 276

Query: 251 DELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTCTLD 310
              KIEGKY  V+YCRDY SRY+ LEPLK+    +L+  + KLLF++ R+PIFI+T +L+
Sbjct: 277 ---KIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIETVSLN 333

Query: 311 RQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLKLVV 370
            QD FD+ E I   Y+I +GLGM ++  F   G+K+MK L   H++ECL+DW MCLK   
Sbjct: 334 TQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMCLKYGP 393

Query: 371 SRLNQNYSDRVRGVPSDLL-CSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIYLE 429
              N  ++DR  GVP DLL C+ +   HK     ++ +I  L   ++VQ     G IYLE
Sbjct: 394 HNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQ-IIRTLPKDNIVQI--GNGSIYLE 450

Query: 430 DE-NSPNL 436
           ++   PN+
Sbjct: 451 EKVKDPNI 458

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  246 bits (629), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 133/365 (36%), Positives = 202/365 (55%), Gaps = 17/365 (4%)

Query: 73  LDQDMLIEGRLQLEKEI----NTVKGQLTQPIYDLLHSDALTKENLLRASDKVTNSTVEN 128
           +D+DM +    + E+E      T+ GQL +  Y+L+ +++LT+E L   + K+      +
Sbjct: 95  VDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSATALKMDKFRAAS 154

Query: 129 KFVLLKRRYYVQENL-LHDVKRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFY 187
           + V L RRY + E   + D  R++ +V EP  ++D+IM+ H++N H   +  +  L   Y
Sbjct: 155 RLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHGRPRKCHQLLGPMY 214

Query: 188 ANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHVEIFAPFDSAYQGN 247
           +N+T+ F + +  FCS CN S   I +KK+KH N    L+PL R  VE+F PF       
Sbjct: 215 SNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQVEVFEPFPGE---- 270

Query: 248 DNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTC 307
                 K+ GKYP +LY RDY SR++W+ PL++     L+ +++K++FSMIR+PIF +T 
Sbjct: 271 ------KLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFFETT 324

Query: 308 TLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLK 367
           T++ QD FD+ E I   Y+I IGLG          G+ +++ L   HKEECL DW MCLK
Sbjct: 325 TIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPHKEECLADWIMCLK 384

Query: 368 LVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIY 427
                 N   +DR  GVP DLL     DL+ K       ++  L   ++V+     G IY
Sbjct: 385 YGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKI--GRGCIY 442

Query: 428 LEDEN 432
           LED N
Sbjct: 443 LEDRN 447

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  233 bits (593), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 130/380 (34%), Positives = 213/380 (56%), Gaps = 16/380 (4%)

Query: 56  KFVLP-VKGFD-LGSFCGELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKEN 113
           + VLP +K  D L S  G L++++   G   L K  +T+ G L+Q IYDL+ +D LT + 
Sbjct: 59  ELVLPEIKNLDELISESG-LNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKK 117

Query: 114 LLRASDKVTNSTVENKFVLLKRRYYVQE--NLLHDVKRKDLVVYEPNELFDLIMSVHVLN 171
           + R   K  N + E K+  LK RYYV +    + D +  D ++  PN++ ++++  H++N
Sbjct: 118 VSREKVKWANKSNE-KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLIN 176

Query: 172 SHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGR 231
            H + K ++  L   YAN++++  ++   +CS CN S +    KK K   ++  L+P  R
Sbjct: 177 EHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFER 236

Query: 232 CHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMT 291
            H+EIF PF          DE  IEG Y  +LY RDYYSRYVWL PLK     +L   + 
Sbjct: 237 IHIEIFKPFG---------DEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLV 287

Query: 292 KLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLF 351
              F++ + PI+I++ T++R D+  + + IA  Y ++IG+G+ +S+ F   G++ MK L 
Sbjct: 288 TYFFTITKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLL 347

