Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19118g8.261ON57857829750.0
SAKL0H17050g8.261ON58457620330.0
Ecym_43098.261ON57757819430.0
AGR087C8.261ON57757718890.0
TDEL0F038808.261ON57958018180.0
KLTH0G13706g8.261ON58456618130.0
Kpol_543.378.261ON57857317280.0
YLR088W (GAA1)8.261ON61461517240.0
Kwal_56.238048.261ON57857117170.0
Smik_12.1478.261ON61361417110.0
Skud_12.1568.261ON61261316820.0
TBLA0F030808.261ON58357816790.0
NCAS0B038608.261ON58357616610.0
Suva_10.1728.261ON61461516620.0
ZYRO0C01672g8.261ON56958216370.0
KNAG0H032508.261ON58558615740.0
TPHA0A018208.261ON58157015500.0
NDAI0J013908.261ON58357315350.0
CAGL0L12232g8.261ON59157515310.0
KAFR0B055508.261ON55556714360.0
TBLA0A078003.45ON41341742.1
TPHA0J018406.124ON52848706.0
SAKL0F11088g7.336ON497123706.1
NDAI0A019607.336ON53480698.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19118g
         (578 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...  1150   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   787   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   753   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   732   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   704   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   702   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   670   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   668   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   665   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   663   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   652   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   651   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   644   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   644   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   635   0.0  
KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...   610   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   601   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   595   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   594   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   557   0.0  
TBLA0A07800 Chr1 complement(1921256..1922497) [1242 bp, 413 aa] ...    33   2.1  
TPHA0J01840 Chr10 complement(422152..423738) [1587 bp, 528 aa] {...    32   6.0  
SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {...    32   6.1  
NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {O...    31   8.1  

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score = 1150 bits (2975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/578 (97%), Positives = 564/578 (97%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL
Sbjct: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE
Sbjct: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS
Sbjct: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV
Sbjct: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW
Sbjct: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY
Sbjct: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L              LNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL
Sbjct: 361 LATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420

Query: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480
           PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL
Sbjct: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480

Query: 481 LAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQ 540
           LAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQ
Sbjct: 481 LAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQ 540

Query: 541 QLGCWTWYIICLGWYPSWLLVTYASIDAIEVQTPIKKE 578
           QLGCWTWYIICLGWYPSWLLVTYASIDAIEVQTPIKKE
Sbjct: 541 QLGCWTWYIICLGWYPSWLLVTYASIDAIEVQTPIKKE 578

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  787 bits (2033), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/576 (65%), Positives = 462/576 (80%), Gaps = 7/576 (1%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           MALVEKLHRR I +GL+PKFI+ L  LS+ C V+G+ WL   +P+DGQFRRTYISENAL+
Sbjct: 1   MALVEKLHRRFIDMGLLPKFIALLPTLSIFCAVVGVSWLALFIPTDGQFRRTYISENALM 60

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRE+EWN+LRGYRTQ++LF+  S+TH+ N EVS WLQ+FG KTAIY +E+YGE
Sbjct: 61  PSQAYSYFRETEWNVLRGYRTQIELFKK-SSTHERNEEVSSWLQQFGAKTAIYTNEEYGE 119

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           TLYGI HAPRGDGTEAMV+AAPWYN   +YNTGG ALA+SL RFFSRWPVWSKNIIIVLS
Sbjct: 120 TLYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIALAVSLSRFFSRWPVWSKNIIIVLS 179

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           EDP+A+LRSWV AYHTSLDLTGGSIE+A+V+D+PG++D F Y+EIH+DGLNGE PNLDLV
Sbjct: 180 EDPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSNDFFKYVEIHFDGLNGELPNLDLV 239

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           NVAVHI EHEG+KVSLHG+   EL +ND+ SR+KT++LG+K+  LSGIK  +GNE FSGW
Sbjct: 240 NVAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTIILGVKNMALSGIKKSHGNEVFSGW 299

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RI S+TLKA G DGP DITTFGR+PEA+ RSVNNLLEKFHQSFFFYLLLAPR F+SIG+Y
Sbjct: 300 RIHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLEKFHQSFFFYLLLAPRLFVSIGSY 359

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L              LN ILNN+Y  LPLLS YN++++L F ++L  +F T+Q F+Y P 
Sbjct: 360 LPAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFALLGFAVALFVSFITAQAFLYAPQ 419

Query: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480
           P +LL L+ +  ++P++  TR++I+ PFSYR K+FAY+Y ++VLTSLLV+NFSLA  +G 
Sbjct: 420 PELLLSLNVLLLLMPII-FTRVKIRTPFSYRLKSFAYLYFSVVLTSLLVVNFSLAFGLGC 478

Query: 481 LAFPMT--RTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEA 538
           LAFPMT  RTT+    NLR  +KN VLL+ISNPFIA W     V+  L G +VFY L  A
Sbjct: 479 LAFPMTLVRTTS---GNLRARLKNCVLLLISNPFIAIWLFAICVDRELQGVQVFYGLTSA 535

Query: 539 SQQLGCWTWYIICLGWYPSWLLVTYASIDAIEVQTP 574
            + LGCWTW++IC+GW PSWLLV Y+ ID++ +  P
Sbjct: 536 WKDLGCWTWFVICIGWLPSWLLVAYSGIDSVSIVVP 571

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/578 (60%), Positives = 451/578 (78%), Gaps = 2/578 (0%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           MA++EKLHRRI+ +GL+P+ I+ L ++S+ C ++ + WL   LP +GQ+RRTYISENAL+
Sbjct: 1   MAVLEKLHRRIVDMGLVPRIIASLPKISIFCALLSISWLTLFLPLEGQYRRTYISENALM 60

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRESEWNILRGYR +L+  + +   H+ N  V+ W++E+G KT+I  + QYGE
Sbjct: 61  PSQAYSYFRESEWNILRGYRRELENLKDLDI-HERNTIVASWMEEYGAKTSINTNNQYGE 119

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           TLYGI H  RGDGTEAMV+AAPW   +  YN GGAALAISL R+F+RWPVWSKNII+VLS
Sbjct: 120 TLYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAALAISLARYFARWPVWSKNIIVVLS 179

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
            DP+ASLR+WV AYHT LDLTGGSIESA+VLDYPGT+D F Y+EI Y+GLNG  PNLDL+
Sbjct: 180 ADPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTNDYFKYIEIGYNGLNGGLPNLDLI 239

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           N AVHI+EHEG+KVSLHG+PF EL ++ Y  RLKT+L GIKD  L+GIKN  G+EAF+GW
Sbjct: 240 NTAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLLSGIKDMTLAGIKNTTGHEAFNGW 299

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQS+TLKA G DGP D+TTFGRVPEA+ RSVNNLLEKFHQSFFFYLLL+PR F+SIG+Y
Sbjct: 300 RIQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLEKFHQSFFFYLLLSPRSFVSIGSY 359

