Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19096g8.260ON29232923150110.0
TDEL0F038708.260ON2942305635780.0
CAGL0L12210g8.260ON2981307835410.0
TBLA0E044208.260ON3148263628380.0
SAKL0H17072g8.260ON2997111122640.0
KLTH0G13728g8.260ON2966157322100.0
Suva_10.1718.260ON2958157421000.0
KAFR0B027208.260ON2982159620780.0
YLR087C (CSF1)8.260ON2958156820700.0
Kwal_YGOB_56.238088.260ON2941157320620.0
Smik_12.1468.260ON2958156720570.0
Skud_12.1558.260ON2959157420520.0
NDAI0B019808.260ON2959157619880.0
KNAG0G020308.260ON2998157319780.0
Ecym_43108.260ON2943155519660.0
NCAS0B050108.260ON2952158919430.0
Kwal_56.23810singletonOFF2763118619140.0
Kpol_392.78.260ON2995120318670.0
ZYRO0C01694g8.260ON3006120717760.0
TPHA0J007308.260ON3046147216610.0
AGR088W8.260ON2887125616320.0
Kwal_56.23808singletonOFF62611408e-10
TPHA0E019505.398ON331179900.13
Skud_10.2981.529ON21887739.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19096g
         (2923 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...  5786   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  1382   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  1368   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  1097   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...   876   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...   855   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...   813   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...   805   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...   801   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...   798   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...   796   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...   795   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...   770   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...   766   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...   761   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...   753   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...   741   0.0  
Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...   723   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...   688   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...   644   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...   633   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    59   8e-10
TPHA0E01950 Chr5 complement(402763..403758) [996 bp, 331 aa] {ON...    39   0.13 
Skud_10.298 Chr10 (530592..530621,530625..531251) [657 bp, 218 a...    33   9.7  

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score = 5786 bits (15011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2841/2923 (97%), Positives = 2841/2923 (97%)

Query: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60
            MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY
Sbjct: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60

Query: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120
            KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG
Sbjct: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120

Query: 121  DASENAKLPCRFLLQCDGLEVFVYNKIDVYESVLRDHFTNVTKDGQETESNDDITINTEX 180
            DASENAKLPCRFLLQCDGLEVFVYNKIDVYESVLRDHFTNVTKDGQETESNDDITINTE 
Sbjct: 121  DASENAKLPCRFLLQCDGLEVFVYNKIDVYESVLRDHFTNVTKDGQETESNDDITINTEK 180

Query: 181  XXXXXXXXXXXXXXXXXXXXXTDAPKLSAKTKLFPIQLEANRAAIVLGNRNTRHVGVFKF 240
                                 TDAPKLSAKTKLFPIQLEANRAAIVLGNRNTRHVGVFKF
Sbjct: 181  AAANSKLSNSSRYSYSGRSKSTDAPKLSAKTKLFPIQLEANRAAIVLGNRNTRHVGVFKF 240

Query: 241  EQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTFVVEKTMDKIWQ 300
            EQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTFVVEKTMDKIWQ
Sbjct: 241  EQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTFVVEKTMDKIWQ 300

Query: 301  TVKKQCISISKLLLPNQGKTINNQQAYIDSWKGLDLYHHTKAVQEENVDTTVLHEQEYAR 360
            TVKKQCISISKLLLPNQGKTINNQQAYIDSWKGLDLYHHTKAVQEENVDTTVLHEQEYAR
Sbjct: 301  TVKKQCISISKLLLPNQGKTINNQQAYIDSWKGLDLYHHTKAVQEENVDTTVLHEQEYAR 360

Query: 361  YSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQDDDTPAFGTDIHIYTAA 420
            YSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQDDDTPAFGTDIHIYTAA
Sbjct: 361  YSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQDDDTPAFGTDIHIYTAA 420

Query: 421  VYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSVDFRDKSVLHIPTR 480
            VYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSVDFRDKSVLHIPTR
Sbjct: 421  VYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSVDFRDKSVLHIPTR 480

Query: 481  ESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQADRLPNELYVLLLNPE 540
            ESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQADRLPNELYVLLLNPE
Sbjct: 481  ESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQADRLPNELYVLLLNPE 540

Query: 541  IKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAELFLLRDHISLISDLFT 600
            IKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAELFLLRDHISLISDLFT
Sbjct: 541  IKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAELFLLRDHISLISDLFT 600

Query: 601  DFSANDALRYELFRPFTYEIKWVFTEYKLFXXXXXXXXXXXXXXXXXXCFLSLSGDILNT 660
            DFSANDALRYELFRPFTYEIKWVFTEYKLF                  CFLSLSGDILNT
Sbjct: 601  DFSANDALRYELFRPFTYEIKWVFTEYKLFLNVNDANIINNLLDLNENCFLSLSGDILNT 660

Query: 661  SINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFGECPDFSMTGTYIS 720
            SINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFGECPDFSMTGTYIS
Sbjct: 661  SINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFGECPDFSMTGTYIS 720

Query: 721  FPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHFKTTEEYSNDLSME 780
            FPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHFKTTEEYSNDLSME
Sbjct: 721  FPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHFKTTEEYSNDLSME 780

Query: 781  EDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVADTINENTIHKSSLLRTKNETDVWITFF 840
            EDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVADTINENTIHKSSLLRTKNETDVWITFF
Sbjct: 781  EDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVADTINENTIHKSSLLRTKNETDVWITFF 840

Query: 841  VNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLTAFFSRIYLNHSNEFSFNRVV 900
            VNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLTAFFSRIYLNHSNEFSFNRVV
Sbjct: 841  VNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLTAFFSRIYLNHSNEFSFNRVV 900

Query: 901  AIEESHSENTGYLDDLNLHGHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAI 960
            AIEESHSENTGYLDDLNLHGHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAI
Sbjct: 901  AIEESHSENTGYLDDLNLHGHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAI 960

Query: 961  QKVGFTYKDAENILIYSIHKPEDVTSLTISIGRVSSIVRTNHGGSATLSLNDITINSWDL 1020
            QKVGFTYKDAENILIYSIHKPEDVTSLTISIGRVSSIVRTNHGGSATLSLNDITINSWDL
Sbjct: 961  QKVGFTYKDAENILIYSIHKPEDVTSLTISIGRVSSIVRTNHGGSATLSLNDITINSWDL 1020

Query: 1021 SNSRYSKRVDLLVAAISVCAIDEKKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLN 1080
            SNSRYSKRVDLLVAAISVCAIDEKKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLN
Sbjct: 1021 SNSRYSKRVDLLVAAISVCAIDEKKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLN 1080

Query: 1081 DSPFHRCKFLLAFDQLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYIN 1140
            DSPFHRCKFLLAFDQLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYIN
Sbjct: 1081 DSPFHRCKFLLAFDQLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYIN 1140

Query: 1141 LINFDTDIIDTKNXXXXXXXXXXXXXXSNTVSNDLSGQLAEEFESENTTVNISTLSVFVT 1200
            LINFDTDIIDTKN              SNTVSNDLSGQLAEEFESENTTVNISTLSVFVT
Sbjct: 1141 LINFDTDIIDTKNLTDDRPDDKRLLPLSNTVSNDLSGQLAEEFESENTTVNISTLSVFVT 1200

Query: 1201 PKAFTFAENAAHFMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISD 1260
            PKAFTFAENAAHFMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISD
Sbjct: 1201 PKAFTFAENAAHFMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISD 1260

Query: 1261 ETALDKTQLEALDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFN 1320
            ETALDKTQLEALDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFN
Sbjct: 1261 ETALDKTQLEALDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFN 1320

Query: 1321 IFKSSKNRLTKVLPIAWFEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLK 1380
            IFKSSKNRLTKVLPIAWFEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLK
Sbjct: 1321 IFKSSKNRLTKVLPIAWFEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLK 1380

Query: 1381 LAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHV 1440
            LAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHV
Sbjct: 1381 LAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHV 1440

Query: 1441 RDTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQFLDIFVDWKNWDVYE 1500
            RDTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQFLDIFVDWKNWDVYE
Sbjct: 1441 RDTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQFLDIFVDWKNWDVYE 1500

Query: 1501 VEQSSLFTLLFSGESTVHEEDLFNXXXXXXXXXXXXXPYAPQQSSIIAKQIDLCVKKMSH 1560
            VEQSSLFTLLFSGESTVHEEDLFN             PYAPQQSSIIAKQIDLCVKKMSH
Sbjct: 1501 VEQSSLFTLLFSGESTVHEEDLFNELSLSLEMLHLELPYAPQQSSIIAKQIDLCVKKMSH 1560

Query: 1561 DAILDFDTMGYDKKEIDFDLLISYADIRASMQLIERIILLKQKLFPQITDIENKTNRWVS 1620
            DAILDFDTMGYDKKEIDFDLLISYADIRASMQLIERIILLKQKLFPQITDIENKTNRWVS
Sbjct: 1561 DAILDFDTMGYDKKEIDFDLLISYADIRASMQLIERIILLKQKLFPQITDIENKTNRWVS 1620

Query: 1621 KIYQTSFRISQLTLHMLIEKYMMLLDLQDLSIAGLETSSEINSLLSAKFSSETLSFNLLY 1680
            KIYQTSFRISQLTLHMLIEKYMMLLDLQDLSIAGLETSSEINSLLSAKFSSETLSFNLLY
Sbjct: 1621 KIYQTSFRISQLTLHMLIEKYMMLLDLQDLSIAGLETSSEINSLLSAKFSSETLSFNLLY 1680

Query: 1681 LDRIISRILLEKVTANFFGTENENIRFFTSNIGSVVLDSSDLTLTEMMKHARALLASIDD 1740
            LDRIISRILLEKVTANFFGTENENIRFFTSNIGSVVLDSSDLTLTEMMKHARALLASIDD
Sbjct: 1681 LDRIISRILLEKVTANFFGTENENIRFFTSNIGSVVLDSSDLTLTEMMKHARALLASIDD 1740

Query: 1741 MKAITPDHDSEKKNGHVDLVWVLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNLSGIS 1800
            MKAITPDHDSEKKNGHVDLVWVLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNLSGIS
Sbjct: 1741 MKAITPDHDSEKKNGHVDLVWVLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNLSGIS 1800

Query: 1801 IIVNYTELLLDFYFNQLKLLRISNSVTKVDYRSNTLLTDIGLDTDIVKLTLSDNRVYIEE 1860
            IIVNYTELLLDFYFNQLKLLRISNSVTKVDYRSNTLLTDIGLDTDIVKLTLSDNRVYIEE
Sbjct: 1801 IIVNYTELLLDFYFNQLKLLRISNSVTKVDYRSNTLLTDIGLDTDIVKLTLSDNRVYIEE 1860

Query: 1861 LTDSLNGTVSELIKIFKNKNADNEPAAPKFKPCSFKMNAIYIGLLTDLKTTNYVLEFNET 1920
            LTDSLNGTVSELIKIFKNKNADNEPAAPKFKPCSFKMNAIYIGLLTDLKTTNYVLEFNET
Sbjct: 1861 LTDSLNGTVSELIKIFKNKNADNEPAAPKFKPCSFKMNAIYIGLLTDLKTTNYVLEFNET 1920

Query: 1921 AFSCASRAEALEETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIEDDI 1980
            AFSCASRAEALEETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIEDDI
Sbjct: 1921 AFSCASRAEALEETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIEDDI 1980

Query: 1981 KKTLQIETPHSRVMLAPSTLIAVIFFIQEAKVSLQKVKQKGKFNSSSNAIEIPPYFETLS 2040
            KKTLQIETPHSRVMLAPSTLIAVIFFIQEAKVSLQKVKQKGKFNSSSNAIEIPPYFETLS
Sbjct: 1981 KKTLQIETPHSRVMLAPSTLIAVIFFIQEAKVSLQKVKQKGKFNSSSNAIEIPPYFETLS 2040

Query: 2041 VNILSNKLCLGWIFEEDTDENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFF 2100
            VNILSNKLCLGWIFEEDTDENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFF
Sbjct: 2041 VNILSNKLCLGWIFEEDTDENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFF 2100

Query: 2101 FANGVPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIE 2160
            FANGVPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIE
Sbjct: 2101 FANGVPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIE 2160

Query: 2161 SFQXXXXXXXXXXXXXXXTHNVAENLSDKVSILSIRSINCIAKYGGGIINLYTPDDIAQD 2220
            SFQ               THNVAENLSDKVSILSIRSINCIAKYGGGIINLYTPDDIAQD
Sbjct: 2161 SFQKKLAKISNIKKSSISTHNVAENLSDKVSILSIRSINCIAKYGGGIINLYTPDDIAQD 2220

Query: 2221 SPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQ 2280
            SPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQ
Sbjct: 2221 SPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQ 2280

Query: 2281 KQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAK 2340
            KQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAK
Sbjct: 2281 KQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAK 2340

Query: 2341 IQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFM 2400
            IQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFM
Sbjct: 2341 IQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFM 2400

Query: 2401 LTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLGSGPHSGQKCQPQ 2460
            LTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLGSGPHSGQKCQPQ
Sbjct: 2401 LTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLGSGPHSGQKCQPQ 2460

Query: 2461 ALTEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFYLD 2520
            ALTEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFYLD
Sbjct: 2461 ALTEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFYLD 2520

Query: 2521 ELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHSFL 2580
            ELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHSFL
Sbjct: 2521 ELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHSFL 2580

Query: 2581 IARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIEN 2640
            IARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIEN
Sbjct: 2581 IARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIEN 2640

Query: 2641 KKSYVQTLKESNPESSGKIHFSNNELLAPLRLRTNLTAEIGSFRLYVFPSTLFDSEVLVL 2700
            KKSYVQTLKESNPESSGKIHFSNNELLAPLRLRTNLTAEIGSFRLYVFPSTLFDSEVLVL
Sbjct: 2641 KKSYVQTLKESNPESSGKIHFSNNELLAPLRLRTNLTAEIGSFRLYVFPSTLFDSEVLVL 2700

Query: 2701 KANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQAALLE 2760
            KANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQAALLE
Sbjct: 2701 KANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQAALLE 2760

Query: 2761 GDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATHVRAL 2820
            GDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATHVRAL
Sbjct: 2761 GDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATHVRAL 2820

Query: 2821 SVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATPPIE 2880
            SVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATPPIE
Sbjct: 2821 SVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATPPIE 2880

Query: 2881 WFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLGDNLGTM 2923
            WFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLGDNLGTM
Sbjct: 2881 WFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLGDNLGTM 2923