Query: 352 LQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQ-QDLHKKFRTLQRNVISR 410
           L H++ECL DW MCLK   +  N   + +V G+P +LL ++   +   K+++ +  VI  
Sbjct: 348 LLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDE 407

Query: 411 LLGHHVVQFEEAGGMIYLED 430
              H+++  +     IYLED
Sbjct: 408 TFPHNMIVLDNGKSEIYLED 427

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  224 bits (572), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 120/354 (33%), Positives = 200/354 (56%), Gaps = 16/354 (4%)

Query: 81  GRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLLRASDKVTNSTVEN--KFVLLKRRY- 137
           GR   ++ ++++ G L+Q +Y+L+  D L  + L   S+K   S +    K + LKRRY 
Sbjct: 68  GRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTL---SEKTRWSRINANAKCLYLKRRYK 124

Query: 138 YVQENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKL 197
             ++  + D+ R++ +VYEP+  +D I+S H+LN H+  +GI+  L   Y+N+++ + K+
Sbjct: 125 LTKKGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYIKM 184

Query: 198 VTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEG 257
           V  FCS CN      + +K  H NI+   +PL R  ++IF PF++           KI+ 
Sbjct: 185 VLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFENE----------KIQN 234

Query: 258 KYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDV 317
           +Y  ++Y RDY SR+VW+ PLK+     L   +  LL  + R+PI+IDT T++R+DM  +
Sbjct: 235 RYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTTTIERRDMLAI 294

Query: 318 CENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNY 377
           C+ IA  Y+I +G+G    +SF   G+ R+K L  ++K++CL DWNMCLKL     N+  
Sbjct: 295 CKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKS 354

Query: 378 SDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIYLEDE 431
               RGVPS+L     +     F + +  +I+ L   +  +     G++Y +DE
Sbjct: 355 ITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVYAQDE 408

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  214 bits (546), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 128/400 (32%), Positives = 208/400 (52%), Gaps = 13/400 (3%)

Query: 43  PASAST-ESTEPDF--KFVLPVKGFDLGSF-CGE---LDQDMLIEGRLQLEKEINTVKGQ 95
           PA  S   STE +   KFV+P        +  GE   +D D L  G   + +    + G+
Sbjct: 43  PAGTSNMSSTELELYNKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGK 102

Query: 96  LTQPIYDLLHSDALTKENLLRASDKVTNSTVENKFV-LLKRRYYVQENLLHDVKRKDLVV 154
           LTQ  Y LL ++ LT E +++A +    +  E K+  L+KR Y  +E  + D K  + +V
Sbjct: 103 LTQETYTLLMNNNLTMETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIV 162

Query: 155 YEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISY 214
            EP++LF+LI++ H+ N H+ +  ++  L   YAN T+ F +    +C++CN        
Sbjct: 163 LEPDKLFNLILTAHLKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPI 222

Query: 215 KKFKHENIHANLIPLGRCHVEIFAPFDSA----YQGNDNTDELKIEGKYPFVLYCRDYYS 270
           +K +H NI+  L+PL R H+E+FAPF+       Q +     +KIEGKY  V YCRD+ +
Sbjct: 223 EKVRHRNINEELLPLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRT 282

Query: 271 RYVWLEPLKSVTLSDLLP-VMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKI 329
           RYVW  PLK++    L+  + T  +  +   PIF+++ T+DR D+ ++ E +A  Y +K+
Sbjct: 283 RYVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKL 342

Query: 330 GLGMNSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLL 389
           GLG  + T F   GIKR K+   + K EC  DW MCLK      N+    ++    + L 
Sbjct: 343 GLGFANFTKFHAQGIKRFKTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKASNILF 402

Query: 390 CSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIYLE 429
                   +  R  +   I +    ++  + ++GG I++E
Sbjct: 403 TELMGQFERDMRKKKLKYIEQSFSENIKTYPKSGGCIFIE 442

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  196 bits (499), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 131/419 (31%), Positives = 206/419 (49%), Gaps = 28/419 (6%)