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L               + ILNN+Y +LPLLSIYNIW++  F ++L+ +F T++ F Y PL
Sbjct: 360 LPAAIALSASFAIASADSILNNEYSKLPLLSIYNIWALFAFAVALMISFVTAEAFAYMPL 419

Query: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480
           P +LL  +   S +   +  + +IQ+PFSYRFKAFA++Y +IVLTSLLV+NF+LA+ +G+
Sbjct: 420 PSLLLAFNVALSFIS-FTVIKYKIQKPFSYRFKAFAHLYFSIVLTSLLVVNFALALAVGV 478

Query: 481 LAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQ 540
           LAFPM+ T T   + ++  ++N +LL+ SNPFIA+W +    E +L+G  +F++LI+A  
Sbjct: 479 LAFPMSLTKTTTNATMQQKLRNSLLLMSSNPFIASWILCQLFEAQLAGTSLFHSLIDAWT 538

Query: 541 QLGCWTWYIICLGWYPSWLLVTYASIDAIEVQTPIKKE 578
           QLGCWTWY++C+GWYPSW+LV Y+SID+I + T  KK 
Sbjct: 539 QLGCWTWYVLCIGWYPSWILVAYSSIDSIPIVTTSKKS 576

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  732 bits (1889), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/577 (59%), Positives = 450/577 (77%), Gaps = 2/577 (0%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           MA++EKLHR+++ +GL+PK I  L+++S +  ++ + WL   LP +GQ+RRTYISENAL+
Sbjct: 1   MAVLEKLHRKVVDMGLVPKIIFSLAKISYVTTLLSVAWLTLFLPMEGQYRRTYISENALM 60

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRESEWNILRGYR+++D  + + T  + N  V+ W++E+G K A+Y+D+++GE
Sbjct: 61  PSQAYSYFRESEWNILRGYRSEIDGMRTL-TADERNRIVASWMEEYGAKAAVYNDDRHGE 119

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           TLY + HA RGDGTEAMV+AAPW     +YNTGG ALA+++ R+FSRWPVWSKNIIIVLS
Sbjct: 120 TLYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVALAVAMGRYFSRWPVWSKNIIIVLS 179

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           EDP ASLRSWV AYHT LDLTGGSIE+AIVLDYPGT+D F ++EI Y+GLNG  PNLDL+
Sbjct: 180 EDPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTNDYFQHVEISYEGLNGGMPNLDLL 239

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           NVAVHI EHEG+KV+LHG P+ EL  + Y SR++ +L GIKD  LSGIK   GNEAFSGW
Sbjct: 240 NVAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLLKGIKDMALSGIKRTSGNEAFSGW 299

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQS+TLKA+G +G  DITTFGRVPEA+ RSVNNLLEKFHQSFFFYLLLAPRYF+SIG+Y
Sbjct: 300 RIQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLEKFHQSFFFYLLLAPRYFVSIGSY 359

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L               + +LNN++  LPL+SIYNIW++L F ++L+ +  T+++F Y P 
Sbjct: 360 LPAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWALLAFSVALLVSAITAEVFFYLPA 419

Query: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480
           P +LL  + + S +P  +  + +IQ+PFS+RFKA AY+Y + VL+SLLV+NF LA ++GL
Sbjct: 420 PALLLAFNVVVSFMP-FALVKYKIQKPFSHRFKAAAYLYFSTVLSSLLVMNFQLAFMVGL 478

Query: 481 LAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQ 540
           LAFPMT   T + +++R  +KN +LL++SNPFI+    V+  EP L+GF VFY+LI+A  
Sbjct: 479 LAFPMTFVRTTVHASVRQKMKNSLLLLLSNPFISICVFVHLFEPELTGFSVFYSLIDAWN 538

Query: 541 QLGCWTWYIICLGWYPSWLLVTYASIDAIEVQTPIKK 577
            LGCWTWY++CLGWYP+W++V Y+SID++ +  P KK
Sbjct: 539 DLGCWTWYVLCLGWYPAWIMVAYSSIDSVPIAAPAKK 575

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/580 (57%), Positives = 440/580 (75%), Gaps = 6/580 (1%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           M+L+ KLHRR+I +GL+PK ++ L  LS+L  V+ +GWL  +LP +G++RRTYISENALL
Sbjct: 1   MSLIGKLHRRVIDLGLVPKIVAALPLLSMLFAVVSVGWLA-LLPLEGRYRRTYISENALL 59

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRE+EWN LRGYRTQ++     ST+ + N EV+ WL+EFGVKTAIY DE++G+
Sbjct: 60  PSQAYSYFRETEWNTLRGYRTQIERLAN-STSRERNEEVAGWLREFGVKTAIYQDEKHGD 118

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           TLYG+ HA RGDGTEA+++AAPW N +   N  G ++ I+L RFFSRWPVWSKNII+VLS
Sbjct: 119 TLYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIALTRFFSRWPVWSKNIIVVLS 178

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           E+PK S+RSWV AYHTSLDLTGGSIE+A+VLDYPG +D FD++EIHYDGLNGE PNLDLV
Sbjct: 179 ENPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYFDHVEIHYDGLNGEEPNLDLV 238

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           N+A+ I EHEG+KVSLHG+   ++  ND+ SRL  ML GIK++ LSG++   GNEAFSGW
Sbjct: 239 NIAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGIKNAALSGLRKVNGNEAFSGW 298

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQ++TLKA G +G HD+TTFGR+PEA+ RS+NNLLEKFHQSFFFY+LLAPRYF+SI +Y
Sbjct: 299 RIQAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFHQSFFFYILLAPRYFVSISSY 358

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L              L+ ++NN Y +LPL S YN+ S+  +CISL+  F  +QLF+ F  
Sbjct: 359 LPCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSMWCISLLGCFGIAQLFLRFDA 418

Query: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480
           P +L+  S + S LPLL + +  I EP +YR K+ A+++ ++VLTSLL++NF LA  MGL
Sbjct: 419 PTILISFSALISFLPLLLKKK--IAEPLAYRLKSVAFLFFSLVLTSLLMVNFFLAFAMGL 476

Query: 481 LAFPMT--RTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEA 538
            AFPMT  RT+++   +LR+ +KN +LL++SNPFIA++      EP L GF VF     A
Sbjct: 477 TAFPMTLVRTSSLNNYSLRIKLKNSILLLLSNPFIASYIFCQCFEPDLPGFTVFTEFATA 536

Query: 539 SQQLGCWTWYIICLGWYPSWLLVTYASIDAIEVQTPIKKE 578
            ++LGCWTW++IC+GW PSWL+V  ++++    Q   +K+
Sbjct: 537 WKELGCWTWFVICIGWLPSWLMVALSTLNTQPAQLDDRKK 576

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/566 (58%), Positives = 437/566 (77%), Gaps = 4/566 (0%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           MAL+EKL RRII +GL+P+ +  L +LS+LC ++G+ WL  +LP +GQ+R TYISENAL+
Sbjct: 1   MALIEKLQRRIIDLGLLPRIVRFLPKLSILCGILGICWLTLLLPLEGQYRHTYISENALM 60