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 1382 bits (3578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 933/3056 (30%), Positives = 1562/3056 (51%), Gaps = 256/3056 (8%)

Query: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60
            M+  S F  +S+S+E++ S  FLVDW+L  ++ +   FYLGR+ A+ +T  L++++W+ +
Sbjct: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60

Query: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIR--------- 111
            K+KI+++S++++ L G I F+NL ++  D TIS L+GS  WRY LL TR           
Sbjct: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120

Query: 112  -GIDFESEDGDASENAKLPCRFLLQCDGLEVFVYNKIDVYESVL----RDHFTNVTKDGQ 166
             G+    ED ++ +N  LPCRF+L C+G E+F+YN+   YE+++    R+      K   
Sbjct: 121  DGLGVGEEDVNSMKNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEKFMS 180

Query: 167  ETESNDDITINTEXXXXXXXXXXXXXXXXXXXXXXTDA-------PKLSAKTKLFPIQLE 219
            + E ++    ++E                       D         K S   +  P++L+
Sbjct: 181  KQEMSELFHCHSERSDDKGSTDSVLSSSVSDVPNINDRVFDEVHNQKKSIFMRFLPMELQ 240

Query: 220  ANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLG 279
             +R +IVLGN+ T  + +      +GV D+      LD Y+    +D  D    +R N+ 
Sbjct: 241  LSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIRQNIE 300

Query: 280  YQNDNPIKTFVVEKTMDKIWQTVKKQCISISKLLLPNQGKTINNQ----QAYIDSWKGLD 335
            Y   N  K       + ++W T       +  L +P   K+ NN+    + ++  WKGL 
Sbjct: 301  Y---NRKKATFKNGKLSRMWATF------VKVLHIPFYNKSHNNKGTESEPFMTKWKGLG 351

Query: 336  LYHHTKAVQEENVDTTVLH----EQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINS 391
            LY        +  D   +H      EYA+ S ++K+ R  LTY +DIPG+VP  +     
Sbjct: 352  LYKGL-TFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAHPTL- 409

Query: 392  QSDRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATK 451
                 E      +   P FG D+  Y   + YGPWA + +Q ++R+ SP V+R  +    
Sbjct: 410  -----EGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIKT 464

Query: 452  PEPGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNE 511
              PGS RIY  FK +    D S   IPTRE SKD+EF+K++K T + +R FGWL++    
Sbjct: 465  LSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFAM 524

Query: 512  GGEILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQ 571
                     LC + +  PN++Y+     E  SSVNH+V+ +CN   +  ++GYP GWN  
Sbjct: 525  DSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNSS 584

Query: 572  ADWLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFX 631
            A W   L S   E FLLR+H++L++D+FTDFS+ +   YELFRPF Y+I W+   Y ++ 
Sbjct: 585  ATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIYL 644

Query: 632  XXXXXXXXXXXXXXXXXCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHP 691
                             C+LSL G+ L   +  P  SI     +  + + +P+ +L ++ 
Sbjct: 645  NVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRLLLNT 704

Query: 692  PCWNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLR 751
            P WNTL+EF+     G    F++ G Y  +  +D+DN DT+ ++  S+ T    +GFV+R
Sbjct: 705  PPWNTLNEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVMR 764

Query: 752  YLMNIKLNYFGDFNHFKTTEEYSNDLSMEED---TKTKTKNFQEQPTNDVESLTSSSSDG 808
            YLMN+K+NYFGDF HF T+EEY+  +  +E     KT+ ++ ++  TN    L++ S   
Sbjct: 765  YLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESLRDNSTN----LSTDSGGL 820

Query: 809  SYQVADTINENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEF 868
            S        +  + +S + RT NETD+W TF V +G +++PE +Y+C     L F  L  
Sbjct: 821  SDPYVRLRADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVALHFGELIV 880

Query: 869  DMRYTNYFMDLTAFFS----RIYLNHSNEFSFNRVVAIEESHSENTGYLDDLNLHGHRMF 924
            D+R  NY+MDL A  S    + Y++  +   F  +        +  G L  L +HGHRM+
Sbjct: 881  DLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAALTIHGHRMY 940

Query: 925  GVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDV 984
            G+PP+E TY C+W I +  L+ +SD +F   F      +GF Y + EN L+Y +  P+D+
Sbjct: 941  GLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLYDVETPDDM 1000

Query: 985  TSLTISIGRVSSIVRTNHGGSATLSLNDITINSWDLSNSRYSKRVDLLVAAISVCAI--- 1041
            TS+T+ + R  ++V  N    A + + ++T  S D  N RYS+R+DL V ++S+  +   
Sbjct: 1001 TSVTVRV-RDMNVVVENDSSRAVVDVPNLTFTSIDFENERYSQRIDLKVPSLSILLLTSE 1059

Query: 1042 -DEKKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHST 1100
             D +   L    T V LT F+ + +   HR  Q++ + LNDSPF+RC FLL    L  S 
Sbjct: 1060 DDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLLPC-YLQESP 1118

Query: 1101 LYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDI---IDTKNXXXX 1157
            LY  LLGSI+PS SLP L  PL  +T D I E LLG +   +  D D    +D  +    
Sbjct: 1119 LYKSLLGSISPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKCDYDTQRTVDDPDSPSE 1178

Query: 1158 XXXXXXXXXXSNTVSNDLSGQLAEEF------ESENTTVNISTLSVFVTPKAFTFAENAA 1211
                       + V  D   QL +        + +N  +++  L+V + P   ++ +   
Sbjct: 1179 SFDTSQEHEGPDDVRYDRFAQLPKILSPNPLEQYDNVIIDVKFLAVDLDPLICSYVDGLL 1238

Query: 1212 HFMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISDETAL--DKTQL 1269
                 ++T  I+D  EM+IV          G+ +N++ +L N+K+ + D      DK   
Sbjct: 1239 GEFWKVNTVDIIDEIEMSIVKRL-------GQLWNNTCVL-NLKLYVVDINFFWGDKNAK 1290

Query: 1270 EA---LDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIFKSSK 1326
                  D+L+  +             Q     +  T +++  T+S    S++  +F  S 
Sbjct: 1291 VVDLYFDKLDFDLG------------QRTRDLDGETIVSEKITLS-KLRSVRATVFDRSI 1337

Query: 1327 NRLTKVLPIAWFEIL----MFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLK-- 1380
                +  P A    +     ++ +    VG VS L   S    + ++ +EW   Y+ +  
Sbjct: 1338 TEGVEERPPALSLAVEGWEAYSWMREKIVGSVSLL---STDITVDESQLEWLSVYIAEQR 1394

Query: 1381 -LAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFH 1439
             L K          E  +    D+   I   +E  +IS     PY+ITKPA+I RLS  H
Sbjct: 1395 DLIKNMLTSFTKLHEYWQGTRRDLLRDITTASEHYQIS---HEPYVITKPAFIMRLSNGH 1451

Query: 1440 VRDTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDK------SQFLDIFVDW 1493
            VR+  SW+IITRLRH+  +             +P E RN    +      S    +   W
Sbjct: 1452 VRENPSWRIITRLRHILTY-------------LPNEWRNNSAIQVSPTVDSTDASVASHW 1498

Query: 1494 KNWDVYEVEQSSLF-TLLFSGESTVHEEDLFNXXXX---------XXXXXXXXXPYAPQQ 1543
            + W++ ++ +S ++ T+  S +S    + L                         +   +
Sbjct: 1499 RRWEISDITRSYIYRTIFLSDQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVAHNFVITR 1558

Query: 1544 SSIIAKQIDLCVKKMSHDAILDFDTMGYDKKEIDFDLLISYADIRASM--QLIERIILLK 1601
            ++I+ ++I          A LD+D +         +L +S   I+  +  QL++   +  
Sbjct: 1559 ANIVGEEIPAAELSKVQQA-LDYDNV--------MNLTVSLGAIKGELNDQLLKLRNIFS 1609

Query: 1602 QKLFPQITDIENKTNRWVSKIYQTSFRIS-------------QLTLHMLIEKYMMLLDLQ 1648
            +   P +    +KT+  +SK Y+ +  ++             +LT  +L  K  +LL+  
Sbjct: 1610 KAQTPALK--RSKTSINISKSYKVNVLLAFDRSELQFVLGQTRLTNRILNGKAALLLEKL 1667

Query: 1649 DLSIAGLETSSEINSLLSAKFSSETLSFNLLYLDRIISRILLEKVTA---NFFGTENENI 1705
              S A       ++ +  AK S   L    L L   +SR L   +TA   ++  + + NI
Sbjct: 1668 KNSAA-----PALSFVFFAKRSESWLKHADLVLAEALSRELSLTMTAELWSYMPSLSINI 1722

Query: 1706 RFFTSNIGSVVLDSSDLTLTEMMKHA-RALLASIDDMK------AITPDHDSEKKNGHVD 1758
            +   S+I +       +T TE++ ++ + ++ SI ++K        TP+      N  + 
Sbjct: 1723 QCSNSHIRA-------MTSTELLVNSIKQIMESISELKRHFAMEKTTPNVQGTSTNLSIP 1775

Query: 1759 LV-WVLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNLSGISIIVNYTELLLDFYFNQL 1817
            L    L++    +  +     PF++R  +  L      +    I+++  +  +    +Q 
Sbjct: 1776 LQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYLNRVQSNEILISIWDANIILKSHQT 1835

Query: 1818 KLLRISNSVTKVDYRSN-----TLLTDIGLDTDIVKLTLSDNRVYI------EELTDSLN 1866
                 + ++  +  + N     + + ++GL T ++KLTLS+ R  +      E+L     
Sbjct: 1836 TEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMKLTLSEPRRILSSFLQDEKLIGESL 1895

Query: 1867 GTVSELIKIFKNKNADNEPAAPKFKPCSFKMNAIYIGLLTDLKTTNYVLEFNETAFSCAS 1926
            G +  L+++F +  A N+  +   +  S   N  Y G+L  + +T +V E +    +  +
Sbjct: 1896 GYIKGLLQLF-SPLARNKTQSSALR-WSLDANLNYFGILVPMASTFFVFEIHMLLAAMNN 1953

Query: 1927 RAEALEETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIED----DIKK 1982
             ++  +E    D+     + I+N  +L+  P +   LSK+ D  F+++++      +  +
Sbjct: 1954 ASDGQDE---GDHHVTGQVSIENCLLLIKEPSLPADLSKLLD--FSIRVMSSQKVPNSPQ 2008

Query: 1983 TLQIETPHSRVMLAPSTLIAVIFFIQEAKVSLQKVKQKGK----------FNSSSNAIEI 2032
            + QIE+ H RV L+P +L+ V++   + +  L+  ++  K          F+ S++A   
Sbjct: 2009 SYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHRKQDKAISPFSLFDGSASADR- 2067

Query: 2033 PPYFETLSVNILSNKLCLGWIFEEDTD-ENGIVIGYESLFAAYEKPYGKLTIVDGYVATA 2091
                +  S++ILS  LC+GW+F+   D + G++IG++ LF+AYEK YGKLT++DGY + A
Sbjct: 2068 --QIDFRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLFSAYEKHYGKLTLIDGYFSVA 2125

Query: 2092 QGKESNNFFFANGVPE-LNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVE 2150
             G+ ++ F+      +  NRS LS++QI +W       KDLF+R+N + L+V +L+ S +
Sbjct: 2126 NGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKDLFIRVNGEALEVSLLSNSFD 2185

Query: 2151 IVNVMRSSIESFQXXXXXXXXXXXXXXXTHNVAENLSDKVS--ILSIRSINCIAKYGGGI 2208
            I+    +SI+ FQ                    EN S+ +S  +  IR+I+C  KY GG+
Sbjct: 2186 IIESTLASIQKFQTLKKERMHKRDSGPRNKLNLENTSNNISPFLSHIRTIDCQFKYVGGV 2245

Query: 2209 INLYTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSC 2268
            + +Y+ DD+ + +   SLE+ SP + ++L Y HN   ++ H IR LV+++ THNIL+S C
Sbjct: 2246 LKIYSLDDLNR-AEGPSLEIKSPGVVIALKYNHNEAERRPHRIRCLVSIDPTHNILYSQC 2304

Query: 2269 VPVLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGA 2328
            VP+L ++    Q+ +++         H   E    + + S DYK+L    D A  +  G 
Sbjct: 2305 VPILNDIVEASQRMVQK---------HSPDETPLESSQ-SIDYKSLLDSFDIAFKVTSGR 2354

Query: 2329 QNITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISS 2388
            Q ++L+CEPRAK+QAD+GF +F   + T+      P  +SL   +I+ S RHIFSRE S+
Sbjct: 2355 QQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQSSVRHIFSRETSA 2414

Query: 2389 SAGINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLG 2448
            S  ++ V    + TH +    +G  L+SD+  + NMKQLQ + LFLDIW    K   K G
Sbjct: 2415 SFSVDFVDFTSIFTHPDV---FGVALVSDINVFFNMKQLQNLNLFLDIWQLNGKLNNK-G 2470

Query: 2449 SGPHSGQKCQPQALT---EFTTP-KIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWIS 2504
                  +K Q +++T     +TP  I W + +IF N    +D+ PSLG ++ ++   W +
Sbjct: 2471 RAKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSLRLSRTWFA 2530

Query: 2505 SHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFK 2564
            + H       +  + DEL+ KS+GRL G+F++KN  + S +++P   +   +  ++L+  
Sbjct: 2531 TDHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGSSEMSLSLS 2590

Query: 2565 MSHLSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASA 2624
            +  ++ K  FDYH FLI  + +++  +R+E D  G+L DLL+V++S   ++   TAL +A
Sbjct: 2591 VGRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDFCATALTAA 2650

Query: 2625 NLYDIYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRL-RTNLTAEIGSF 2683
            N+ DIY T  RMR +N+ SY++TL+ESN  +  ++    +++L  L L RT+L+ +I +F
Sbjct: 2651 NILDIYNTITRMRQDNRISYIETLRESN-STEARVTLLYDDILQSLNLLRTDLSFDITTF 2709

Query: 2684 RLYVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQ 2743
            +  + P +LFD EVLVL  + ++  + TQ+ +K KT+L  Q+ +  +SL+  K EL EE+
Sbjct: 2710 KAQISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSKEELDEER 2769