Query: 47  STESTEPDFKFVLPVKGFDLGSFCGE-LDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLH 105
           S+ STE + K V PV G    ++  E LD +    G   +     T  G+++Q +Y L  
Sbjct: 25  SSFSTETNPKLV-PVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFK 83

Query: 106 SDALTKENLLRASDKVTNSTVENKFVLLKRRYYVQEN-LLHDVKRKDLVVYEPNELFDLI 164
           +D +TKEN+ R      +     K + + RRYY   N ++ D    + +VY+P   FD+I
Sbjct: 84  NDDVTKENIARLYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDII 143

Query: 165 MSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHA 224
           MS H++N H+ S+ +Y  L  FYAN      K    +CS CN S  K++ K      +  
Sbjct: 144 MSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSL-KLTPKVQPKPYLFE 202

Query: 225 NLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLS 284
             +PL R  +EI  PF +           K+EGKY  ++  +D+  R+ WLEPLK+    
Sbjct: 203 KALPLERITIEIIEPFPNE----------KVEGKYSNMVVMKDFIGRFEWLEPLKNTKFK 252

Query: 285 DLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGI 344
           +++PV+ K++ S  R+PI++++ TLD  D+FD+ E I   Y IKIGLG  + +S  +   
Sbjct: 253 NIVPVVAKMILSFPRVPIWVESNTLDWSDLFDIFEMIVTKYGIKIGLGCTTRSSAAQ-AT 311

Query: 345 KRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQ 404
            R+      H +ECL D+N CLK   ++ NQ         P D++  ++  L  KFR  +
Sbjct: 312 ARINRDLNDHHDECLFDFNNCLKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKR 371

Query: 405 RNVISRLLGHHVVQFEEAGGMIYLEDENSPNLLLXXXXXXXXXXXXXXIFDELASSRDG 463
             ++       V+      G +YLE   SPN +                 DEL+S++D 
Sbjct: 372 AFILKHSPSSCVMN--RGMGTLYLE---SPNGIQEDAAASSA--------DELSSAKDA 417

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  186 bits (471), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 120/388 (30%), Positives = 204/388 (52%), Gaps = 33/388 (8%)

Query: 65  DLG-SFCGELDQ-------DMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLLR 116
           DLG S+   LD+       ++L +G   +++  +     LTQ   D+L++  L+ EN+++
Sbjct: 34  DLGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIK 93

Query: 117 ASDKVTN-STVENKFVLLKRRYYVQE-NLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHV 174
              K+TN S    K+    RRYY+ E N + D ++   ++ EP  ++D++++ H L  H 
Sbjct: 94  YDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYH-LKLH- 151

Query: 175 SSKGIYNELSTFYANVTQSFCKLVTSFCSKC--NES------GNKISYKKFKHENIHANL 226
           SS  +   L  F++NV + +      +CSKC  +E+       + I++K  ++  I   L
Sbjct: 152 SSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPL 211

Query: 227 IPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDL 286
            P+ R H+EIF PFD          +LKIE KY  +LY RDY +RY+W   LK + L  +
Sbjct: 212 FPMERIHIEIFNPFD----------DLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHI 261

Query: 287 LPVMTKLLFSM-IRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSS-TSFQKTGI 344
             ++T+   S+   +PIF+ + T+D  D+FD+CE I+R Y I +GLG N+    F  +GI
Sbjct: 262 TNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGI 321

Query: 345 KRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLL-CSTQQDLHKKFRTL 403
           +  K L   +K +CL  W+  L       N  ++ R+   P D++ C+      KKFR  
Sbjct: 322 EMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDR 381

Query: 404 QRNVISRLLGHHVVQFEEAGGMIYLEDE 431
           +  +I + +  + V+      +I++EDE
Sbjct: 382 RLRIIKQTITDNYVKLGNVASIIFIEDE 409

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  171 bits (433), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 109/383 (28%), Positives = 195/383 (50%), Gaps = 19/383 (4%)