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRE+EWNILRGYRTQ+ + +  S+  + N  V+ W QEFG KTA Y+D+ +G 
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQVLEEKSS-KERNEVVASWFQEFGAKTAFYEDDLHGN 119

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           T+YG+ HAPRGDGTEAMV+AAPWYN + EYN GGAALA +L RFFSRWPVWSKNIIIV S
Sbjct: 120 TMYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAALATALSRFFSRWPVWSKNIIIVFS 179

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           +DP+ASLRSWV AYHTSLDLTGGSIESA+VLDYPG++D F Y+EI+Y GLNGE PNLDLV
Sbjct: 180 DDPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSNDFFKYVEIYYAGLNGELPNLDLV 239

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           NVAVHI EHEG+KVSL+G+   E+++ +Y S++KTM++G+K   LSG+++CYGNEAFSGW
Sbjct: 240 NVAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMMVGVKKMALSGVQSCYGNEAFSGW 299

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQ++ L+A+G DGP DITTFGR+PEA  RSVNNLLEKFHQSFFFYLLLAPRYF+SI +Y
Sbjct: 300 RIQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASY 359

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L              L+ +L +     P  S++N+ +++ F ++L+ +FA S LF ++  
Sbjct: 360 LPAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSAVIGFTVALLLSFALSILFSHWQY 419

Query: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480
             +L+  + + +VLP +   R  I+   SY+FK+ A++Y+++VLTSLLV+NF+LA  +GL
Sbjct: 420 SSLLISCNAVIAVLPAI-FGRQGIEASHSYQFKSVAFLYLSVVLTSLLVINFALAFGIGL 478

Query: 481 LAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQ 540
           LAFP+      + S  R  +KN +LLI+SNPFI+T   VN  EP+LSG ++F+ L++A Q
Sbjct: 479 LAFPLILVKAPMTSRQR--VKNTILLILSNPFISTLLFVNTFEPQLSGLQLFHRLVQAWQ 536

Query: 541 QLGCWTWYIICLGWYPSWLLVTYASI 566
           +LGCWTW ++C+GW PSWLLV  + I
Sbjct: 537 KLGCWTWSVVCIGWLPSWLLVACSGI 562

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/573 (55%), Positives = 422/573 (73%), Gaps = 3/573 (0%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           M+++E L RR+I  GL+PKF++ L +LS+L   + +  L+  LP DGQFRRTYISENAL+
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSV-MLMLYLPMDGQFRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRE+EWNILRGYR ++++    S+  + NA +S WL+EFG+KT++Y +++YG+
Sbjct: 60  PSQAYSYFRETEWNILRGYRKEIEVLSSHSSI-ERNAIMSSWLEEFGLKTSVYKNQEYGD 118

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           +LYG+F+APRGDGTE+MV+A PWYN   E+N  GAAL +SL RF SRWPVWSKNII+V S
Sbjct: 119 SLYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFS 178

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           E+P+ +LRSWV AYHTSLDLTGGSIE+A+VLDYPG SD F+Y+E+HY+G NG  PNLDLV
Sbjct: 179 ENPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLV 238

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           N+A+ IAEHEG+KVSLHGL   E+   DY SRLK + LG K+  L+G++  YGNEAFSGW
Sbjct: 239 NIAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGW 298

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQ+LTLKA+G D  HD+TTFGRV EA+ RS+NNLLEKFHQSFFFY LLAPRYF+SIG+Y
Sbjct: 299 RIQALTLKARG-DTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSY 357

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L              ++  +NN+Y  +   S YN+ S + + +S++  F     F Y+P 
Sbjct: 358 LPAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQ 417

Query: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480
           P +LL  + + S +PL +   L I EP +YR K  +++Y+++V+TSLLV+NF LA  MGL
Sbjct: 418 PLLLLLGNVVISTIPLAAPKNLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGL 477

Query: 481 LAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQ 540
            A+PMT        NLRL  +N +LL ISNPFIA W  +  VE +L G +  Y L++A  
Sbjct: 478 FAYPMTLVMLNNTDNLRLKTRNSILLAISNPFIAFWLFITIVESKLDGIEAIYGLVDAWN 537

Query: 541 QLGCWTWYIICLGWYPSWLLVTYASIDAIEVQT 573
           +LG WTW+I C+GW+PSW+LV  +++   +VQT
Sbjct: 538 KLGSWTWFIFCIGWFPSWILVAISALKVEQVQT 570

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/615 (53%), Positives = 428/615 (69%), Gaps = 40/615 (6%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           MAL+EKLHRRI+ +GL+P+ I+ L  +S+LC + G   +  +LP DGQ+RRTYISENAL+
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISMLCALFGFISIA-ILPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRESEWNILRGYR+Q+     + T+ + N  +  WLQEFG KTAIY++EQYGE
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIKEMVNM-TSMERNNLMGSWLQEFGTKTAIYENEQYGE 118

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           TLYG+ HAPRGDGTEAMV+A PW+N + E+N GGAAL +SL RFFSRWPVWSKNII+V S
Sbjct: 119 TLYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAALGVSLARFFSRWPVWSKNIIVVFS 178

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           E+P+A+LRSWV AYHTSLDLTGGSIE+A+VLDY  T D F+Y+EI YDGLNGE PNLDLV
Sbjct: 179 ENPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTEDFFEYVEISYDGLNGELPNLDLV 238

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           N+A+ I EHEG+KVSLHGLP  +L  N++ SRLK + LGI+D  LSG+K  +GNEAFSGW
Sbjct: 239 NIAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILCLGIRDWALSGVKKPHGNEAFSGW 298

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQS+TLKA G  G HDITTFGR+PEA+ RS+NNLLEKFHQSFFFYLLLAPR F+SI +Y
Sbjct: 299 RIQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L              LN  +NN Y  + L S YN+ ++L + +SLV +F  SQ F+  P 
Sbjct: 358 LPSAVALSIAFAISSLNAFINNAYANISLFSEYNLVALLVWFVSLVISFVVSQAFLLIPS 417

Query: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480
             +L+ +S     LPL+   ++ I EP SYR K  A++Y ++V TSLL++NF++A+++G 
Sbjct: 418 SGLLMTISMASCFLPLILSRKIHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477

Query: 481 LAFPMTRTTTIIESN-------------------------------------LRLSIKNL 503
           LAFPMT   TI+ES+                                      +  +KNL
Sbjct: 478 LAFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEIELVENHMDTTPATPQQQKQKLKNL 537

Query: 504 VLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQQLGCWTWYIICLGWYPSWLLVTY 563
           VLLI++NPFI+      F +    GF +   L+ A   L CW+W+++C+GW P WLL+  
Sbjct: 538 VLLILTNPFISITLFGLFFDDEFHGFDIINKLVSAWLDLKCWSWFVLCIGWLPCWLLILA 597