Query: 2744 FAELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTD-IEFLYSSSFGDKVDIKWN 2802
             A++S+E+Y   A+ + G  I+  P + V +TTWQK P +D IE+L++  F D+V +KWN
Sbjct: 2770 VAKISIEDYMLYASKISGGTIVKVPRLLVSMTTWQK-PKSDLIEYLFTCRFFDRVAVKWN 2828

Query: 2803 LDPINFIREMWATHVRALSVRRGHTEPSPS-KPFFEDENIAEKIKIVNLGTKYKYIPLEE 2861
            L PINFI+EMW+TH+++L+VR+  +  + S K    D +  E+IK      K +Y+PL+E
Sbjct: 2829 LGPINFIKEMWSTHIKSLAVRQTQSNKTMSEKDKQADLDPEEEIK-----AKLQYVPLDE 2883

Query: 2862 PHIEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917
            P+IEMP ++DLG+ATPP+EWFGV+RKR P   HQL +V +QKL++ AE +Y +  G
Sbjct: 2884 PYIEMPQIKDLGDATPPMEWFGVHRKRLPAATHQLAIVLIQKLVHAAEKEYAKVQG 2939

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 1368 bits (3541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 956/3078 (31%), Positives = 1550/3078 (50%), Gaps = 268/3078 (8%)

Query: 3    SSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQYKI 62
            SS+ FR  S+  +++ S  FLVDWIL VIL +   FYL R  A+ +T  L++ +W+Q K+
Sbjct: 6    SSAGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKV 65

Query: 63   KINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIR----------- 111
            K+++ ++++S L GR+FFKNLT++  D TI+ LEGS TWRYWL+ TR             
Sbjct: 66   KVSIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHAS 125

Query: 112  -GIDFESEDGDASENA-------KLPCRFLLQCDGLEVFVYNKIDVYESVL-------RD 156
             G    SED    + A       KLPCRFL +C+G E+F+YN+   Y++++       R+
Sbjct: 126  AGSSGNSEDDTKFDIANYMEKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVERE 185

Query: 157  HFTN--VTKDGQETESNDDITINTEXXXXXXXXXXXXXXXXXXXXXXTDAPKLSAKTKLF 214
             F       D  +  S+       E                           L    +  
Sbjct: 186  KFEKFMAENDFLDPSSDGSSDDKIEETSSATNSTDEETIANDRTFQNDTRKTLPRYLEAL 245

Query: 215  PIQLEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFEL 274
            PI+   N+ +I++GN+ T  V +  FE A  + D+  + S LD YR K  + L +    +
Sbjct: 246  PIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLYRMKYEVRLKNLEIMM 305

Query: 275  RTNLGYQNDNPIKTFVVEK-TMDKIWQTVKKQCISISKLL-LPNQGKTINNQ--QAYIDS 330
            + N+ Y N+   + F  +K  + ++W    +    I KL+  P +      Q    ++  
Sbjct: 306  KQNIDYDNEKS-RNFEFDKGKLSRLWHRFTR----IFKLVPFPFKSNRRKEQPHDNFMQK 360

Query: 331  WKGLDLYHHTKAVQEENVDTTV--LHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSS 388
            WKGL +Y +    + +  D     +   EYA+++ ++K+ RV++ + +D+PG VP  +  
Sbjct: 361  WKGLSMYRNDMFGEFDEFDDIEFDISSHEYAKFTSLLKSPRVTIHHDYDMPGWVPHGAHP 420

Query: 389  INSQSDRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMK 448
             +S +D  +  N   +   P +  +I+I+   V YGPWA +    +  L SP VSR    
Sbjct: 421  PSSYADGPDVGN---NMAPPQYIFEINIFGGTVCYGPWAQRQTNHLQSLLSPSVSRTAKP 477

Query: 449  ATKPEPGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVS 508
              K +PGS RIY   KL+++  +     IPTRESSKD EF+  YK T D +R FGW+++ 
Sbjct: 478  IKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYKETNDDYRPFGWIDIK 537

Query: 509  LNEGGEILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGW 568
            ++     +F+LA+C  +    N + V L++ EI+SSVNH++  +  + +   +IGYP GW
Sbjct: 538  VSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKSKSFSFNCDIGYPLGW 597

Query: 569  NKQADWLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYK 628
            N +A+W   +DS   ELFLLR+H++LI+D  TDFS+ + + YELFRPF Y IKW    Y 
Sbjct: 598  NAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELFRPFVYHIKWNMKGYS 657

Query: 629  LFXXXXXXXXXXXXXXXXXXCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLS 688
             +                  C+LS+ GD L  ++ +P  +I       T+ + +P+ +L 
Sbjct: 658  FYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRFTNMTYDIYTPMFRLL 717

Query: 689  IHPPCWNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGF 748
            ++ P WNTL+EF+     G   DF + G+Y+ +  +D+DN DT+ ++  S  T    +GF
Sbjct: 718  LNTPPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLTVECSSRGTALHIYGF 777

Query: 749  VLRYLMNIKLNYFGDFNHFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDG 808
            V+RYL+N+K+NYFG+F HF T+EEY+ +    +     +++ ++   +  ES++  SS+ 
Sbjct: 778  VIRYLINVKMNYFGEFFHFVTSEEYTGNTRPTDLENIISEDRRDDDFSSYESVSRISSNS 837

Query: 809  SYQVADTINENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEF 868
            S +      ++++ KS L RT NETD+W TF V DG +I+PE +Y+      L F  L  
Sbjct: 838  SDKNPKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALILPETIYNADPCIALHFAELIV 897

Query: 869  DMRYTNYFMDLTAFFSRI----YLNHSNEFSFNRVVAIEESHSENTGYLDDLNLHGHRMF 924
            D+R  NY+MD+ A    I    Y+    +  +  V        E  G L D+ +HGHRM+
Sbjct: 898  DLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNGKDHEVHGTLSDIYIHGHRMY 957

Query: 925  GVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDV 984
            G+PP E TY C+WD+  G L+ DS+  FL     A  K+GF YKD ENIL+Y     +D+
Sbjct: 958  GLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIGFGYKDLENILLYETEIIDDM 1017

Query: 985  TSLTISIG----RVSSIVRTNHGGSATLSLNDITINSWDLSNSRYSKRVDLLVAAI--SV 1038
            TSLTI I     R++ +  T H   A L L        D  N RYSKR+D+ + ++  ++
Sbjct: 1018 TSLTIFINTIDIRLNDVDTTAH---ADLKLERFCFTLIDFENERYSKRMDIKIPSLEFNI 1074

Query: 1039 CAIDEKKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNH 1098
             + ++    L      +  T FV   +   HR  Q++ ++LND+P+HRC FLL  +    
Sbjct: 1075 FSNEDNDLSLLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVLNDAPYHRCAFLLP-ESYQK 1133

Query: 1099 STLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDIIDTKNXXXXX 1158
            S +Y++L G+I PS SLP L  PLT  T + + E LL  Y+ L   + DI ++       
Sbjct: 1134 SRIYNELFGAIAPSSSLPPLPIPLTADTIEYVLEDLLEDYMGLFEGNYDIKESSVENLEL 1193

Query: 1159 XXXXXXXXXSN-----TVSNDLSGQLAE-EFESENTTVNISTLSVFVTPKAFTFAENAAH 1212
                     +      T SN ++  L++   ES+N  V + ++ + + P  +T  E    
Sbjct: 1194 SAIEATRAITGIGAERTHSNPIT--LSDYAVESDNYVVKVESIVIDINPALYTTIEKLLK 1251

Query: 1213 FMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNIS------DETALDK 1266
             +       I+D  E+ IV   S  H       +    + NVKV I        E   D 
Sbjct: 1252 HIYDQDAVQIIDGIEIGIVKRLSSIH-------DGVTTMTNVKVQIKHFNLFWGEKESDN 1304

Query: 1267 TQLEALDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIFKSSK 1326
              +   D+++ +++            + LEQ++E   +  + T+     +++  + +   
Sbjct: 1305 VSM-FFDKMDFALTE-----------KTLEQNSEKNLL--EMTVLAKIKAVRLTVVQQPG 1350

Query: 1327 NRLTKVLPIA------WFEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLK 1380
               T+  P A       FE   ++T +   V  +S     S    + DA VEW  +Y+++
Sbjct: 1351 LIPTQERPPAITVGVEGFE--FWSTAIEKQVNSIS---VSSADITVDDAQVEWFFKYIVR 1405

Query: 1381 LAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHV 1440
                F    +S   +   R    KE I R+    +   I   PY+ITKPA+I RLS+ HV
Sbjct: 1406 QKYFFLDMLQSYNRIQNNRIESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHV 1465

Query: 1441 RDTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQ-----FLDIFVDWKN 1495
            R+  SWKIITRLRH+  +            ++ + +R+   D SQ     F+ IF +W++
Sbjct: 1466 RENKSWKIITRLRHILTYLPK-----DWYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRS 1520

Query: 1496 WDVYEVEQSSLFTLLFSGESTVHE----EDLFNXXXXXXXXXXXXXPYAPQQSSIIAKQI 1551
            W+  +V +S ++  LF  +    +    + LF               Y    S +++   
Sbjct: 1521 WEFSDVARSYIYGKLFLNDHAEKKKQSLQKLFKLNIGNFFMTVYSTNYDVDHSIVVSNA- 1579

Query: 1552 DLCVKKMSHDAILDFDTMGYDKKE--IDFDLLISYADIRASMQLIERII---LLK-QKLF 1605
                       +L+      + KE  +  + LI   DI  ++ +I+  +   LLK QKL 
Sbjct: 1580 ---------KLLLELTPSSTEPKENSLQREELI---DISGTVDVIKGKLSTKLLKLQKLI 1627

Query: 1606 PQITDIENKT-----NRWVSKIYQ--TSFRISQLTLHMLIEKYMMLLDLQDLSIAGL--- 1655
            P +T+   K         + K ++   +F ++   + ++++   + +++ D  I+ L   
Sbjct: 1628 PILTEGSEKQPVKPPQDTIPKPFKMNAAFMVNSCDIQLVMDATKLNMNVNDGRISVLWEN 1687

Query: 1656 ---ETSSEINSLLSAKFSSETLSFNLLYLDRIISRILLEKVTANFFGTENENIRFFTSNI 1712
                T+   + +L +K +   L        + I+ +L E   +NF+ T       FT++ 
Sbjct: 1688 LQDSTAQAGSVVLFSKHTELVL--------KHINSVLAEGRVSNFYAT-------FTTDT 1732

Query: 1713 GS------VVLDSSDLTLTEMMKHARALLASIDDMK----AITPDHDSEKKNGHVDLVW- 1761
             +      +   SS +    M K  R L+ +I D+K     I+   + E++      V+ 
Sbjct: 1733 WAQRPTYLIHSKSSSIHFRTMAKTER-LVEAIKDIKLKIDQISEQLELERRLTQHPTVYD 1791

Query: 1762 ------VLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNLSGISIIVNYTELLLDFYF- 1814
                  + S    ++ +      PF ++     +DF +      S ++   +   DF+  
Sbjct: 1792 PNKSNVIASCLFSNVSMDIMPVSPFALKNSAKQIDFFYNKFDSDSWLIKLKD--TDFFLT 1849

Query: 1815 -NQLKLLRISNSVTKVDYRSNT-----LLTDIGLDTDIVKLTLS-----------DNRVY 1857
             +Q K   +  S+ K+  R N       L DI L T++VKLT S           D RV 
Sbjct: 1850 SDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINLSTNLVKLTFSEPKNIVYSFLKDERVA 1909

Query: 1858 IEELTDSLNGTVSELIKIFKNKNADNEPAAPKFKPC-SFKMNAIYIGLLTDLKTTNYVLE 1916
             E +   L  T+  L  I  +K +  +    K +   S   +  Y G+L  + +T YV+E
Sbjct: 1910 SESV--HLLQTLKPLFSISDDKESTPQSYQEKTEYLWSLDSSIDYFGILIPMTSTYYVME 1967

Query: 1917 FNETAFSCASRAEALEETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLI 1976
            F+ +  S  S A      +  D    MS  ++N+  L+    +   LSK+ DI   +  +
Sbjct: 1968 FH-SYVSSISNANGAPSGNL-DITGHMS--VENILFLIKESSLPDGLSKVIDIAVNVSTL 2023

Query: 1977 E--DDIKKTLQIETPHSRVMLAPSTLIAVIF-FIQEAKVSLQKVKQKGK-----FNSS-- 2026
            +  DD  +++Q+E+ H+R+ L+P +L+ +++ F Q  K+S   +K   K     F  S  
Sbjct: 2024 QRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKLSEHYLKYHSKSLWQSFAKSDD 2083

Query: 2027 ----SNAIEI--PPYFETL-SVNILSNKLCLGWIFE-EDTDENGIVIGYESLFAAYEKPY 2078
                +N+I+     +F ++ S++ LS  LC+GW+FE E     G++ GY  LF+AYE   
Sbjct: 2084 KQQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYELGPPKGLITGYSRLFSAYENCM 2143

Query: 2079 GKLTIVDGYVATAQGKESNNFFFANGVPEL-NRSHLSSMQINFWFSGQFIEKDLFVRMNA 2137
            GKLT++D Y A AQG  S+ F+    V EL NR +L +MQI FW+      KD++VR   
Sbjct: 2144 GKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNMQILFWWKVIEGMKDVYVRFTG 2203

Query: 2138 DKLDVRILTTSVEIVNVMRSSIESFQXXXXXXXXXXXXXXXTH---NVAENLSDKVSILS 2194
            + LDV+ L+  +  +     SI+ FQ                H   +   N S+ + + +
Sbjct: 2204 ETLDVKYLSDFMLTIESTLHSIKMFQKLKKELIVETPKREVVHIKEDKPVNSSNNI-LKN 2262

Query: 2195 IRSINCIAKYGGGIINLYTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSL 2254
            I+S+NC  KY GG  +++   D    +P  ++E+ SP I V + Y H   + K H IR L
Sbjct: 2263 IKSVNCHFKYDGGTYSVFNISD-GSLNPTPAIEIKSPVISVDVLYKHEKQNTKHHSIRCL 2321

Query: 2255 VNVESTHNILFSSCVPVLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNL 2314
            VN++ THN+L+++C P++ N   +++    R+ SE K        +TT T   + DY+ L
Sbjct: 2322 VNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENK------HSETTPTSVQNIDYEKL 2375

Query: 2315 FKKIDTAIVINVGAQNITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEI 2374
             +  D AI +    Q ++L+CEP+AK+QAD+GF    +SM T+  D  EPL+ S    + 
Sbjct: 2376 LEDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFDIDEPLAFSFSIKDT 2435

Query: 2375 EISTRHIFSREISSSAGINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFL 2434
            + S +H+FSRE S+S G+  + L  + TH N I TYG +LISD+  Y N+KQLQ + LFL
Sbjct: 2436 KASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDLYFNVKQLQNLYLFL 2495

Query: 2435 DIW------SPKTKKAQKLGSGPHSGQKCQPQALTEFTTPKIPWIYQIIFKNTSAVIDMD 2488
            DIW      +P T   +++          +P         ++PW + +IF N    ID+ 
Sbjct: 2496 DIWQLSELLNPVTSSQEQVIRKDKKKSVDKPI----HNESQLPWCFTLIFTNVKGDIDLG 2551

Query: 2489 PSLGSINFKVPTFWISSHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWP 2548
            PSLG I+ ++   W+++ H       +  ++D+L   S+GRL G+  I    + S + W 
Sbjct: 2552 PSLGLISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEGRLSGVVNIDGASWVSEVIWL 2611

Query: 2549 VKDNKFEAPLINLAFKMSHLSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVS 2608
                +   PL+ L+     +  K  FDYH FLI  V+++   + +ERD  G+  DLL VS
Sbjct: 2612 QDSKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNILFQLHSERDMVGVAPDLLKVS 2671

Query: 2609 MSFGSVNIFLTALASANLYDIYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLA 2668
             S   + +  TAL +AN+ DIY T  RMR + K SY++TLK+SN E++ K   +  ++L 
Sbjct: 2672 FSCEEIKLCSTALVAANILDIYNTIIRMRQDTKISYIETLKDSNMETN-KQTLAYRDILK 2730

Query: 2669 PLR-LRTNLTAEIGSFRLYVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRD 2727
             L+ LRT+LT  I S +L + P +LFD EV+V+    ++  + T +E K  T L  ++ D
Sbjct: 2731 SLQLLRTDLTVSICSLQLQISPISLFDVEVVVINVVSVSARSETHSEAKLTTSLNMEVYD 2790

Query: 2728 INISLAQFKNELTEEQFAELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEF 2787
              +SL+  K EL E+  ++++V +Y   A+ + G  I+  P + V +TTWQ+     +E+
Sbjct: 2791 ATLSLSTAKQELDEDALSKITVADYMTYASKIRGGTIIEIPRMGVQMTTWQEEKSDILEY 2850

Query: 2788 LYSSSFGDKVDIKWNLDPINFIREMWATHVRALSVRRGH--------TEPSPSKPFFEDE 2839
            LYS  F DKV ++WNL P+NF++EMW THV+A++VRR          +E    K   E+E
Sbjct: 2851 LYSCKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQVLTGSFNVSEKDVEKRIKEEE 2910

Query: 2840 NIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVV 2899
            NI          TK  Y+P+EEP I+MP ++DLG+ATPP+EWFGVNRKRFP   HQ  VV
Sbjct: 2911 NI----------TKLNYVPVEEPQIDMPQIKDLGDATPPVEWFGVNRKRFPAFTHQTAVV 2960

Query: 2900 PLQKLIYVAEDQYNRTLG 2917
            P+Q L+Y+A+ QY +TLG
Sbjct: 2961 PVQNLVYLAQKQYAKTLG 2978

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 1097 bits (2838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 790/2636 (29%), Positives = 1310/2636 (49%), Gaps = 212/2636 (8%)

Query: 408  PAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSV 467
            P    +  ++ A++ YGPWAH+++ +I R+FSPIVSR       PEPG LR Y   K+SV
Sbjct: 595  PESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTMTKISV 654

Query: 468  DFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQADR 527
               + S   +PTRE SKD++F+KRY  T D+ R+FGW +++ +   E  F ++     + 
Sbjct: 655  SIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSIPDVNG 714

Query: 528  LPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAELFL 587
              N+L +   + E++SSVNH++ FR  +  + ++IGYP GWN +  W F  DS   E F 
Sbjct: 715  YANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQLETFF 774

Query: 588  LRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFXXXXXXXXXXXXXXXXX 647
            LR+H+ LI+D F+DFS+ +   YE FRP  Y++ W F  Y  +                 
Sbjct: 775  LREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNPLDFNE 834

Query: 648  XCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFG 707
             C++S+ GD  +  + +P   I     +  F + +P+ +L ++ P WNTL+EF+     G
Sbjct: 835  NCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMRNKEIG 894

Query: 708  ECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHF 767
               DF+  G+YI +  +D+DN D++ I+  +     L++GFV+ YL+N+++NYFG+F+HF
Sbjct: 895  RGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFGEFSHF 954

Query: 768  KTTEEYSN--------------DLSM--EEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQ 811
             T EEY++              D S+  E ++ +   N Q  P N  +S           
Sbjct: 955  ITAEEYTDIVRGNDNDIVSTLADFSVMSETNSVSNVSNSQHNPDNSSKS----------N 1004

Query: 812  VADTINENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMR 871
            + D +    + K  + R  NETD+W TF V +G +++PE LY+      LSF+ L  D R
Sbjct: 1005 IIDPLYNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFR 1064

Query: 872  YTNYFMDL------TAFFSRIYLNHSNEFSFNRVVAIEESHSENTGYLDDLNLHGHRMFG 925
              +Y++DL      T+F   I  N ++ F      AI+  + E  G + ++++HGHRM+G
Sbjct: 1065 NCDYYLDLLATLNGTSFKRCIRKNQNDIFELVHNNAIK--NLEEHGSVSNISIHGHRMYG 1122

Query: 926  VPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVT 985
             PP   +Y   W + + +LS +SD  F+  F+  I KVGF + + +NIL+Y     +++T
Sbjct: 1123 APPTSPSYFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMT 1182

Query: 986  SLTISIGRVSSIVRTNHGGSATLSLN--DITINSWDLSNSRYSKRVDLLVAAISVCAIDE 1043
            S+T+  G    I+  +   SA + LN   IT N  + +N RYS R+DL V  +     D 
Sbjct: 1183 SVTVH-GTGIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDN 1241

Query: 1044 ----KKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHS 1099
                 KT LF   T +  T F    + + H   QQ  + LNDS FHRC FLL    +  S
Sbjct: 1242 GSSMDKTCLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLL-LPHIQES 1300

Query: 1100 TLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDIIDTKNXXXXXX 1159
             LY +L G ITPS S+P L  P+  +T   I +  LG +   IN    +           
Sbjct: 1301 LLYHELYGGITPSSSVPPLPIPVQAETIAFIIDDFLGPF--GINSTELLGSISTSTPIHS 1358

Query: 1160 XXXXXXXXSNTVSNDLSGQLAEEFESENTT-----VNISTLSVFVTPKAFTFAENAAHFM 1214
                    S++V + +    +    S++ T     ++IS +++ + P  FT+A N   F+
Sbjct: 1359 SNKPLKPPSSSVIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASN---FL 1415

Query: 1215 LTMSTESIM---DYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISD-ETALDKTQLE 1270
                +E+I+   D  EM IVN       T  +  +S   + N+K+ I   +    +   E
Sbjct: 1416 DEFYSENIIETIDGIEMAIVNRLG----TKSEELDS---VTNIKLQIKYLDFFFGQRNTE 1468

Query: 1271 AL----DRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIF-KSS 1325
             L    D+++L VS  +   K             ST + D+  I   F SL+ +I  K  
Sbjct: 1469 GLELYVDQIDLEVSQKTFQKK-------------STVVLDEIAILSRFLSLRASINEKKV 1515

Query: 1326 KNRLTKVLPIAWFEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLKLAKAF 1385
                 +  P     +  +     +   +V+ L   S    + ++ +EW ++YL +L   F
Sbjct: 1516 LEDFDERPPALSLALEGWEGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLV-VF 1574

Query: 1386 CKEGKSCIELGKLRSIDMKETIIRVAELG-KISGIDSVPYIITKPAYITRLSKFHVRDTA 1444
              E  + ++  + +S  +++ ++    L  +   I   PY+ITKPAY+ R+SK HVR   
Sbjct: 1575 VHELVNSLDSIQKKSNGIQKKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNR 1634

Query: 1445 SWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQFLDIFVDWKNWDVYEVEQS 1504
            SW+I+TRLRH+  +     E   Q +   +++ ++      FL +F +W+NW+V +V +S
Sbjct: 1635 SWRIVTRLRHIYTYLPDDWEIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARS 1694

Query: 1505 SLFTLLF-SGESTVHEEDL---FNXXXXXXXXXXXXXPYAPQQSSIIAKQIDL------- 1553
             ++  +F S + T  E+ L                   YA   + I+ K + L       
Sbjct: 1695 YIYKKIFLSNDETTSEKKLQTTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLELTTET 1754

Query: 1554 CVKKMSHDAILDF-DTMGYDKKEIDFDLLISYADIRASMQLIERIILLKQKLFPQITDIE 1612
             V      +IL+   ++G  K E     L          +L+E I       F +  DI+
Sbjct: 1755 AVSPPIEKSILNMTGSLGSIKGEFSDKFL----------RLLELI-----PDFSKEEDIK 1799

Query: 1613 NKTNRWVSKIYQTSFRISQLTLHMLIEKYMMLLDLQDLSIAGLETSSEINSLLSAKFSSE 1672
            + T    S I         + L +L E   + L + D +++   T  +I++LL     S+
Sbjct: 1800 SLTEN--SSIVSEKSPYFTIHLFLLFENGGLQLTMGDTTLSNNVTDGKISALLEKSSYSK 1857

Query: 1673 TLSFNLLYLDRIISRILL--EKVTANF----FGTENENIRFFTSNIGSVVLDSSDL---- 1722
              S++  Y  +     L   + + A F     G  +  I      +  + L S+DL    
Sbjct: 1858 EFSYSGAYYMKKSEMCLKHNKDIIAEFQLHHLGLISTGIYTPICPVILINLRSADLHFKS 1917

Query: 1723 ---------TLTEMMKHARALLASIDDMKAITPDHDSEKKNGHVDLVWVLSLKVGSLQLQ 1773
                     T+ ++ +++  L    D  K  T     ++K   ++    ++  +  +  +
Sbjct: 1918 LASTEKIVKTIEDITEYSVHLYKHYDLRKYTTKPTKVDQKPEKINFDVRVACNLSKVSAE 1977

Query: 1774 TSAFVPFIIRILISGLDFNFKNLSGISIIVNY--TELLLDFYFNQLKLLRISNSVTKVDY 1831
             +   PF +R     LD  F       I+++   T++ +  +  + +  R S    +++ 
Sbjct: 1978 LTLISPFYLRYETKQLDLYFNQNGDGEILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINC 2037

Query: 1832 ----RSNTLLTDIGLDTDIVKLTLS-----------DNRVYIEELTDSLNGTVSELIKIF 1876
                  N +L  + L   +VKLT S           D R+ IE   +     + +L KIF
Sbjct: 2038 NPMSEKNKVLV-VSLSASLVKLTFSEPRRIFASFLQDERITIESFQE-----LKKLKKIF 2091

Query: 1877 ----KNKNADNEPAAPKFKPC--SFKMNAIYIGLLTDLKTTNYVLEFNETAFSCASRAEA 1930
                KN    N     +  P   + ++N  Y G+L  + +T +VLE +    S  +  E 
Sbjct: 2092 FSNAKNVKKLNNDVPKEDTPTKWALELNINYFGILLPIASTFFVLELHMLLGSLTNTTEE 2151

Query: 1931 LEETHANDNLREMSLVIQNVCILVLNPEVLP-TLSKIFDIGFALKLIEDDIK--KTLQIE 1987
            ++E    +N     + ++N+  L+ N   LP  LSK+ D    +  ++      ++LQIE
Sbjct: 2152 IQEV---NNQISGQISLENILFLI-NDRSLPLRLSKLVDFSIRISTLQKTTSSYESLQIE 2207

Query: 1988 TPHSRVMLAPSTLIAVIFFIQEAKVSLQKVKQ---KGKFNSSSNAI-------EIP-PYF 2036
            + H R+  +P +L+ V++ +++ +  L+  K    K ++N SS+         E P  YF
Sbjct: 2208 SSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKRQWNLSSHKTGTKSSTSESPLNYF 2267

Query: 2037 ETLSVNILSNKLCLGWIFEEDT-DENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKE 2095
               S++ILS   C+GW+  E+  D  G + GY+ LF+AYEK YGKLT+++GY++      
Sbjct: 2268 R--SIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAYEKNYGKLTLIEGYMSVTNSNS 2325

Query: 2096 SNNFFFANGVPE--LNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVN 2153
            SN+FF + G  +   NRS L SMQI +W      +KDLF+R++ D LDV IL+  V I+ 
Sbjct: 2326 SNDFF-SQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFIRLHGDALDVDILSNFVNIIE 2384

Query: 2154 VMRSSIESFQXXXXXXXXXXXXXXXTHN--VAENLSDKVSIL--SIRSINCIAKYGGGII 2209
            ++  S + F+                H    +EN ++ V      I SINC  KY GG +
Sbjct: 2385 LIFKSYQIFEDFRKSKIVQNIEKQKHHEHIKSENATEFVPTFLSDINSINCEFKYEGGTL 2444

Query: 2210 NLYTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCV 2269
             +++ DD+  DS   SLEL +P + + L+Y H   S K HW+R ++++ S+HNIL+S C 
Sbjct: 2445 RVFSVDDVEIDS-TPSLELNAPKVSIYLNYKHFDDSPKPHWLRCVIDIHSSHNILYSKCA 2503

Query: 2270 PVLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQ 2329
            P ++     IQ+ +E    E KQ V K    T N       YK +    D A  I    Q
Sbjct: 2504 PFVIEFVESIQEILENRPVEPKQSVSKIA--TPNRT-----YKRILAPFDIAFRIKAAKQ 2556

Query: 2330 NITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSS 2389
             ++ +CEP AK+QA++G  +F   + T      +PLSL+L  ++I  S +HIFS+E S+S
Sbjct: 2557 MLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKISTSVQHIFSKEASAS 2616

Query: 2390 AGINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLGS 2449
              +N + L F+ T       Y   LISD+  + NMKQ Q + LFLDIW      ++ +G 
Sbjct: 2617 FSLNFIDLTFIFTQPTL---YCVGLISDIDIFFNMKQQQNLLLFLDIW----HLSESIGI 2669