Query: 54  DFKFVLPVKGFDLGSFCGEL-DQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKE 112
           + K+++P  G    S    L D+ +L +G + +    N+    L++ +YDL+ +D LT++
Sbjct: 28  NIKYIIPRIGQKYDSLITPLLDKQLLQKGEIAVA---NSKTNYLSKELYDLVKNDDLTRK 84

Query: 113 NLLRASDKVTNSTVENKFVLLKRRYYVQENLL-HDVKRKDLVVYEPNELFDLIMSVHVLN 171
           N+  A +    + +  + + LK RYY    L+ HD  +++ +V +P   F ++M+ H+LN
Sbjct: 85  NVAVALNLDEKNAI-TRLIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLN 143

Query: 172 SHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGR 231
            H++   IY  LS  +AN++  F K    +CS CN +   I  KK    +   +++   R
Sbjct: 144 DHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYER 203

Query: 232 CHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMT 291
             +++ APF +           KI+ +Y  +L   D++++++W  PLK++ L  ++  +T
Sbjct: 204 LILDVVAPFGAK----------KIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVT 253

Query: 292 KLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGM-NSSTSFQKTGIKRMKSL 350
           + + ++   P+FI + TL   D+F++C  +AR Y I IGLG  N   ++ K     +  +
Sbjct: 254 EFIVALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKNPY--VTRI 311

Query: 351 FLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISR 410
              HK ECL  W MCLK +  R + +  D      +  L S   D  KK+    + +I R
Sbjct: 312 LNSHKTECLKSWFMCLKWLADRQSNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGR 371

Query: 411 LLGHHVVQFEEAGGMIYLEDENS 433
           L   + +  +E    IY EDE S
Sbjct: 372 LPSENFINIDEGSHFIYSEDEFS 394

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  166 bits (419), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 111/383 (28%), Positives = 191/383 (49%), Gaps = 27/383 (7%)

Query: 65  DLGSFCGELDQDMLIEGR---LQLEKEINTVKGQLTQPIYDLLHSDALTKENLLRA-SDK 120
           +LGS   ++D + +  GR   LQLE   ++    LTQ +Y L+       E    A    
Sbjct: 34  ELGS---DIDIERINHGRNDHLQLESVFSSF---LTQKMYTLIREKNFNYETFEEAMKSH 87

Query: 121 VTNS-----TVENKFVLLKRRYYVQENLLHDVKRKDL-VVYEPNELFDLIMSVHVLNSHV 174
            T+S     T   KF+L++ RY + E      KR D  ++  PN+++DLIM  H LN H+
Sbjct: 88  YTDSGKYMGTANKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHL 147

Query: 175 SSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHV 234
            S  I++ L   Y+N++++  +L    CS CN        +  +H +   N     + HV
Sbjct: 148 GSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCDKNF-AFEKIHV 206

Query: 235 EIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMTKLL 294
           EIF PF+         D      K+  V+Y RDY++RYVWL PL+ +++ +L   +   L
Sbjct: 207 EIFQPFE---------DVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHL 257

Query: 295 FSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQH 354
              +R+PI+I++ TLD  ++  + + I++   + +G+G      FQ +GI  MK LF+Q+
Sbjct: 258 LLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQN 317

Query: 355 KEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGH 414
           +E C ++WN  +    +  N  Y+  + G+P +L+       +K ++  ++  I   L  
Sbjct: 318 REYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLADNKTYKKKRQRTILLTLSK 377

Query: 415 HVVQFEEAGGMIYLED-ENSPNL 436
           + +  +     +Y E  ENS +L
Sbjct: 378 NTILLKNGKSALYKESTENSIDL 400

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  143 bits (360), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 111/387 (28%), Positives = 192/387 (49%), Gaps = 21/387 (5%)

Query: 54  DFKFVLPVKGFDLGSFCGELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKEN 113
           DF F  P+   D   +   +D DML  G  +  +  NT+K  +T  +Y  +  ++L +++
Sbjct: 27  DF-FCPPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDD 85