Query: 564 ASIDAIEVQTPIKKE 578
           +S ++  V    K++
Sbjct: 598 SSFESKSVVVRSKEK 612

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/571 (56%), Positives = 428/571 (74%), Gaps = 14/571 (2%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           MAL+E+L R++I +GL+P+ +  L +LS+LC +IG+ W+  +LP +GQ+R TYISENAL+
Sbjct: 1   MALIERLQRKVIDLGLLPRIVRFLPKLSVLCGIIGIFWVTLLLPLEGQYRHTYISENALM 60

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRE+EWNILRGYRTQ+   +  S+  + N  +  WLQEFGVKTA+Y+DE  G 
Sbjct: 61  PSQAYSYFRETEWNILRGYRTQIQTLENKSSL-ERNEILGSWLQEFGVKTALYEDESCGN 119

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           TLYG+ HAPRGDGTEAMV++APW+N + E+N GG AL ++L R+FSRWPVWSKNII+V S
Sbjct: 120 TLYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVVALARYFSRWPVWSKNIIVVFS 179

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           +DPKASLRSWV AYHTSLDLTGGSIESA+VLDYPG +D F Y+EI+Y GLNGE PNLDLV
Sbjct: 180 DDPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDFFKYVEIYYAGLNGELPNLDLV 239

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           NVA+H+ EHEG+KVSL+G+P  E+   DY +R+KTM++GIK   LSG++ CYGNEAFSGW
Sbjct: 240 NVAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVGIKKMALSGVQRCYGNEAFSGW 299

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQ++ L+A+G  GP DITTFGRVPEA+ RSVNNLLEKFHQSFFFYLLLAPRYF+SI +Y
Sbjct: 300 RIQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKFHQSFFFYLLLAPRYFVSIASY 359

Query: 361 LXXXXXXXXXXXXXXLNQIL-----NNKYGELPLLSIYNIWSILTFCISLVFAFATSQLF 415
           L              L+ +L      ++ G LP     NI +++ F ++L+F+F  S  F
Sbjct: 360 LPAAVAFSVSFIVAALDNVLCQGASTSQSGILP-----NIAAVVGFTVALLFSFTVSVTF 414

Query: 416 VYFPLPRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLA 475
             F  P +L+  S + ++ P+L   R+RIQ  +++R KA AY+Y+++VLTSLLV+NF+LA
Sbjct: 415 ARFHHPVILISWSVMTALAPIL-LNRVRIQSSYAHRLKAVAYLYLSVVLTSLLVVNFALA 473

Query: 476 IVMGLLAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYAL 535
             +GLLAFP+        +  RL  KN +LL++SNPFI+T     F EP L G ++   L
Sbjct: 474 FGIGLLAFPLILVKN--STTPRLLFKNSLLLLLSNPFISTCLFAYFFEPLLPGLQILEQL 531

Query: 536 IEASQQLGCWTWYIICLGWYPSWLLVTYASI 566
           ++A  + GCWTW ++C+GW PSWLL+ Y+S+
Sbjct: 532 VQAWNEFGCWTWCVVCIGWLPSWLLIAYSSM 562

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/614 (53%), Positives = 428/614 (69%), Gaps = 39/614 (6%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           MAL+EKLHRRI+ +GL+P+ I+ L  +S++C + G   +  +LP DGQ+RRTYISENAL+
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIASLPVVSMVCALFGFISIA-ILPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRESEWNILRGYR+Q++    + T+ + N  +  WLQEFG KTAIY++EQYGE
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIEEMVNM-TSMERNNIMGSWLQEFGTKTAIYENEQYGE 118

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           TLYG+ HAPRGDGTEAMV+A PW+N + ++N GGAAL +SL RFFSRWPVWSKNIIIV S
Sbjct: 119 TLYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALGVSLARFFSRWPVWSKNIIIVFS 178

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           E+P A+LRSWV AYHTSLDLTGGSIE+A+V+DY    D F+Y+EI YDGLNGE PNLDLV
Sbjct: 179 ENPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAEDFFEYVEISYDGLNGELPNLDLV 238

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           NVA+ I EHEG+KVSLHGLP  +L  N+Y SRLK + LGI+D  L+G+KN +GNEAFSGW
Sbjct: 239 NVAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCLGIRDWALAGVKNPHGNEAFSGW 298

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQS+TLKA G  G HDITTFGR+PEA+ RS+NNLLEKFHQSFFFYLLLAPR F+SI +Y
Sbjct: 299 RIQSVTLKAHGNSG-HDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L              LN  +NN Y  + + S YN+ ++L + ISLV +F  SQ+F+  P 
Sbjct: 358 LPSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALLVWFISLVISFVVSQVFLLLPS 417

Query: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480
             +L+ +S I   LPL+   ++ I EP SYR K  A++Y ++VLTSLL++NF++A+++G 
Sbjct: 418 AGLLMAISMISCFLPLILSKKVHISEPLSYRLKNVAFLYFSLVLTSLLMINFAMALLIGT 477

Query: 481 LAFPMTRTTTIIES------------NLRLSIKNLVLLI--------------------- 507
           LAFPMT   TIIES            +++   K    LI                     
Sbjct: 478 LAFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETELIENYEDIMPGKSQQRQELKNLL 537

Query: 508 ---ISNPFIATWAVVNFVEPRLSGFKVFYALIEASQQLGCWTWYIICLGWYPSWLLVTYA 564
              ++NPFI+     +F +    GF V   L+ A   L CW+W+++C+GW P WLLV  +
Sbjct: 538 LLVLTNPFISITIFGSFFDDEFQGFDVINKLVSAWLDLKCWSWFVLCIGWLPCWLLVLAS 597

Query: 565 SIDAIEVQTPIKKE 578
           S ++  V    K++
Sbjct: 598 SFESKRVMLKSKEK 611

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/613 (53%), Positives = 428/613 (69%), Gaps = 38/613 (6%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           MAL+EKLHRRI+ +GL+P+ I+ L  +S LC + G   +  +LP DGQ+RRTYISENAL+
Sbjct: 1   MALLEKLHRRIVDMGLVPRIIALLPVISTLCALFGFISIA-ILPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRESEWN+LRGYR+Q++  + + T+ + N ++  WLQEFG KTAIY+ +QYGE
Sbjct: 60  PSQAYSYFRESEWNVLRGYRSQIEEMENM-TSSERNNQMGSWLQEFGTKTAIYESQQYGE 118

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           TLYG+ HAPRGDGTEAMV+A PW+N + E+N GGAAL +SL RFFSRWPVWSKNII+V S
Sbjct: 119 TLYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALGVSLARFFSRWPVWSKNIIVVFS 178

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           E+P+A+LRSWV AYHTSLDLTGGSIE+A+VLDY    D F+Y+EI YDGLNGE PNLDLV
Sbjct: 179 ENPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEISYDGLNGELPNLDLV 238

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           N+A+ I EHEG+KVSLHGLP+ +L  ND+ SRLK + LGI+D  LSG+KN +GNEAFSGW
Sbjct: 239 NIAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSLGIRDWALSGVKNPHGNEAFSGW 298