Query: 2450 GPHSGQKCQPQALTEFTTPK-------IPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFW 2502
             P+  ++   +       P+       IPW + IIF N +A I + P+LG ++ K+   W
Sbjct: 2670 RPNRKKRKHKKHKGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSAKLEKTW 2729

Query: 2503 ISSHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLA 2562
              S   +D    +  + D +  KS GRL G+ +I N  +   +++   +  + +P++ + 
Sbjct: 2730 FISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNSPIVAIG 2789

Query: 2563 FKMSHLSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALA 2622
              +  ++ K  FDYH F+I++V+++   + +ERD  G L DLL+ ++    ++I  T L 
Sbjct: 2790 IDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDLLLTTLLCEEISICSTTLV 2849

Query: 2623 SANLYDIYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRL-RTNLTAEIG 2681
            ++N+ DIY T  R R + K SY +TL ESN + + + +   +++L  L L RT++  ++ 
Sbjct: 2850 ASNILDIYNTIIRTRQDTKNSYFETLMESNNQDT-RTNIPYSDILKSLNLLRTDVQIDVS 2908

Query: 2682 SFRLYVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTE 2741
              +L + P +LFD EVLV+  + M+  + T +  K KT L  Q+ + +++L+  K EL E
Sbjct: 2909 KLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAKEELDE 2968

Query: 2742 EQFAELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKW 2801
            E   ++SV +Y   A+ ++G  IL  P + VG+TTWQK+    IE+ ++  F  KV ++W
Sbjct: 2969 ESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGKVSVRW 3028

Query: 2802 NLDPINFIREMWATHVRALSVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEE 2861
            NL P+NFI+EMWATHV++L+VR+   E        E E+  E I +     K+ Y+ L E
Sbjct: 3029 NLGPVNFIKEMWATHVKSLAVRQARIEEPVEYSSEELESSPESIYLEPAQPKFTYVALVE 3088

Query: 2862 PHIEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917
            P IEMP ++DL +ATPP+EWFG+NRK+FP   HQ  V+ +QKL++  E +Y + +G
Sbjct: 3089 PSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQTAVIVVQKLVHAVEKEYAKIIG 3144

 Score =  153 bits (386), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 101/156 (64%), Gaps = 8/156 (5%)

Query: 7   FRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQYKIKINL 66
           F  +S+S EK  S  FLV WIL  ILC+L  FY+ R+ A+ LT  LD+ +WR YK+KI+ 
Sbjct: 7   FVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVKIHC 66

Query: 67  QSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESED------- 119
           +SI++S L  RI FKNL +++ + TIS LEG   W+YWLL+TR+   +   +        
Sbjct: 67  ESIRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELHQQQKEHGYIT 126

Query: 120 -GDASENAKLPCRFLLQCDGLEVFVYNKIDVYESVL 154
            G   +N +LPC+FL QC+G E+FVYNK   YE+++
Sbjct: 127 PGSGFKNIQLPCKFLFQCEGAEIFVYNKTSAYENII 162

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 93/187 (49%), Gaps = 17/187 (9%)

Query: 213 LFPIQLEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISD-LDYYRTKISLDLYDAL 271
            +P  L+  + +I+ GN+ T  + +  ++ A+G+ D+  + +  +D Y+ K+ LD  +  
Sbjct: 300 FYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQNFE 359

Query: 272 FELRTNLGYQNDNPIKTFVVEKTMDKIWQTVK----------KQCISISKLLLPNQ--GK 319
            E++ N+ Y++D+  K F  +  + ++W               + I  S+L   +     
Sbjct: 360 IEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFLED 419

Query: 320 TINNQQAYIDSWKGLDLYHHT---KAVQEENVDTTVLHEQEYARYSRVMKAERVSLTYYF 376
            I   + +   WKGL LY      +   EE+++   L+  EYARY  ++KA R+  T  +
Sbjct: 420 NIFEDEDFEKKWKGLSLYKDAALNRGNPEEHIEFDFLN-HEYARYCSIVKAPRLIFTNEY 478

Query: 377 DIPGIVP 383
           DIPGIVP
Sbjct: 479 DIPGIVP 485

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/1111 (42%), Positives = 682/1111 (61%), Gaps = 36/1111 (3%)

Query: 1834 NTLLTDIGLDTDIVKLTLSDNRVYIEELTDSLNGTV---SELIKIFKNKNADNEPAAPKF 1890
            N +  ++G+ + I KLT+SD R +I  L +     +   ++L  + +   + N+  + + 
Sbjct: 1896 NAMFLNVGVASGISKLTVSDPREFIYSLVEDETLAIKNFAQLKSLAEKFPSKNQEKSKQR 1955

Query: 1891 KPCS----FKMNAIYIGLLTDLKTTNYVLEFNETAFSCASRAEALEETHANDNLREMSLV 1946
            K  +      +N  YIG++  L +  YVLE N    S ++   A +      +       
Sbjct: 1956 KQTNIIWLLHVNVEYIGIIVLLGSAGYVLELNNVLTSLSNNISARKYLEQGLHGIVGDFS 2015

Query: 1947 IQNVCILVLNPEVLPTLSKIFDIGFALKLI--EDDIKKTLQIETPHSRVMLAPSTLIAVI 2004
            I+NV +L+    +   LSK+ D+   LK+   E D  + +QIE+ H RV L P +L  V+
Sbjct: 2016 IENVLLLIHANRLKGELSKLVDLAVNLKVSQEEGDDLQNIQIESSHFRVALCPMSLTKVL 2075

Query: 2005 FFIQEAKVSLQKVKQKG-----KFNSSSNAIEIPPYFETLSVNILSNKLCLGWIFEEDTD 2059
            + I E     +  K +      K  + ++  E+   F   S+ ILS   C+GWIF+  ++
Sbjct: 2076 WAINEFTRVSEAYKTRSSLLQHKKTAPTDISELSNKFR--SIQILSYNFCIGWIFDAGSE 2133

Query: 2060 EN-GIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFFANGVP--ELNRSHLSSM 2116
             + G++ GYE LFAAY+KPYGKLT++D Y + A G  S+ FF +NG    + NRS+L SM
Sbjct: 2134 TDPGLIWGYERLFAAYQKPYGKLTLLDAYFSIAHGASSDTFF-SNGKEKDQFNRSYLPSM 2192

Query: 2117 QINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQXXXXXXXXXXXXX 2176
            QI +WF  +    +LFVR+  ++LDV  L++S+ I N    SI++FQ             
Sbjct: 2193 QIGYWFVKEGDTSNLFVRITGERLDVNFLSSSIGIANGAVKSIQTFQELKKTMVDPFATN 2252

Query: 2177 XXTHNVAENLSDKVS-ILS-IRSINCIAKYGGGIINLYTPDDIAQDSPKSSLELTSPSIE 2234
              T     + +  +  ILS IR+ NCI KY GG+  L++ +DI Q++ K S E+ SPS+E
Sbjct: 2253 KTTEKPVNSEAAPLDPILSKIRAFNCIVKYAGGVFKLFSEEDI-QNNSKPSFEVESPSVE 2311

Query: 2235 VSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQKQMERFNSEKKQLV 2294
            V++DY H     K HWIR LV V+ ++N LF +CVP+L  +T +++  ++ FNS+ K   
Sbjct: 2312 VAIDYKHLPDVIKSHWIRGLVTVDPSNNTLFPTCVPILSGMTKDVRNMLKSFNSKPKP-- 2369

Query: 2295 HKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQADLGFSNFRISM 2354
                ++ +       +YK L +  D A ++N+G Q I+L+CEP+AK+QAD+GF    + M
Sbjct: 2370 ----DRNSTISSSGMNYKKLLRAFDIAFLVNIGKQGISLSCEPKAKVQADVGFEKLAVKM 2425

Query: 2355 FTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFMLTHENTIKTYGNTL 2414
            FT++ D+SEPLSLS+    +  ++RHIFSRE+S+S  I+ +   F+LTH   I+TYG TL
Sbjct: 2426 FTNNLDNSEPLSLSIDIEHLRATSRHIFSREVSTSFQIDHIDAVFVLTHPEIIQTYGTTL 2485

Query: 2415 ISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLGSGPHSGQKCQPQ---ALTEFTTPK-- 2469
            +SD++ Y NMKQLQ++ LFLDIW P ++  +    G    +         +++F  P   
Sbjct: 2486 VSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMPKGGNTRTRSLSSHDKLPVSKFQKPAGT 2545

Query: 2470 --IPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFYLDELNSKSD 2527
               PW Y +IF N    ID+ PSLG ++ +    W  S H VDW   +S +L+ +   SD
Sbjct: 2546 NAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNRSWAISDHFVDWRQRLSVFLENILLSSD 2605

Query: 2528 GRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHSFLIARVSDL 2587
            GRLGG   I+ + + S ISWPVK   +E PLI+L+ ++  L+ K  FDYH FLIA V  L
Sbjct: 2606 GRLGGFLGIERVCWSSEISWPVKGGFYETPLISLSLELGSLALKTSFDYHMFLIANVEHL 2665

Query: 2588 QLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIENKKSYVQT 2647
             L + NERDE G+LKDLL VS++ G +++FLTALASAN  DIY T  RMR +NK SY++T
Sbjct: 2666 LLKLYNERDEMGILKDLLAVSVTCGKIHLFLTALASANAIDIYNTIIRMRQDNKNSYIET 2725

Query: 2648 LKESNPESSGKIHFSNNELLAPLRLRTNLTAEIGSFRLYVFPSTLFDSEVLVLKANKMNV 2707
            LK+SN +S+     + N L +   LRT+L+  I  F L VFPSTLFD EVLVLKA  M+ 
Sbjct: 2726 LKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGIDLFYLQVFPSTLFDMEVLVLKAEDMSA 2785

Query: 2708 EAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQAALLEGDIILAA 2767
               TQ + K KT L WQ+ +  +SL+ FKN+  EE  +++ V+EY + A  + G  ILAA
Sbjct: 2786 HTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFNEEIVSQIEVKEYIKHATKVRGGTILAA 2845

Query: 2768 PSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATHVRALSVRRGHT 2827
            P++ V +TTWQ++    IE LY+SSFG KVD+KWNL PINFIREMWATHVRAL++RR H 
Sbjct: 2846 PAILVDMTTWQEVSSNVIELLYTSSFGGKVDVKWNLGPINFIREMWATHVRALALRRVHD 2905

Query: 2828 EPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATPPIEWFGVNRK 2887
                +K FFEDE+I EKIK V+LG KY YIPLEEP IEMP ++DLG+ATPP+EWFGVNR+
Sbjct: 2906 MRDKNKSFFEDEHIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQ 2965

Query: 2888 RFPGMAHQLIVVPLQKLIYVAEDQYNRTLGD 2918
            RFPG+ HQ +VVPLQKL ++AE++Y R LG+
Sbjct: 2966 RFPGLTHQSVVVPLQKLAHMAEEEYARVLGN 2996

 Score =  872 bits (2253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/1568 (34%), Positives = 823/1568 (52%), Gaps = 71/1568 (4%)

Query: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60
            MD+ S F+ I IS E + S  FLVDW+L V+L +   FY GR LA+ +T  + + +WR+Y
Sbjct: 1    MDAGSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRY 60

Query: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120
            K+KIN+QS+K+SFLGGR+FFKNLTV++ D TISFL+GSFTWRYWLL++R   ++   + G
Sbjct: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELEKSG 120

Query: 121  DASENAK--LPCRFLLQCDGLEVFVYNKIDVYESVLRDHFTNVTKDGQET-----ESNDD 173
            +  +     L CRF L+ DG E+F+YN+   Y+ +LR    +V KD +E+     E  +D
Sbjct: 121  EEKDQKSRMLQCRFFLESDGFELFIYNRTVAYDGILR----SVAKDDKESFKKFFEGGED 176

Query: 174  ITINTEXXXXXXXXXXXXXXXXXXXXXXTDAPKLSAKTKLF---PIQLEANRAAIVLGNR 230
               ++E                       +  +  +++ L    PI L+ NR A++LGN 
Sbjct: 177  SLHSSEEKLEDETLASDSSVSNVDSTNDRNFQEQDSRSMLLQFLPIHLKVNRGAVLLGNT 236

Query: 231  NTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTFV 290
             T  V +  +E A+GV D+  S   LD Y+ +  LD  +   +++ N+ + ++NPIK+++
Sbjct: 237  TTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKIKPNISFGDENPIKSYI 296

Query: 291  VEKTMDKIWQTVKKQCISISKLLLP---NQGKTINNQQAYIDSWKGLDLYH--------H 339
            V   M ++W+  KK         L    NQ       Q + + W+GL LY         H
Sbjct: 297  VHSRMSRVWKKFKKIFFERMSHYLAHSDNQKIMFVKHQQFFEKWRGLALYSEYNVTTSDH 356

Query: 340  TKAVQEENVDTTVLHE---QEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRD 396
            +   +EE  D  ++ +    EYA+Y++++K+ +V++TY +DIPG+VP  +     Q D  
Sbjct: 357  SVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTYAYDIPGMVPHGALHTMEQRDGP 416

Query: 397  ESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGS 456
            +  N       P F  D  +Y A + YGPWAH+ +Q + R+  PIVSRD +   K  PGS
Sbjct: 417  DVGNSGA---PPEFSLDFKLYGATICYGPWAHRQIQYLQRMLCPIVSRDAIPLKKLTPGS 473

Query: 457  LRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEIL 516
             RIY  F LSV   + ++  IPTRESSKD++F+K+Y+ + +  R FGWL++ L +  ++ 
Sbjct: 474  RRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKNKERPFGWLDIKLTKETDLF 533

Query: 517  FNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLF 576
              + +C       N+L   L+ PEI+SSVNH++ F+ + QTI A++GYP GWN +A W+F
Sbjct: 534  MTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQTISADLGYPLGWNSEAQWVF 593

Query: 577  ELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFXXXXXX 636
            + +S+    F LRDHI+L+SD+F DF +     YELFRPF Y  +W    Y ++      
Sbjct: 594  QFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFVYRFEWSIDNYSIYLNVNDA 653

Query: 637  XXXXXXXXXXXXCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNT 696
                        C+LSL GD L    ++   +I        + +++P   L +  P W+T
Sbjct: 654  NIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVNYSIRTPEFHLQLDTPSWST 713

Query: 697  LHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNI 756
            LHEF+     G   DF M G+Y     VDV N DTILI+ +S  T     GFV+RYLMNI
Sbjct: 714  LHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQSKYTTLQCCGFVIRYLMNI 773