Query: 114 L-LRASDKVTNSTVENKFVLLKRRYYVQENLLHDVKRKDLVVYEPNELFDLIMSVHVLNS 172
             + AS K+  S    K + L+ RY    +      + + ++ EP  ++ L M  H +N+
Sbjct: 86  APIPASLKIKTS----KKMYLQIRYSKNSDGDLIETKTNKLLCEPKYIYKLTMKAHFMNN 141

Query: 173 HVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYK-KFKHENIHANLIPLGR 231
           H+ S  +Y  LS  Y N+      LV  +CS CN +G     +  +   N + + +PL R
Sbjct: 142 HMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLER 201

Query: 232 CHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMT 291
             ++I  PF        N  ++KI  KY  +L  RDY+SRY W+ PLKS  + ++   + 
Sbjct: 202 LQIDITKPF--------NDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELG 253

Query: 292 KLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTS--FQKTGIKRMKS 349
           K L ++ R PIF+ +  +    +  +   I   YKIKI +G+       F + GI R+  
Sbjct: 254 KFLVTLPRTPIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVY 313

Query: 350 L--FLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQ-DLHKKFRTLQRN 406
           L    ++KE+C  DW  C++    + N+ + DR  G  ++ L   Q+ +L+K F   +  
Sbjct: 314 LLNLKENKEKCKSDWYQCIRNTTFKENRRF-DRNTGSFANFLIGKQKAELNKVFENKRDA 372

Query: 407 VISRLLGHHVVQFEEAGGMIYLEDENS 433
           ++S LL  +V++  E G +IY ++ NS
Sbjct: 373 LLSDLLEENVLKIGECGSIIYFDNNNS 399

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 70/270 (25%), Positives = 107/270 (39%), Gaps = 43/270 (15%)

Query: 69  FCGELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKENLLRASDKVTNSTVEN 128
           F  E+  ++LI G+L     +  +  +   P+ + L +  L +   LR   K    T   
Sbjct: 81  FMNEMYAELLIRGKLTPRIIVEEIYKRYGIPLKNELQTKVLQR---LRGRCKRMRLTY-- 135

Query: 129 KFVLLKRRYYVQENLLHDVKRKDLVVYEPNELFDLIMSVH--------VLNSHVSSKGIY 180
           KF   K  +    N      +K L+   P  L  +I  VH         L  H     I 
Sbjct: 136 KFEDGKLFFTSPHN------KKKLIWCPPTLLHYVIACVHENWDCDDYTLRKHRDENEIQ 189

Query: 181 NELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGR-----CHVE 235
           + L+  Y N+++     V + C  C      +S KKF    +  N++PL R       V+
Sbjct: 190 SILAAKYHNISKFLIHDVVAACPDCK----PLSSKKFNITRV--NVLPLTRYSFQRLQVK 243

Query: 236 IFAPFD-SAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVT-LSDLLPVMTKL 293
           I +  D S     DN  +  I       LY  DY+S  VWL  L      +D+L V+   
Sbjct: 244 ILSAADYSCVCPKDNCTKNAI-------LYIGDYHSGAVWLFALDGEEDATDILLVLEMF 296

Query: 294 LFSMIRMPIFIDTCTLDRQDMFDVCENIAR 323
           L  ++  P  I    +D Q +F   ENIA+
Sbjct: 297 LNVVLITPKHIQ---VDNQKIFRD-ENIAK 322

>KNAG0F01810 Chr6 complement(342010..343686) [1677 bp, 558 aa] {ON}
           Anc_6.243 YMR172W
          Length = 558

 Score = 34.7 bits (78), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 52/139 (37%), Gaps = 18/139 (12%)

Query: 125 TVENKFVLLKRRYYVQENLLHDVKRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIYNELS 184
           T+E +F+ L ++   Q  LL D+K             +   S+   N   ++   +N+ S
Sbjct: 174 TMEEQFLALSKKIESQNGLLQDLKE------------NTSQSIKAQNEMTNTSRQWNQQS 221