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQS+TLKA G  G HDITTFGR+PEA+ RS+NNLLEKFHQSFFFYLLLAPR F+SI +Y
Sbjct: 299 RIQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L              LN  +NN Y  + L S YN+ ++L + ISLV +F  SQ+F+  P 
Sbjct: 358 LPSAVAFSVAFAISSLNAFINNAYASISLFSEYNLVALLVWFISLVVSFIISQIFLLVPS 417

Query: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480
             +L+ +S     LPL+   ++ I EP SYR K  A++Y ++V TSLL++NF++A+++G 
Sbjct: 418 VGLLMTISLATCFLPLVLSEKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGS 477

Query: 481 LAFPMTRTTTII-----------------------------------ESNLRLSIKNLVL 505
           LAFPMT   TI+                                   ++  R  +KNL+L
Sbjct: 478 LAFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDLFEHHGDTVLEKAKKRQQLKNLLL 537

Query: 506 LIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQQLGCWTWYIICLGWYPSWLLVTYAS 565
           L+++NPFI+        +    GF +   LI A   L CW W+++C+GW P WLL+  +S
Sbjct: 538 LVLTNPFISITLFALVFDNEFHGFDIVNKLISAWLDLKCWNWFVLCIGWLPCWLLILASS 597

Query: 566 IDAIEVQTPIKKE 578
            ++  V    K++
Sbjct: 598 FESRSVVVKSKEK 610

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/578 (56%), Positives = 430/578 (74%), Gaps = 6/578 (1%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           MAL+  +HRR+I +GL+PK + +L  +S+    IG+  L  MLP DGQ+R TYISENAL+
Sbjct: 1   MALLATIHRRVIDMGLVPKIMKRLPLVSIFLAAIGIV-LFLMLPMDGQYRHTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRESEWNILRGYRT++D+F  + +  D N  +++WL+EFG KT++Y +++YG+
Sbjct: 60  PSQAYSYFRESEWNILRGYRTEIDIFPSMPS-RDRNLVMTQWLEEFGTKTSVYHNDEYGD 118

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           TLYGIF+APRGDGTEA+V+A PWYN + E+NTGGAAL I+L RFFSRWP+WSKNII+V S
Sbjct: 119 TLYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAALGIALSRFFSRWPIWSKNIIVVFS 178

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           E+P  +LRSWV AYH SLDLTGGSIE+AIV+DYP +SD FDY+EI+Y G+NGE PNLDL+
Sbjct: 179 ENPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSSDFFDYVEIYYHGINGELPNLDLL 238

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           N+A+ I EHEG++VSLHGLP   L +N+Y SRL+T+LLG KD++LSGIK  +GNEAFSG+
Sbjct: 239 NIAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLLLGTKDALLSGIKPRHGNEAFSGF 298

Query: 301 RIQSLTLKAKGI--DGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIG 358
           RIQ++TLKAK    +  HDIT+FGR+ EA  RSVNNLLEKFHQSFFFYL+LAP+YF+SI 
Sbjct: 299 RIQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNLLEKFHQSFFFYLILAPKYFVSIS 358

Query: 359 TYLXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYF 418
           +YL              L+  +NN Y  LP+ S YN+ + L F IS+ F+F  ++L + F
Sbjct: 359 SYLPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNLLAGLLFTISITFSFFVARLSLLF 418

Query: 419 PLPRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVM 478
             PR+L+  S   SVLP L   R  I EP SYR K+ A++Y+++VLTSLLVLNFSLA  +
Sbjct: 419 TEPRLLVLGSVFLSVLPHLLGNRFTIPEPLSYRLKSIAFLYISLVLTSLLVLNFSLAFGI 478

Query: 479 GLLAFPMTRTTTI-IESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIE 537
           G+L F MT   TI I S++R+ ++N + L++SNPF +        +  + G K+FY  I 
Sbjct: 479 GILGFAMTAVKTITIHSSMRVRVRNTMHLLLSNPFTSVLLFTYIFDKDIYGIKIFYEFIH 538

Query: 538 ASQQLGCWTWYIICLGWYPSWLLVTYASIDAIEV-QTP 574
           +   L CWTW+IIC+GW P W+LV+ +SI    V Q+P
Sbjct: 539 SWNTLNCWTWFIICVGWLPPWILVSISSIQTNTVMQSP 576

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/576 (55%), Positives = 425/576 (73%), Gaps = 5/576 (0%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           M L E++ R++I+ GLIPK IS L  +S LC V+G+  ++ +LP +GQ+R TYISENAL+
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIV-IIGILPFEGQYRNTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRESEWNI+RGYR+Q+   +  S   + NA +S+WLQ+FG KT IY + + G+
Sbjct: 60  PSQAYSYFRESEWNIVRGYRSQIVELRNASAV-ERNAIMSEWLQQFGTKTDIYQNHETGD 118

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           TLYG+FHAPRGDGTE+MV+A PW+N + E+N  GAAL ++L R+FSRWPVWSKNII+V +
Sbjct: 119 TLYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFT 178

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           E+PKA+LRSWV AYHTSLDLTGGSIE+AIVLD+ G  D FDYMEI+YDGLNGE PNLD+V
Sbjct: 179 ENPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMV 238

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           N+ V  AEHEG+KVSLHG PF ++  +   SRLK ++  IK+S LSG+K  YGNEAFSGW
Sbjct: 239 NIGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGW 298

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQS+TL+A+G +GP D+T+FGRVPEA+ RS+NNLLEKFHQSFFFYL+LAPR+F+SI +Y
Sbjct: 299 RIQSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSY 358

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L              LN   NN Y  LP  S+Y + SIL + +SLV  F  S +F+Y P 
Sbjct: 359 LPSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPF 418

Query: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480
           P +LL ++ I  + P + +    +++  SYR ++ A+++M+++LTSLL++NF LA  MGL
Sbjct: 419 PTILLAVNIIICLYPAILKGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGMGL 478

Query: 481 LAFPMTRTTTIIESN---LRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIE 537
           L+FPMT+  TI        R  +KN VLL++SNPFIATW      +   SG  VF  L+ 
Sbjct: 479 LSFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDNEFSGLDVFERLVS 538

Query: 538 ASQQLGCWTWYIICLGWYPSWLLVTYASIDAIEVQT 573
           AS++LGCWTW ++C+GW+  WLLV  +++D +++  
Sbjct: 539 ASRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSN 574

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/615 (53%), Positives = 426/615 (69%), Gaps = 40/615 (6%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           MAL+EKLHRR++ +GL+P+ I+ L  +S LC + G    + +LP DGQ+RRTYISENAL+
Sbjct: 1   MALLEKLHRRVVDMGLVPRVIALLPVISTLCALFGF-ISIAILPMDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRE+EWNILRGYR+Q++    +++T  +N  +  WLQEFG KTAIY++EQYGE
Sbjct: 60  PSQAYSYFRETEWNILRGYRSQIEETVNMTSTERNNL-MGSWLQEFGTKTAIYENEQYGE 118