Query: 757  KLNYFGDFNHFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSS-------DGS 809
             +NYFGDF HFKTTEEY+ +L  +E  +T+         +D  S  SS+S          
Sbjct: 774  NMNYFGDFIHFKTTEEYTREL--QEKLETREAEVIADNVSDESSQMSSTSFVTNDKETTE 831

Query: 810  YQVADTINENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFD 869
            Y + +   +  + ++ L R +NE DVW TF V DGC++ PEN+YDC     L F  L+ D
Sbjct: 832  YDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENIYDCTSCIGLHFDSLDVD 891

Query: 870  MRYTNYFMDLTAFFSRIYLNHSNEFS----FNRVVAIEESHSENTGYLDDLNLHGHRMFG 925
            +RY NY+MDL A  S  Y+   ++F+    F+ V A E     + G+L +LN+H HRMFG
Sbjct: 892  LRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDGHQGFLSELNIHAHRMFG 951

Query: 926  VPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVT 985
            +P +EETY CKWD  IGSL  DSD  F    + A  K+GF YKD EN+LIY I KP D+T
Sbjct: 952  LPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYKDYENMLIYEIIKPIDMT 1011

Query: 986  SLTISIGRVS-SIVRTNHGGSATLSLNDITINSWDLSNSRYSKRVDLLVAAISVCAIDE- 1043
            SLT+    +S  +   N      L L+ I+ +  D  N RYS ++   +  I +   ++ 
Sbjct: 1012 SLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSNKMSAKIPNIKLLVSEKS 1071

Query: 1044 -KKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLY 1102
             K  V    +T+++L  F    +  NHR  Q+N + L+DSP+HRC FLL   Q   + LY
Sbjct: 1072 SKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSPYHRCAFLLPM-QYQKTVLY 1130

Query: 1103 DDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDIIDTKNXXXXXXXXX 1162
            + L G+ITP +S+P L++P+   T D+I+E LLG +       +D   +K          
Sbjct: 1131 NKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYECCSDANYSKETAITEENSS 1190

Query: 1163 XXXXXSNTVS---------NDLSGQLAEEFESENTTVNISTLSVFVTPKAFTFAENAAHF 1213
                  +T +         N  S +L  +FE ++  +N+    + + P +     +    
Sbjct: 1191 FIQGSGSTSALKELSSYSQNCPSYKLEPKFEYDSFIINLGKTIIAINPSSEKCLLSIYLQ 1250

Query: 1214 MLTMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISDETALDKTQLEALD 1273
                S + I+D  E++IV  FS   +      N  V+    K+  +  +   K ++   D
Sbjct: 1251 FCVGSIDDIIDANEIDIVEKFSKYFVEKSAVTNLRVLAP--KICFTFGSPKGKFEVSDYD 1308

Query: 1274 RLELSVSNISVISKILKYPQNLEQSNEST-GITDDSTISCNFDSLQFNIFKSS--KNRLT 1330
             L + V++ S+    L   +   Q+N S    T++ T S    S+ F I +       L 
Sbjct: 1309 HLYVEVNHPSL---DLCQKKIFGQTNSSKLEYTEEVTSSLKASSINFFINQQQLKPKTLL 1365

Query: 1331 KVLPIAWFEILMFNTVLF---SDVGKVSKLIFGSIKSAILDADVEWTVEYLLKLAKAFCK 1387
            K  P+  F I+ F  + F   S     + L   ++   +  + +EW  +YL  +     K
Sbjct: 1366 KARPV--FSIV-FEELEFWSDSSESSKNSLNARAVDFFVNHSQLEWLSDYLRAVILCATK 1422

Query: 1388 EGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVRDTASWK 1447
               S  +   L     KE I R A       I     +ITKPAYITRLSK H+R+  SW+
Sbjct: 1423 LFASFSKSKTLIQARQKELIFRTALASVEYNIIHDSPVITKPAYITRLSKNHIRENRSWR 1482

Query: 1448 IITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQFLDIFVDWKNWDVYEVEQSSLF 1507
            IITRLRH+  +        ++     EE +     + QFL IF +W++W+  +V++  ++
Sbjct: 1483 IITRLRHILNYLPKSWYKRTEESLKKEEFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIY 1542

Query: 1508 TLLFSGES 1515
              +F   S
Sbjct: 1543 KRVFLSRS 1550

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score =  855 bits (2210), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1573 (32%), Positives = 815/1573 (51%), Gaps = 98/1573 (6%)

Query: 4    SSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQYKIK 63
            +S F+ +S+S  +D S  FLVDW+L + + +L  FY GR+  + LT  L++  W++YK+K
Sbjct: 2    ASQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVK 61

Query: 64   INLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDGDAS 123
            I++QS+K+SFLGGRIFFKNLTVV+ + T SFL+GS TWRYWLL++R       SE+ D S
Sbjct: 62   ISIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAFAKASENIDKS 121

Query: 124  ENAKLPCRFLLQCDGLEVFVYNKIDVYESVLR-------DHFTNVTKDGQETESNDDITI 176
               KLPCRF ++C GLE F+YNK   ++++L        + F +  +D  + ++ D+ ++
Sbjct: 122  VE-KLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQDNSD-KNTDECSV 179

Query: 177  NTEXXXXXXXXXXXXXXXXXXXXXXTDAPKLSAKT-----KLFPIQLEANRAAIVLGNRN 231
            + +                       D    S  +     KL P++    + A+V+GN+ 
Sbjct: 180  DEDSAGQRSHLETSTSSPSSKSKSLNDRSFQSPDSTPPFLKLLPLEYSVQKGAVVIGNKT 239

Query: 232  TRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTFVV 291
            +  V V  +E+  GV D     S +D Y+ K+  +       L+ NL  +++NP+K+FV 
Sbjct: 240  SSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHISLKPNLSLESENPLKSFVK 299

Query: 292  EKTMDKIWQTVKKQCISISKLLLPNQGKTI-NNQQAYIDSWKGLDLYHHTKAVQEENVDT 350
               + K+W    +           N   +  +  +  +  W+GL LY   +    ++   
Sbjct: 300  RSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNPLKRWRGLGLYWKEEDAAWDDRFQ 359

Query: 351  TVLHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQDDDTPAF 410
              L + EYARY++VMK + + L Y FD PGIVP  +       D  +  N       P +
Sbjct: 360  FDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPHGALPTFQTVDGPDVGNSGP---PPDY 416

Query: 411  GTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSVDFR 470
              DI I  A++YYGPW+H  +  + +LFSP+VSRD     +  PGS RIY   +LS+   
Sbjct: 417  SIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQPVEQLTPGSKRIYTRLRLSILIV 476

Query: 471  DKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQADRLPN 530
             +SV  IPTRE+SKD EF+KR++ T D  R FGWL VSL+EG E+ FN+A+C  A    N
Sbjct: 477  GESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEVSLSEGSEVRFNIAMCPTATGFDN 536

Query: 531  ELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAELFLLRD 590
             L +  + PEI++SVNH++L    T ++ A +GYP GWNK+A+W+F+  S   ++F+L+D
Sbjct: 537  TLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLGWNKKAEWVFDSVSNQCQIFILKD 596

Query: 591  HISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFXXXXXXXXXXXXXXXXXXCF 650
            HI+L+ D+ +DF + +   YELFRPF+Y   W FT Y ++                  C+
Sbjct: 597  HITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGYSIYLNVNDANIVNNPVNFNENCY 656

Query: 651  LSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFGECP 710
            LS  GD L  +  +P  +I     +  + L +PL +L+++ P WNTLHEF+ +   G   
Sbjct: 657  LSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRLNMNTPSWNTLHEFMKDKEVGRSA 716

Query: 711  DFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHFKTT 770
            +FS++G+Y+    +DVDN DTI+I+  S ST    +G+VLRY + +K+NYFGDF HFKTT
Sbjct: 717  NFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYGYVLRYFLGVKMNYFGDFVHFKTT 776

Query: 771  EEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVADTINENTIHKSSLLRTK 830
            EEY  +L     T   TK   +  T   E+      D S +     +  T  K+SL R  
Sbjct: 777  EEYMEEL---RGTNAVTKTTHDSETEIQEAPKQMDEDSSQREQHIKDPLTAKKTSLKRMV 833

Query: 831  NETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLTAFFS----RI 886
            NE DVW TF V DGC I+PENLYDC   + L F  L+ D+R+ NY+MD+ A  S    R 
Sbjct: 834  NEKDVWFTFVVEDGCFILPENLYDCDSCYALEFDSLDIDLRHINYYMDMQAALSPLRIRR 893

Query: 887  YLNHSNEFSF---NRVVAIEESHSENTGYLDDLNLHGHRMFGVPPVEETYLCKWDISIGS 943
             ++   E  F    R +  E       G L  L++H HRMFG+PP EETY CKWD S+G+
Sbjct: 894  LIDCGCEEVFEQKGRALCGELV----AGRLSRLHIHTHRMFGLPPAEETYFCKWDFSLGT 949

Query: 944  LSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVTSLTISIGRVSSIV-RTNH 1002
            L   SD  F   F+ A +K+GF ++D ENI+ Y +    D+TS+T++I  +     +   
Sbjct: 950  LDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVAPILDMTSVTLAIDAIVFCTDKIKD 1009

Query: 1003 GGSATLSLNDITINSWDLSNSRYSKRVDLLVAAISVCAIDEKKT--VLFTCDTAVELTKF 1060
              +  L+  DI+    DL NS YS RVDL VA ++   ID+ K+   + +  T+++++ F
Sbjct: 1010 ETAIQLNAQDISAKFADLENSLYSSRVDLDVANLTASIIDKNKSNKAIASFMTSIKISNF 1069

Query: 1061 VVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLYDDLLGSITPSISLPTLSE 1120
                ++  H   Q+  +  ND+PFHRC FL+    L +S+ Y  L G I P +S+P+L+ 
Sbjct: 1070 CQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPL-TLQNSSDYKGLFGCIPPGVSIPSLAV 1128

Query: 1121 PLTFQTFDNIYERLLGSYINLINFDTDIIDTKNXXXXXXXXXXXXXXSNTVSNDLSGQLA 1180
            PL  +    +++     Y+   N   D +D                 +++   D  GQL 
Sbjct: 1129 PLQTENVKAVFQ----GYLKAENASKDFVD------RWFPVNEVKNKNSSSLKDFKGQLQ 1178

Query: 1181 ---------------EEFESENTTVNISTLSVFVTPKAFTFAENAAHFMLTMSTESIMDY 1225
                             FE     VN+    + ++P+ +    NA         E  +D 
Sbjct: 1179 PILDDNTSLSSSFSDPTFEHNTLVVNLENSRLSISPECYEVIGNAVEQCHKKLIEQFIDN 1238

Query: 1226 FEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISDETALDKTQLEALDRLELSVSNISV- 1284
             E+++V  F         + N  V++  + V    ET   +   +   +++++ + +S+ 
Sbjct: 1239 IELDVVLHFIKMASRQKNYKNIRVLMPTLDVLF--ETYNKENTYDVEGQVKVTANQVSLD 1296

Query: 1285 --ISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIFKSSKNRLTKVLPIAWF-EIL 1341
              + K LK P        S    +D+T     +SL   +F    N+L K    A   E +
Sbjct: 1297 WSLKKGLKLPG-------SDNDPEDTTSLLKIESLDLEVF----NKLDKKTKFAEMDENI 1345

Query: 1342 MFNTVL-----FSDVGKV--SKLIFGSIKSAILDADVEWTVEYLLKL---AKAFCKEGKS 1391
             F   +     +S +  +  S L   SI +++      W ++++ K    +K        
Sbjct: 1346 AFGCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDFMRKAFNDSKQLINRLSY 1405

Query: 1392 CIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVRDTASWKIITR 1451
            C   G+ R  + +E   R+++      I   P +ITKPAYITRL   HVR++ SWKI+TR
Sbjct: 1406 CT--GQFRKAE-QEFFYRISKASDEYQITHDPPVITKPAYITRLPSQHVRESRSWKIVTR 1462

Query: 1452 LRHVSKH--TSHVSETTSQCDDIPEEVRNICKDKSQFLDIFVDWKNWDVYEVEQSSLFTL 1509
            LRH+  +  T+ +S+  +   +     R+  ++   FL+IF +W NWD  +VE+  ++  
Sbjct: 1463 LRHILNYLPTTLISDIFNDLKNSEYPPRSTAEE--TFLEIFSNWGNWDYSDVEKCYMYRR 1520

Query: 1510 LFSG---ESTVHE 1519
            +F+    ++  HE
Sbjct: 1521 VFTNTLDDTVAHE 1533

 Score =  753 bits (1945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1192 (35%), Positives = 672/1192 (56%), Gaps = 65/1192 (5%)

Query: 1780 FIIRILISGLDFNFKNLSGISIIVNYTELLLDFYFNQLKLLRISNSVTKVDY-------- 1831
            F + I IS L  +   LS ++I  N+ +L L +  +    L+++     +D         
Sbjct: 1784 FALNIDISDLTTDISLLSSLAITKNFKKLTLAYEQSASSALKLAFETLDIDVFSTRTTQQ 1843

Query: 1832 -----------------RSNTLLTDIGLDTDIVKLTLSDNRVYIEELTDSL---NGTVSE 1871
                             ++N     + LD++I KL L D R     L   +      ++ 
Sbjct: 1844 YLKISQSNISFSLHRPKKNNASPPTVKLDSNITKLKLYDPRDITLPLGKDIAQAKACLAS 1903

Query: 1872 LIKIFKNKNADNEP-----AAPKFKPCS---FKMNAIYIGLLTDLKTTNYVLEFNE-TAF 1922
            L   F   N  N+         KF   +   F++   Y+GLL  L +T+Y+ E NE +AF
Sbjct: 1904 LKSCFGKLNTKNDKDIMSQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAF 1963

Query: 1923 SCASRAEALEETHANDNLREMSLVIQNVCILVLNPEVLP-TLSKIFDIGFALKLIED--D 1979
              A         ++   LR   L   ++  L+ N  +LP  LS++ D   ++K+ ++  +
Sbjct: 1964 ITADEFTNKASENSQGALRG-DLSAASIAFLI-NDRMLPEALSRVVDFAVSIKIAKESEE 2021

Query: 1980 IKKTLQIETPHSRVMLAPSTLIAVIFFIQE-AKVS-LQKVKQKGKFNSSSNAIEIPPYFE 2037
            + ++LQIE+P+ R+ L+P +L+ ++F + E +++S LQK +  GK   S    E   +  
Sbjct: 2022 VIRSLQIESPYFRIALSPFSLVRILFLVNELSRLSELQKRQTVGKLPESVEVRETFRFRR 2081