Query: 185 TFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGRCHVEIFAPFDSAY 244
            F+A++  SF  +   +    N +G  I +     +       P G      +   D+  
Sbjct: 222 QFFADMLYSFTNVSNKYFKNINSTGISIPHNNHSVDTHTQGYTPNG------YNNMDTQP 275

Query: 245 QGNDNTDELKIEGKYPFVL 263
                T E  I    PFVL
Sbjct: 276 SSTATTVESHINSTTPFVL 294

>Ecym_8241 Chr8 complement(495524..499450) [3927 bp, 1308 aa] {ON}
           similar to Ashbya gossypii ACR059W
          Length = 1308

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 64/141 (45%), Gaps = 13/141 (9%)

Query: 215 KKFKHENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVW 274
           +K K  N   + I L   H+EI  P D+ ++ ND T  L   G      YC +     + 
Sbjct: 809 RKAKSANNTVSCISLNSTHLEI--PPDATFENNDATALLNALG------YCVNLKFLDLS 860

Query: 275 LEP-LKSVTLS---DLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIG 330
             P L S TL+   DLLPV   L+   +    F  T  +   ++  +C ++  +  +   
Sbjct: 861 NNPKLFSQTLAPLTDLLPVFVNLVRIHLDFNNFKSTDIITLAEVLPMCSSLNYLSILGAP 920

Query: 331 LGMNSSTSFQKTGIKRMKSLF 351
           L ++SST+   + IK+  +LF
Sbjct: 921 LDIHSSTALSMS-IKKSTALF 940

>Kpol_1037.22 s1037 (46639..51129) [4491 bp, 1496 aa] {ON}
           (46639..51129) [4491 nt, 1497 aa]
          Length = 1496

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/112 (22%), Positives = 58/112 (51%), Gaps = 18/112 (16%)

Query: 316 DVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLFLQHKE----ECLHDW-NMCLKLVV 370
           ++ E   + +K+ IGLG  S+T +QK     ++ ++ + +     + LH++ ++ + +V+
Sbjct: 794 NMTEEEKQAFKLPIGLGHTSTTIYQKV----IRKVYDKERGFEIIDALHEYPSVAVPVVL 849

Query: 371 SRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEA 422
            RL Q   +  R          Q++ +K +R L++ V  + L H  + F+++
Sbjct: 850 KRLKQKDKEWRRA---------QREWNKVWRELEQKVFFKSLDHLGLTFKQS 892

>KLLA0B07799g Chr2 complement(682960..686643) [3684 bp, 1227 aa]
           {ON} similar to uniprot|P51862 Saccharomyces cerevisiae
           YLR371W ROM2 GDP/GTP exchange protein (GEP) for Rho1p
           and Rho2p mutations are synthetically lethal with
           mutations in rom1 which also encodes a GEP
          Length = 1227

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 44/98 (44%), Gaps = 6/98 (6%)

Query: 103 LLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYVQENLLHDVKRKDLVVYEPNELFD 162
           L++ DA T +  +     +  +   N  +LL R    Q+ L HDV  +  +   PNE+++
Sbjct: 349 LVYRDAFTGQQAIDVICSIIRTNDRNLALLLGRALDAQK-LFHDVIYEHRLRDSPNEVYE 407

Query: 163 LIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTS 200
                   NS V  KGIY   ST   + +QS   +  S
Sbjct: 408 FTG-----NSRVIGKGIYEIGSTNNFSASQSSTTIAPS 440

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 56,342,234
Number of extensions: 2517473
Number of successful extensions: 8020
Number of sequences better than 10.0: 38
Number of HSP's gapped: 8205
Number of HSP's successfully gapped: 38
Length of query: 527
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 413
Effective length of database: 40,409,475
Effective search space: 16689113175
Effective search space used: 16689113175
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)