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           TLYG+ HAPRGDGTEAMV+A PW+N  +E+N GGA+L +SL RFFSRWPVWSKNII+V S
Sbjct: 119 TLYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLGVSLARFFSRWPVWSKNIIVVFS 178

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           E+P A+LRSWV AYHTSLDLTGGSIE+A+VLDY    D F+Y+E+ YDGLNGE PNLDLV
Sbjct: 179 ENPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAEDFFEYVEVSYDGLNGELPNLDLV 238

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           NVA+ I EHEG+KVSLHGLP+ +L  ND+ SRLK + LGI+D  LSG+KN +GNEAFSGW
Sbjct: 239 NVAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCLGIRDWALSGVKNPHGNEAFSGW 298

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQS+TLKA G  G HDITTFGR+PEA+ RS+NNLLEKFHQSFFFYLLLAPR F+SI +Y
Sbjct: 299 RIQSVTLKAHG-HGGHDITTFGRIPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L              LN  +NN Y  + L S YN+ ++L + I++V +F  SQLF+    
Sbjct: 358 LPSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVLVWFIAMVVSFVISQLFLSVLP 417

Query: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480
             +L+ +S     LP+    ++ I EP SYR K  A++Y ++V TSLL++NF++A+++G 
Sbjct: 418 AGLLMTISLAICFLPIALSGKVHISEPLSYRLKNVAFLYFSLVSTSLLMINFAMALLIGT 477

Query: 481 LAFPMTRTTTII-------ESNLR--LSIKN----------------------------L 503
           LAFPMT   TI        E+  R  +SIK                             L
Sbjct: 478 LAFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDETQLNKHYKEGTLEKNQQRQKLKNL 537

Query: 504 VLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEASQQLGCWTWYIICLGWYPSWLLVTY 563
           +LLI++NPFI+        +    GF +   L+ A   L CW+W+I+CLGW P WLL+  
Sbjct: 538 LLLILTNPFISITVFGLLFDDEFQGFDIINKLVSAWIDLKCWSWFILCLGWLPCWLLILA 597

Query: 564 ASIDAIEVQTPIKKE 578
           +S ++  V    K++
Sbjct: 598 SSFESKSVVVKSKEK 612

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/582 (54%), Positives = 420/582 (72%), Gaps = 18/582 (3%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           MAL+E+L RR++ +GL+PK I+ L  +S++C +I   WL   LP +GQFRRTYISENAL+
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLA-TLPIEGQFRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRESEWNILRGYR+Q++ F  +S  ++ N ++++WLQEFG KT+IY++E+YG+
Sbjct: 60  PSQAYSYFRESEWNILRGYRSQIEHFGEISN-NERNEQMAEWLQEFGAKTSIYNNEEYGD 118

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           +LYGI HA RGDGTEA+++A PWYN   + N GGA+L ISL RFFSRWPVWSKNIIIV S
Sbjct: 119 SLYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFS 178

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           E+P  +LRSWV AYHTSLDLTGGSIE+AIVLDYPGT+D FDY EI Y GLNGE PNLDLV
Sbjct: 179 ENPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLV 238

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           N+AV I EHEG+ VSLHG+    ++   Y SRLK +L GI     +G++   GNEAFSGW
Sbjct: 239 NIAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGW 298

Query: 301 RIQSLTLKAKGIDGP-HDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGT 359
           RIQS+T+KA G +G  +DITTFGR+PEA+ RS+NNLLEKFHQS+FFY+L+APRYF+SI +
Sbjct: 299 RIQSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISS 358

Query: 360 YLXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFP 419
           YL              LN +L N+Y  L   S YN+ ++L + +S++ +F  SQLF+Y P
Sbjct: 359 YLPATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLYVP 418

Query: 420 LPRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMG 479
              +L+    +  +LPL +     I EP S+R + +A++YM++V+TSL+++NF+LA V+G
Sbjct: 419 STILLVAFIVVMLLLPLAAGRLWTITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFVVG 478

Query: 480 LLAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIEAS 539
           +LAFPMT   T       L+ K   LLIISNP ++ +     V+P     ++   LI A 
Sbjct: 479 ILAFPMTAVGT----QRSLTFKKYALLIISNPLVSFF----IVKPHP---QLLQKLISAW 527

Query: 540 QQLGCWTWYIICLGWYPSWLLVTYASIDAIEVQTPI---KKE 578
           Q LGCWTW+++CLGW PSW L+  ++  +  +  P+   KKE
Sbjct: 528 QDLGCWTWFVLCLGWLPSWTLIALSACSSTNLD-PVATSKKE 568

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/586 (53%), Positives = 417/586 (71%), Gaps = 11/586 (1%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           M L E L R+ + +GL+PK ++ L  LS L  V+ +  ++ ++P +GQ+R TYISENAL+
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVV-MILIIPMNGQYRNTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAE-VSKWLQEFGVKTAIYDDEQYG 119
           PSQAYSYFRE+EWNILRGYRT++++      +     + V+ WL EFG KTA+Y +E+ G
Sbjct: 60  PSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMG 119

Query: 120 ETLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVL 179
           +TLYG+ HAPRGDGTEAMV+ APW N   E+N GG+ALAI+L R+FSRWPVWSKNII+V 
Sbjct: 120 DTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVF 179

Query: 180 SEDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDL 239
           S++P  +LRSWV AYHTSLDLTGGSIE+A++LDYP  +D F+Y EIH++GLNGE PNLDL
Sbjct: 180 SDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDL 239

Query: 240 VNVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSG 299
           VNVAVHI +HEG+KVSLHGLP SEL++N+Y SRLK + LG+KDS L+G+K  +GNE FSG
Sbjct: 240 VNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSG 299

Query: 300 WRIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGT 359
           WRIQ++TLKA+G +G  DITTFGR+PEA+ RS+NNLLEKFHQSFFFY LL+P  F+SI +
Sbjct: 300 WRIQAVTLKARG-EGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISS 358

Query: 360 YLXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFP 419
           YL              ++  +NN Y    L   Y + + L   ISL+ +F  +  F+Y  
Sbjct: 359 YLPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTLLAALASVISLLVSFLVAHWFLYST 417

Query: 420 L-PRVLLGLSGIFSVLPL-LSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIV 477
             P  L+  S + +V PL +SR+   ++EP  YR +   YIY +++LTSLL+LNF LA  
Sbjct: 418 TSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFS 477

Query: 478 MGLLAFPMTRTTTI---IESNLRLSIKNLVLLIISNPFIATWAVVNFVE-PRLSGFKVFY 533
           +GL  +PMT    +    +S + L ++N VLL+ISNPF+ATW +   VE        VF 
Sbjct: 478 IGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVFA 537

Query: 534 ALIEASQQLGCWTWYIICLGWYPSWLLVTYASIDAI-EVQTPIKKE 578
           AL  A + L CWTW+++CLGW P+WLLVT++S  +I   +T I+K+
Sbjct: 538 ALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKK 583