Query: 2038 TL-SVNILSNKLCLGWIFE-EDTDENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKE 2095
               SV +LS   CLGWIF+  D+ E G++ GY+ LFAA+EKPYGKLT++D Y + A+G  
Sbjct: 2082 AFRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIAEGST 2141

Query: 2096 SNNFF-FANGVPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNV 2154
            S++F+   N     NRS L SMQI +W   + +  +LF+R+N ++LDVR L+ S+++   
Sbjct: 2142 SDDFYAHKNSFENPNRSFLPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSIDVAGG 2201

Query: 2155 MRSSIESFQXXXXXXXXXXXXXXXTH--NVAENLSDKVSILSIRSINCIAKYGGGIINLY 2212
            +  S+  F                    +     S    + +I+ ++C  +Y GG+  LY
Sbjct: 2202 LMKSLNMFDELKKQYVDPFKSVANPKRPSATSTFSKFPGLSTIQRVDCKVQYAGGVFRLY 2261

Query: 2213 TPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVL 2272
            + DD+ Q+    S +L SPS+E+  DY      +  H +R+ + V S+HN +F +CVPVL
Sbjct: 2262 SLDDV-QNEAGPSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPTCVPVL 2320

Query: 2273 VNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNIT 2332
              +  +I++ ++ FN   ++  HK+  Q       S DY++  +  D + +I++G Q I+
Sbjct: 2321 NEMARDIRQLLKGFNRSPQEASHKSVSQE------SLDYRSFLRGTDISFLIDIGKQQIS 2374

Query: 2333 LTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGI 2392
             +CEP+AK+QADLGF    + +FT+  D SEPLSLS+   EI   +RHIFSRE+S+S  I
Sbjct: 2375 FSCEPKAKVQADLGFEKLAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKI 2434

Query: 2393 NEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTK--KAQKLGSG 2450
            +++   F+LTH +TI TYG   I ++  Y N+KQLQ++ +F++IW P +      +L S 
Sbjct: 2435 DQLSWIFILTHPDTIHTYGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSE 2494

Query: 2451 PHSGQKCQPQALTE-----FTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISS 2505
                   + + L        +T   PW + +I       ID+  SLG ++      W  +
Sbjct: 2495 HSRALTSEEKPLVAKFKKVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAIT 2554

Query: 2506 HHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKM 2565
             H  DW+  +S  ++++   SDGRLGG   ++N  + S I WPV++  FE+PL+ L   +
Sbjct: 2555 DHYSDWTQKLSLQMEKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLL 2614

Query: 2566 SHLSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASAN 2625
                 K+ FDYH  LIA V  L+L + N+RD  G+ ++LL V++S  S  +FLTALA AN
Sbjct: 2615 DEFDLKLSFDYHLILIASVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPAN 2674

Query: 2626 LYDIYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRLRTNLTAEIGSFRL 2685
            + D+Y T  RMR +N+KSY +TL +SN + +     S + L +   LRT L   +    +
Sbjct: 2675 ILDVYNTILRMRKDNRKSYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHI 2734

Query: 2686 YVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFA 2745
             ++PS LFD EVL  KA     ++  + ++K KT L WQI  + I+L++FKN+L E+  +
Sbjct: 2735 QIYPSKLFDMEVLTFKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAAS 2794

Query: 2746 ELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDP 2805
            ++ V+EY   A   +G  IL  P++ +G+TTW  +    +E LYS+SFG K+ I+WNL  
Sbjct: 2795 QIGVKEYIEHARKADGGTILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGS 2854

Query: 2806 INFIREMWATHVRALSVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIE 2865
            INF+REMWATHVRA+++RR H      + FFEDE++ EK++ V+LG +Y+Y+PLEEPHIE
Sbjct: 2855 INFLREMWATHVRAMALRRSHN--GQPRGFFEDEHLEEKLRDVDLGDEYEYVPLEEPHIE 2912

Query: 2866 MPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917
            +P  +DLG ATPP+EWFGVNRK+FPG+ HQ ++VPLQKL ++AE ++ R LG
Sbjct: 2913 IPQTKDLGEATPPVEWFGVNRKQFPGLTHQAMIVPLQKLAHIAETEWARILG 2964

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score =  813 bits (2100), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/1574 (31%), Positives = 802/1574 (50%), Gaps = 101/1574 (6%)

Query: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60
            M++ S  R + ++ +KD S  FLVDWIL VI C+   FY+GRI A++++  L++ +W++ 
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120
            KIKIN++++++S LGGRI+FK+L+V+  D+TIS LEGS TW+YWLL+ R   +  E+E  
Sbjct: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAEL-IENEKN 119

Query: 121  DASENAKLPCRFLLQCDGLEVFVYNKIDVYESVL-------RDHFTNVTKDGQETESNDD 173
             + +N +LPC+FLL+C+GLE F+YN+   Y++V+       RD F     +    E   D
Sbjct: 120  SSGKNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEKYLNEHSFPEPFSD 179

Query: 174  IT----INTEXXXXXXXXXXXXXXXXXXXXXXTDAPKLSAKTKLFPIQLEANRAAIVLGN 229
             +    ++ +                      T+  K       FPI+L+ NR +++LGN
Sbjct: 180  GSSADKLDEDLSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFPIELKLNRGSLLLGN 239

Query: 230  RNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTF 289
            + T  V +  +E  +G+ D+      LD YR K  L+L +    ++ N+GY +   +K  
Sbjct: 240  KFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIKQNIGYDDAIGLKFK 299

Query: 290  VVEKTMDKIWQTVKKQCISISKLLLPNQGKTIN-NQQAYIDSWKGLDLYHHTKA-VQEEN 347
            +    + K+W+T  +    ++K ++P +GK    +  A+   WKGL LY  +    +  +
Sbjct: 300  LDTGKVSKLWKTFVRVLRVVTKPVIPRRGKKAGPSDDAFFQKWKGLSLYKASAGDAKTSD 359

Query: 348  VDTTVLH--EQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQDD 405
            +D         EYA+++ ++K  +V+L+Y  D+PG+VP  +       D  +  N   + 
Sbjct: 360  LDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAHPTIPDIDGPDVGN---NG 416

Query: 406  DTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFKL 465
              P F  D+ I+  ++ YGPWA + +  + R+ SP+VSR      K  PGS R+Y  F++
Sbjct: 417  APPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFRM 476

Query: 466  SVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQA 525
            ++   + +   IPTRESSKD EF++ YK T + +R FGW+++   +     FN+++C   
Sbjct: 477  NILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFCKDTYANFNISVCPTV 536

Query: 526  DRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAEL 585
            +   N+ +V  +  EI+SSVNH++L +     +  +IGYP GWN    W+  + S   E 
Sbjct: 537  EGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNSNTIWIINMKSEQLEA 596

Query: 586  FLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFXXXXXXXXXXXXXXX 645
            FLLR+HI+L++D  +DFSA D   YELFRPF Y++ W    Y ++               
Sbjct: 597  FLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIYLNVNDHNIVNNPLDF 656

Query: 646  XXXCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSETT 705
               C+LSL GD L   I +P  SI+    + ++ + +P+ ++ ++ P WNTL+EF+    
Sbjct: 657  NENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKHKE 716

Query: 706  FGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFN 765
             G   DF++ G Y+ +  +D+DN D++ I+  S+ST    +GFV+RYL+N+K+NYFG+F 
Sbjct: 717  VGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVMRYLINVKMNYFGEFF 776

Query: 766  HFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVADTINENTIHKSS 825
            +F T+EEY+  L   E  +  TK+      +   +L S   +GS +  D  +   + +S 
Sbjct: 777  NFVTSEEYTGVLGAREVGEVVTKS---SVVDLASTLDSEYQNGSMK-NDAEDNGPMKRSD 832

Query: 826  LLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLTAFFSR 885
            L RT NETD+W TF V +G +I+PE +Y       L F  L  D R  NY+MD+ A  + 
Sbjct: 833  LKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDFRSCNYYMDIMAVLNG 892

Query: 886  IYLNHSNEFSFNRVV--------AIEESHSENTGYLDDLNLHGHRMFGVPPVEETYLCKW 937
              +        N V         A E+ H    G L DL +HGHRM+G+PP E TY C+W
Sbjct: 893  TSIKRHVSKQINEVFDFIRRNNGADEQEH----GVLSDLTIHGHRMYGLPPTEPTYFCQW 948

Query: 938  DISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVTSLTISIGRVS-S 996
            DI++G L+ +SD +FL  F  +  KVGF Y D ENIL+Y      D+TSLT+   R++ S
Sbjct: 949  DINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTSLTVHAERINIS 1008

Query: 997  IVRTNHGGSATLSLNDITINSWDLSNSRYSKRVDLLVAAISV---CAI-DEKKTVLFTCD 1052
            +        + +S+  +     D  N RYS+R+D+ V  ++V   C + D   T     +
Sbjct: 1009 LNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMGDGTNTSFLNFE 1068

Query: 1053 TAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLYDDLLGSITPS 1112
            T +  T F    +    R  Q+  +++NDSP+HRC FLL     +  T Y  L G+I PS
Sbjct: 1069 TKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDT-YQKLYGAIAPS 1127

Query: 1113 ISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDIIDTKNXXXXXXXXXXXXXXSNTVS 1172
             S+PTL  P    T D I E ++G Y  L+         K+              S T  
Sbjct: 1128 SSIPTLPLPTLPDTIDYIIEDIVGEYATLLEATNPF---KDLFAETPSTVEPLRASFTED 1184

Query: 1173 NDLSGQLAEEF-----------ESENTTVNISTLSVFVTPKAFTFAENAAHFMLTMSTES 1221
            +D       EF           E +N  +++S + + + P  F F ++      +     
Sbjct: 1185 DDEEAADPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLEQFYSEDMVQ 1244

Query: 1222 IMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVN-ISDETALDKTQLEALDRLELSVS 1280
            ++D  E+ IV   S  ++  G    S++ +    +N I  ET  +  +L  LDR+   +S
Sbjct: 1245 VLDDIEIGIVKRLS--NLQEGIVSISNIDIHVAYLNLIWQETGEEGFEL-YLDRINYQMS 1301

Query: 1281 N-------------ISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIFKSSKN 1327
                          ++V++K+      + Q  ++  +++D   + +     F ++ S+++
Sbjct: 1302 EKSLEKNRTSKSLEVAVLAKVKTVRATVNQ-KKNPELSEDRPPALSLGLEGFEVWSSTED 1360

Query: 1328 RLTKVLPIAWFEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLKLAKAFCK 1387
            R                        +V+ L   S    I ++ +EW  EY         +
Sbjct: 1361 R------------------------QVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQE 1396

Query: 1388 EGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVRDTASWK 1447
               S   +   RS    E I ++    +   I   PY+ITKPA+I RLSK HVR+  SWK
Sbjct: 1397 VFTSVNSIQNTRSSTKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWK 1456

Query: 1448 IITRLRHVSKHTSHVSETTSQCDDIPEEVR-NICKD-KSQFLDIFVDWKNWDVYEVEQSS 1505
            IITRLRH+  +     +T    D + +E + +  KD K+ F+ +F  W+NW+  +V +S 
Sbjct: 1457 IITRLRHILTYLPDDWQT--NIDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSY 1514

Query: 1506 LFTLLFSGESTVHE 1519
            ++  LF  +   H+
Sbjct: 1515 IYGKLFLADHAKHK 1528

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/1070 (35%), Positives = 603/1070 (56%), Gaps = 53/1070 (4%)

Query: 1880 NADNEPAAPKFKPCSFKMNAIYIGLLTDLKTTNYVLEFNETAFSCASRAEAL--EETHAN 1937
            NA  E  A K    +   N  Y G+L  + +T +V E +    S  +    L  E+T   
Sbjct: 1909 NAKKETPA-KMINWTLDTNISYFGILVPVASTYFVFELHMLLLSLTNTNNGLLPEQTRLT 1967

Query: 1938 DNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIED--DIKKTLQIETPHSRVML 1995
              L      I+N+  L+    +   LSK+ D    +  ++   D +++ Q+E+ H RV L
Sbjct: 1968 GQLS-----IENILFLIKERSLPIGLSKLLDFSIKVSTLQRTADTEQSFQVESSHFRVCL 2022

Query: 1996 APSTLIAVIFFIQEAKVSLQKVKQKGKFN---------SSSNAIEIPPYFETLSVNILSN 2046
            +P +L+ +I+   +    +Q   ++   N          S    EIP  F   S++ILS 
Sbjct: 2023 SPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGKSDKPKEIPINFR--SIHILSY 2080

Query: 2047 KLCLGWIFEEDT-DENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFF-ANG 2104
            K C+GW+F+    D+ G++ GY  LF+AYEK +GK TIVD + + + G  S+ FF   N 
Sbjct: 2081 KFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIVDAFFSVSNGNTSSTFFSEGNE 2140

Query: 2105 VPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQX 2164
              + NRS L +MQI++WF      KD F R + + LDV  L + +++++    SI +FQ 
Sbjct: 2141 KEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFLPSFMDVIDSTLQSIRAFQE 2200

Query: 2165 XXXXXXXXXXXXXXTHNV------AENLSDKVSIL--SIRSINCIAKYGGGIINLYTPDD 2216
                           ++        EN S+ ++    +IRS+NC  KY GG+  +YT DD
Sbjct: 2201 LKKNILDMPHESNMENSSPDAAPNTENASNSLAPFLDNIRSVNCNFKYDGGVFRVYTYDD 2260

Query: 2217 IAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLT 2276
            I   S + S EL SP + ++  Y H+    K H IR+L+ V+ THN L++ C P+L+  +
Sbjct: 2261 IEAKS-EPSFELKSPVVTINCTYKHDESKAKPHRIRTLITVDPTHNTLYAGCAPLLMEFS 2319

Query: 2277 TEIQKQMERFNSEKKQLVHKTQEQTTNTQRIS---FDYKNLFKKIDTAIVINVGAQNITL 2333
              +Q  +++         H T E+  N  + S    DYK L  + D A+ +    Q ++L
Sbjct: 2320 ESLQNMIKK---------HSTGEKKPNFTKPSTQNVDYKRLLDQFDVAVKLTSAKQQLSL 2370

Query: 2334 TCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGIN 2393
            +CEP+AK+QAD+GF +F  SM T+  D  +PL  SL   + + S +HIFSRE+S+S  + 
Sbjct: 2371 SCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIFSREVSTSFEVG 2430