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/570 (52%), Positives = 408/570 (71%), Gaps = 6/570 (1%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           MAL+E LHRR   +GL+PK I KLS +S +  +I +G L+  LP DGQ+RRTYISENALL
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIG-LILCLPLDGQYRRTYISENALL 59

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRESEWNILRGYRT ++           N  +S WL +FG+K A+YD+   G+
Sbjct: 60  PSQAYSYFRESEWNILRGYRTAIEAL-IDKPARVRNEVISSWLTDFGMKHAVYDNAADGD 118

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           TLYG++++ RGDGTEA+V+A PWYN + E N GGAAL ISL R+FSRWP+WSKNII+V+S
Sbjct: 119 TLYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVIS 178

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           E+P  +++SWV AYH SLDLTGGS+E+AIVLD+P  S+ F+++E++++G+NGE PNLD+V
Sbjct: 179 ENPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIV 238

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           NVA+ + EHEG+KVSL GL  SE+  + Y +RLKT+L G+K+S LSG +  YGNEAFSG 
Sbjct: 239 NVAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGR 298

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQ+LTLKA G +G HDITTFGR+PEA+ RSVNNLLEKFHQSFFFY L+APR+F+SIG+Y
Sbjct: 299 RIQALTLKACGTEG-HDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSY 357

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L               +  +NN+Y  +PL    +I +++ F  S+  +F   Q+   F  
Sbjct: 358 LPSAVCLSISFGISAAHSYINNQYITVPLSDNSSILALIIFFGSIAISFIFLQINETFLQ 417

Query: 421 PRVLLGLSGIFSVLPL--LSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVM 478
           P +++    + S LPL  + +  + IQ   SYR K+FA+IY+++VLTSLLV+NF+LA  M
Sbjct: 418 PHLMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFALAFGM 477

Query: 479 GLLAFPMTRTTTIIES-NLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVFYALIE 537
           GLLAFP+T T +  E    +  + N   L ISNPFIA +  V+  E  ++ F+VF  LI 
Sbjct: 478 GLLAFPLTFTKSCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFEDDITNFEVFSDLIS 537

Query: 538 ASQQLGCWTWYIICLGWYPSWLLVTYASID 567
           + + +G WTW I C+GW+ +W +V  A++D
Sbjct: 538 SFKYMGNWTWAITCIGWFTTWQMVYIANLD 567

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/573 (51%), Positives = 416/573 (72%), Gaps = 10/573 (1%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           M L+E++ R I+S GLIPK +++L ++S++   I +  ++ +LP DGQ+R TYISENAL+
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISI-LMIAILPMDGQYRNTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRE+EWNI+RGYR +L   +  ST+ + N  +  WL EFGVKT IY++    E
Sbjct: 60  PSQAYSYFRETEWNIVRGYRNELVHMEN-STSRERNQIMESWLNEFGVKTQIYENRD-NE 117

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
            LYG+FHAPRGDGTEA+V+A PW+N + E+NT GAA+ ++L R+FSRWPVWSKNII+V S
Sbjct: 118 VLYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFS 177

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           E+P ++LRSWV AY+TSLDLTGGSIE+AIVLD PG +D FDY+E++YDGLNGE PNLDLV
Sbjct: 178 ENPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLV 237

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           N+ ++IAEHEG++VSLHG PF ++  N+Y +RLK ++  I+ S  SG+   +GNEAFSGW
Sbjct: 238 NIGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGW 297

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQS+TLK KG  GP DIT FGRVPEA+ RS+NNLLEKFHQSFFFYLLLAPR F+SI +Y
Sbjct: 298 RIQSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L              ++  +NN    LP  S Y +   + + ++LV  F  +QLF+  P+
Sbjct: 358 LPSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQLFLILPI 417

Query: 421 PRVLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGL 480
           P +LL ++ + S+  ++ + +   +   S R ++FA+++++++LTSLL++NF L+ ++GL
Sbjct: 418 PSLLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMIGL 477

Query: 481 LAFPMTRTTTIIESNL-RLSIKNLVLLIISNPFIATWAVVNFVEPR-----LSGFKVFYA 534
           +AFPMT+  +I  +   ++ ++N++LL+ISNPFIA   + N V        L G +V   
Sbjct: 478 MAFPMTKVRSITANTAPQIKLENIILLMISNPFIAL-IIYNNVSSNSGLQGLQGLRVINR 536

Query: 535 LIEASQQLGCWTWYIICLGWYPSWLLVTYASID 567
           LI A + + CWTW+++CLGW PSW++V  + I+
Sbjct: 537 LISAWKDMRCWTWFVLCLGWLPSWIMVAISVIE 569

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/575 (52%), Positives = 408/575 (70%), Gaps = 11/575 (1%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           M+L++K++RR+   G I K + +L ++S L  V+ +  L+ +LP DGQ+RRTYISENAL+
Sbjct: 1   MSLLQKVYRRLSERGAITKLLQQLPRVSNLLVVVAIV-LLAILPLDGQYRRTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRE+EWNILRGYR+Q++  ++ S+    N  V++WLQE G+KTA+Y+ E++G+
Sbjct: 60  PSQAYSYFRETEWNILRGYRSQIETLEH-SSVDQRNEVVAEWLQEQGLKTALYEHEKWGK 118

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           TLYG+ HA RGDGTEAMV+A PW N + ++N GGAAL +SL +FF RWPVWSKNII+V S
Sbjct: 119 TLYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLSQFFKRWPVWSKNIIVVFS 178

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           ED  A+LR+WV AYHTSLDLT GSIE+A+VLDYP  SD F+Y+EI YDGLNGE PNLDLV
Sbjct: 179 EDSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEYVEISYDGLNGELPNLDLV 238

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           N+AV I EHEG+KVSLHGLP +E+   DY +RLK M +GIK+  LSG+K  +GNEAFSGW
Sbjct: 239 NIAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKNWALSGVKRIHGNEAFSGW 298

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQS+TL+A G +G  DIT FGR+PEA+ RSVNNLLEKFHQS+FFYLLLAPR F+SI  Y
Sbjct: 299 RIQSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQSYFFYLLLAPRNFVSISNY 358

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L              L+  +NN Y  +P  S+  +   +    S+  +F  S++ +  P+
Sbjct: 359 LPSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILSASVFVSFLISRVLIMLPI 418

Query: 421 PRVLLGLSGIFSVLPL-LSRTRLR-IQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVM 478
              LL  S   + LPL +S+  +  I +  +YR K+   IY +++LTSLL++NF+L  ++
Sbjct: 419 VESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYYSLILTSLLMVNFALTFMI 478

Query: 479 GLLAFPMTR-----TTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSG-FKVF 532
           GLLAFP+T+     T TI + + +  +KN  +L I+NPFI+ W     ++   +G F V 
Sbjct: 479 GLLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISLWLFTATMDTDFNGSFSVI 538

Query: 533 Y-ALIEASQQLGCWTWYIICLGWYPSWLLVTYASI 566
           Y  +I +   LGCWTW+IICLGW P WL+   +SI
Sbjct: 539 YNRMITSWDTLGCWTWFIICLGWLPYWLISVISSI 573

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  557 bits (1436), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/567 (51%), Positives = 393/567 (69%), Gaps = 20/567 (3%)

Query: 1   MALVEKLHRRIISIGLIPKFISKLSQLSLLCCVIGLGWLVFMLPSDGQFRRTYISENALL 60
           M LVE++ R++  +GL+PK    L   S +  +I L   + +LP DGQ+R TYISENAL+
Sbjct: 1   MGLVERVKRQVAVMGLVPKLKKYLPLFSKIIALISLI-SIAILPIDGQYRNTYISENALM 59

Query: 61  PSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAEVSKWLQEFGVKTAIYDDEQYGE 120
           PSQAYSYFRE+EWNILRGYRTQ++    +  T + N  +  WL + G KT    D     
Sbjct: 60  PSQAYSYFRETEWNILRGYRTQVENMVDLPLT-ERNDIMETWLNDIGAKT----DTHNNS 114

Query: 121 TLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAALAISLVRFFSRWPVWSKNIIIVLS 180
           T+YGIFH+PRGDGTEA+V+A PW+N   ++NTGGAAL +SL RFF RWP+WSKNII+V S
Sbjct: 115 TIYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLARFFWRWPIWSKNIIVVFS 174

Query: 181 EDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTSDRFDYMEIHYDGLNGETPNLDLV 240
           ED  ASLRSWV AYHTSLDLTGGSIE+A++LDY   SD FDY+EIHYDGLNGE PNLDLV
Sbjct: 175 EDTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDYVEIHYDGLNGELPNLDLV 234

Query: 241 NVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTMLLGIKDSVLSGIKNCYGNEAFSGW 300
           N+AV I EHEG+KVSLHGLP  EL+     SR K +L  IKDS L+GIK  +GNEAFSGW
Sbjct: 235 NIAVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKDSSLAGIKKPHGNEAFSGW 294

Query: 301 RIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLEKFHQSFFFYLLLAPRYFISIGTY 360
           RIQ+LTLKA G +G  DITTFGR+PEA+ RS+NNLLEKFHQSFF+YLLLAPR F+SI +Y
Sbjct: 295 RIQALTLKACG-EGGIDITTFGRIPEAMFRSINNLLEKFHQSFFYYLLLAPRNFVSISSY 353

Query: 361 LXXXXXXXXXXXXXXLNQILNNKYGELPLLSIYNIWSILTFCISLVFAFATSQLFVYFPL 420
           L              L + +N+    +P +S Y + +I+ + +S+ F+F  +  ++ +  
Sbjct: 354 LPAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIVWFLSITFSFCFAITYLKYTF 413

Query: 421 PRVLLGLSGIFSVLPLLSR------TRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSL 474
           P +L+ +  +FS +PL+SR      T++ +    ++R KAFA+ Y ++VLTSLL++NF L
Sbjct: 414 PVMLMFICILFSFIPLISRGLPLAETKITV----AHRMKAFAFGYFSLVLTSLLMINFPL 469

Query: 475 AIVMGLLAFPMT--RTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFVEPRLSGFKVF 532
           A+ +G+LAFPMT  + +  + ++ + ++KN +LL++SNP+I+  A  N  +  L+G    
Sbjct: 470 ALTIGVLAFPMTLVKISNTLPTSSQ-ALKNSMLLLVSNPYISICAFSNIFDSELTGLATL 528

Query: 533 YALIEASQQLGCWTWYIICLGWYPSWL 559
             LI A   + CWTW+   L  Y + L
Sbjct: 529 DRLIPAWNDMNCWTWFFSHLAGYHAGL 555

>TBLA0A07800 Chr1 complement(1921256..1922497) [1242 bp, 413 aa]
           {ON} Anc_3.45 YOL126C
          Length = 413

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 24/41 (58%)

Query: 224 EIHYDGLNGETPNLDLVNVAVHIAEHEGIKVSLHGLPFSEL 264
           +I+ DG+NG T +L  ++ AVH+  H G    +  L  S+L
Sbjct: 78  DINKDGVNGVTTDLSHIDTAVHVTSHSGEDGLVESLTDSDL 118

>TPHA0J01840 Chr10 complement(422152..423738) [1587 bp, 528 aa] {ON}
           Anc_6.124 YBR227C
          Length = 528

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 306 TLKAKGIDGPHDITTFGRVPEALSR-SVNNLLEKFHQSFFFYLLLAPR 352
           T+ A  +  P D+ +FG +PE + R  +   L+  HQ   F++L  P+
Sbjct: 358 TIPALNLTSPADLISFGIIPELVGRVPIVTALQPLHQKDLFHILKEPK 405

>SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {ON}
           highly similar to uniprot|P39517 Saccharomyces
           cerevisiae YDL160C DHH1 Cytoplasmic DExD/H-box helicase
           stimulates mRNA decapping coordinates distinct steps in
           mRNA function and decay interacts with both the
           decapping and deadenylase complexes may have a role in
           mRNA export and translation
          Length = 497

 Score = 31.6 bits (70), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 53/123 (43%), Gaps = 17/123 (13%)

Query: 423 VLLGLSGIFSVLPLLSRTRLRIQEPFSYRFKAFAYIYMAIVLTSLLVLNFSLAIVMGLLA 482
           VL+G  G   VL L SR    + E           +++      +L  +F   I   L  
Sbjct: 150 VLVGTPG--RVLDLASRKVADLSE---------CPLFVMDEADKMLSRDFKSIIEQILSF 198

Query: 483 FPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFV-EPRLSGFKVFYALIEASQQ 541
           FP +R + +  +   L++K  ++  ++ P+      +N + E  L G   +YA +E  Q+
Sbjct: 199 FPQSRQSLLFSATFPLTVKEFMVNHLNKPY-----EINLMDELTLKGITQYYAFVEEKQK 253

Query: 542 LGC 544
           L C
Sbjct: 254 LHC 256

>NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {ON}
           Anc_7.336
          Length = 534

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 6/80 (7%)

Query: 466 SLLVLNFSLAIVMGLLAFPMTRTTTIIESNLRLSIKNLVLLIISNPFIATWAVVNFV-EP 524
            +L  +F   I   L+  P    + +  +   L++K  ++  ++NP+      +N + E 
Sbjct: 190 KMLSRDFKTIIEQILIFLPKKHQSLLFSATFPLTVKEFMVKHLNNPY-----EINLMDEL 244

Query: 525 RLSGFKVFYALIEASQQLGC 544
            L G   FYA +E  Q+L C
Sbjct: 245 TLKGITQFYAFVEERQKLHC 264

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.140    0.430 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,746,679
Number of extensions: 2413555
Number of successful extensions: 7620
Number of sequences better than 10.0: 28
Number of HSP's gapped: 7761
Number of HSP's successfully gapped: 30
Length of query: 578
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 463
Effective length of database: 40,294,809
Effective search space: 18656496567
Effective search space used: 18656496567
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)