Query: 2394 EVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWS----PKTKKAQKLGS 2449
             + L  + TH + I  YG +L+SD+  + N+KQLQ + LFLDIW       T+  Q+  +
Sbjct: 2431 FMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSILHTRPTQRPNN 2490

Query: 2450 GPHSGQKCQPQALTEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRV 2509
               +       +  +  T +IPW + +IF N S  +D+ PSLG I+ +    W+++ H  
Sbjct: 2491 KEVNMSTLSSNSNVDVGT-EIPWCFTLIFTNLSGDVDLGPSLGVISLRSQRTWLATDHYD 2549

Query: 2510 DWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLS 2569
            +    +  + D ++  S+GRL GLFE+ N  + S + WP++++K   PL++ +  +  ++
Sbjct: 2550 EKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSKNTHPLVSTSLNIDDVA 2609

Query: 2570 SKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDI 2629
             K  FDYH FLI  +++++  + NE+D  G+L DLL VS S   + +  TAL +AN+ DI
Sbjct: 2610 VKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSSTALVAANILDI 2669

Query: 2630 YATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRLRTNLTAEIGSFRLYVFP 2689
            Y T  RMR +NK SY++TL++SNP  S +     + L +   LRT+L+  I S ++ + P
Sbjct: 2670 YNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSVNISSLKVQISP 2729

Query: 2690 STLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSV 2749
             +LFD EVLV++ +K+++ + T + +K KTDL  Q+ D++ +L+  K EL EE  A +++
Sbjct: 2730 ISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELDEEIGASIAI 2789

Query: 2750 EEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFI 2809
            ++Y   A+ + G  I+  P + V +TT Q+    ++E+L++ SF DK+ ++WNL PINFI
Sbjct: 2790 DDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVRWNLGPINFI 2849

Query: 2810 REMWATHVRALSVRRGHTEPSPSKPFFE-DENIAEKIKIVNLGTKYKYIPLEEPHIEMPL 2868
            +EMW THV+AL+VRR  T    +  F + +E + E IK     +K+ YI LEEP IE+P 
Sbjct: 2850 KEMWTTHVKALAVRRSQT---ANISFGQTEEELEESIKREENASKFNYIALEEPQIEVPQ 2906

Query: 2869 LRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLGD 2918
            +RDLG ATPP+EWFGVNRKR P   HQ  V+P+QKL+Y+AE QY + L D
Sbjct: 2907 IRDLGEATPPMEWFGVNRKRLPKFTHQTAVIPVQKLVYLAEKQYVKILDD 2956

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score =  805 bits (2078), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 510/1596 (31%), Positives = 812/1596 (50%), Gaps = 119/1596 (7%)

Query: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60
            M SSS F+ + IS  K+ S  FL+DWIL V+LC+   FY+GR +A++ +  L++ +W++ 
Sbjct: 1    MASSSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRA 60

Query: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120
             IK+N++S+++S LGGRIFFKN+T++  D+TIS L+G+ TWRYWLL TR      ES+D 
Sbjct: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLESKDS 120

Query: 121  DA---SENAKLPCRFLLQCDGLEVFVYNKIDVY--------------------ESVLRDH 157
            +     +N +LPCRF+L C+G E+FVYN+   Y                    E +  DH
Sbjct: 121  NGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQKFLDEQIFNDH 180

Query: 158  --FTNVTKDGQET---ESNDDITINTEXXXXXXXXXXXXXXXXXXXX-XXTDAPKLSAKT 211
              +++ T +G  +   ESN D  +N E                         + K S   
Sbjct: 181  SSYSSKTTNGANSSTGESNSDTKLNDEDFVESGYSSQSTYNQNNDRIFDQAKSDKDSLFL 240

Query: 212  KLFPIQLEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDAL 271
            + FP+++E +RA++  GN+ T  + +   E   G+ D       LD Y+ K++++ ++  
Sbjct: 241  QTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDLYKMKLAIETHNFA 300

Query: 272  FELRTNLGYQNDNPIKTFVVEKTMDKIWQTVKKQCISISKLLLPNQGKTINNQQA--YID 329
              ++ N+GY+ +  +K  +    + ++W+        I++ L   Q K   N+    +I 
Sbjct: 301  VTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLTQRKKKRNEPPDLFIQ 360

Query: 330  SWKGLDLYHHTKAVQEENVDTTV-----LHEQEYARYSRVMKAERVSLTYYFDIPGIVPA 384
             W+GL LY  T  + E   D            EYA++S V+K  +   TY +DIPG VP 
Sbjct: 361  KWQGLSLYKGT--IFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKAIFTYEYDIPGCVPH 418

Query: 385  NSSSINSQSDRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSR 444
             +   NS+ D  +  N   +   P    DI I+  ++ YGPW  + M  I  + +P VSR
Sbjct: 419  GAHPTNSEIDGPDVGN---NGAPPTHSLDIQIFGGSICYGPWTQRQMNFIHSMLAPAVSR 475

Query: 445  DQMKATKPEPGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGW 504
             +    +  PGS RIY   KLS+   D +   I TRE SKD  F+K YK T D +R FGW
Sbjct: 476  TESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYKETNDDYRPFGW 535

Query: 505  LNVSLNEGGEILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGY 564
            +++  ++     F  AL    +   N++ + L   EI+SSVNH++L +C       ++ Y
Sbjct: 536  IDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKCKFFDFDIDVSY 595

Query: 565  PTGWNKQADWLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVF 624
            P  WN +A W  +++S   E FLLR+HI+LI+D  TDF++ +   YELFRP    I W  
Sbjct: 596  PLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELFRPSETFINWKM 655

Query: 625  TEYKLFXXXXXXXXXXXXXXXXXXCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPL 684
              Y ++                  C+LSL GD L  ++ +P   I  + +E T+ + +P+
Sbjct: 656  DAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQFNEITYNITTPM 715

Query: 685  VKLSIHPPCWNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFL 744
             +L ++ P WNTL+EF+     G   DFS  G+Y+ +  +DVDN DTI I   S  T   
Sbjct: 716  FRLLLNTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTISIICESRGTTLQ 775

Query: 745  SFGFVLRYLMNIKLNYFGDFNHFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSS 804
             +GFV+RYL N+K+NYFGDF +F T+EEY+    +  D + + +       +D E     
Sbjct: 776  CYGFVIRYLANVKMNYFGDFFNFITSEEYT---GITRDEELEEELISSN-LSDNEDNGDV 831

Query: 805  SSDGSYQVADTINE-----NTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSF 859
             SDG   + D I++      T+ +S L RT NETD+++TF V DG II+PE +Y+C    
Sbjct: 832  YSDGESGMDDAISQEIPERTTLKRSDLRRTANETDLFLTFSVWDGAIILPETIYNCDNCT 891

Query: 860  LLSFRRLEFDMRYTNYFMDLTAFFSRIYLNHSNEFS----FNRVVAIEESHSENTGYLDD 915
             L F  L  D+R +NY+MDL A      +    E S    F  V+      SE  G+L D
Sbjct: 892  ALKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVLHDNRESSEAQGFLSD 951

Query: 916  LNLHGHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILI 975
            L++HGHRMFG+PP E TY CKWD  IG L+ +S+  FL  FL +  ++GF +KD ENIL+
Sbjct: 952  LSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSFSRIGFGFKDLENILL 1011

Query: 976  YSIHKPEDVTSLTISIGRVSSIVRTNHGG-SATLSLNDITINSWDLSNSRYSKRVDLLVA 1034
            YS     D+TSLT++   +S  ++    G    L    +   S D  ++ YS R+DL++ 
Sbjct: 1012 YSKEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSIDFESANYSSRLDLIIP 1071

Query: 1035 AISVCA----IDEKKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFL 1090
            ++ +      ID KK  LF   T V LT F  + N K HR  Q+N + LND+ FHR  FL
Sbjct: 1072 SLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRNYITLNDAAFHRTSFL 1131

Query: 1091 LAFDQLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLIN------- 1143
            L         LY++L GSI PS SLP L+ P+  +T D I E  LG Y++L++       
Sbjct: 1132 LP-QSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLGEYVSLLDDRTIFRM 1190

Query: 1144 -FDTDIIDTKNXXXXXXXXXXXXXXSNTVSNDLSGQLAEEFESENTTVNISTLSVFVTPK 1202
             F +     +               ++TVS +      + ++ +N  ++I  +SV + P 
Sbjct: 1191 PFGSTNTPNQASTHHEEDMDPLEFSNSTVSTE------KNYQCDNLVIDIEYISVEINPS 1244

Query: 1203 AFTFAENAAHFMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNI--SD 1260
              T+ E+ +  +   +   ++D  E+  + I S        F   +  + N+K+ +  SD
Sbjct: 1245 ISTYIESLSSTVYEENIVQVIDDIEIETIKILST-------FQEGTSSITNIKLRVLYSD 1297

Query: 1261 --ETALDKTQLEA-LDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSL 1317
                  D+  +E  LD+L+  +S            +N+E+  E   +  + T+     S+
Sbjct: 1298 IYWGERDRYGIELYLDKLDFEMSQ-----------RNIEKDREKGLL--EITMLAKTRSI 1344

Query: 1318 QFNIFKSSKNRLTKVLPIAWFEILMFNTVLFSDVG--KVSKLIFGSIKSAILDADVEWTV 1375
            + +I +    +  K  P A   +++    L+S     +V+ +   S    I ++ +EW  
Sbjct: 1345 RASISEEGSTKNEKERPPA-LSLVVEGCELWSATAEKQVNSIDTISTDITIDESQLEWLF 1403

Query: 1376 EYLLKLAKAFCKEGKSCIE--LGKLRSIDMKETIIRVAELGKISG------IDSVPYIIT 1427
                     F  E    ++  +  L S+  + T+ R   + K++       I   PY+IT
Sbjct: 1404 --------LFVNEQNQNLQNIITTLNSVQAEHTVSRRKLISKLTAANDFYQISHDPYVIT 1455

Query: 1428 KPAYITRLSKFHVRDTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQFL 1487
            KPA+ITRLSK HVR+  SWKIITRLRH+  +     E+  +     + + +  + K  F+
Sbjct: 1456 KPAFITRLSKGHVRENRSWKIITRLRHILTYIPSDWESGVENYLKEKSLNDQDEAKKVFM 1515

Query: 1488 DIFVDWKNWDVYEVEQSSLFTLLF-SGESTVHEEDL 1522
             +F +W+NW+  +V +S ++  LF + ++  H++ +
Sbjct: 1516 SVFSNWRNWEFSDVARSYIYGRLFLTNQAEKHKQSM 1551

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/1231 (33%), Positives = 649/1231 (52%), Gaps = 74/1231 (6%)

Query: 1737 SIDDMKAITPDHDSEKKNGHVDLVWVLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNL 1796
            SI D  A   +   +KK   V++  V  L   S ++      PF IR      D  FK  
Sbjct: 1780 SISDRLAEGENKSPKKKLKDVEIEVVCQLSNVSFEIM--PISPFYIRHETKKFDLKFKQF 1837

Query: 1797 SGISIIVNY--TELLLDFYFNQLKLLRISNSVTKVDY---RSNTLLTDIGLDTDIVKLTL 1851
               +++++   T+  L     + +  RIS    ++ Y       ++ D  +   ++KLT 
Sbjct: 1838 GSQNVMIDVWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDANVSASMIKLTF 1897

Query: 1852 SD-NRVYIEELTDSLNGTVSELIKIFK--------NKNADNEPAAPKFKPCSFKMNAIYI 1902
            S+ NR+    L D    T SE  K+ K              +PA  K        +  Y 
Sbjct: 1898 SEPNRILSSFLQDE--RTASESFKLLKALKPFLLPQTEGRLQPATTKEMRWLLDTDIKYF 1955

Query: 1903 GLLTDLKTTNYVLEFNETAFSCASRAEALEETHANDNLREMSLVIQNVCILVLNPEVLPT 1962
            G+L  + TT +V E   T     S ++   E +   +  +  + I+NV  L+ +  +   
Sbjct: 1956 GILVPISTTYFVFE---THALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDRGIPSA 2012

Query: 1963 LSKIFDIGFALKLIED--DIKKTLQIETPHSRVMLAPSTLIAVIFFIQE-AKVSLQKVKQ 2019
            LS++ D   +   I+   ++  + Q+E+ H R+ L+P +L+ +++  Q+   ++    +Q
Sbjct: 2013 LSRMLDFSISFSTIQKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLANYYKEQ 2072

Query: 2020 KG--------------KFNSSSNAIEIPPYFETLSVNILSNKLCLGWIF-EEDTDENGIV 2064
            +G              K  SSS  + +       S ++LS   C+GW+F E +    GI+
Sbjct: 2073 RGTDLWDIKASKLKKEKKGSSSIGMNMS------SFHVLSYNFCIGWMFPEANASAPGIM 2126

Query: 2065 IGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFFANGVPE-LNRSHLSSMQINFWFS 2123
            +G+  LF+AYE  YGKLT+VD + + A+G  S  F+      E +NRS+L +MQI +W  
Sbjct: 2127 LGFSRLFSAYEGGYGKLTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWVK 2186

Query: 2124 GQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQXXXXXXXXXXXXXXXTHNVA 2183
               + KD+F+R + + LDV  LTT + ++  M  S + FQ               T    
Sbjct: 2187 KSGLMKDVFIRFHGEALDVSFLTTFITVIESMLQSFQVFQELKTSLIQPN-----TSTTE 2241

Query: 2184 ENLSDKVSILS-----IRSINCIAKYGGGIINLYTPDDIAQDSPKSSLELTSPSIEVSLD 2238
             N   K+  L+     I+S+NC  KY GG+  +++ +DI +   + S EL +P + +  +
Sbjct: 2242 NNTEPKIKSLAPFLSNIKSVNCQFKYDGGVFKVFSFEDI-ESHLEPSFELKTPGVIIDFN 2300

Query: 2239 YMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQKQMERFNSEKKQLVHKTQ 2298
            Y HN  S K HWIR+LV + STHN LF+ C P++      I + +++ +S  K     T 
Sbjct: 2301 YKHNIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATN 2360

Query: 2299 EQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQADLGFSNFRISMFTDS 2358
                 +Q I  DYK L    D A  +    Q ++L+CEP+AK+QAD+GF +F I + T++
Sbjct: 2361 LSKAPSQNI--DYKRLLDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNN 2418

Query: 2359 PDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFMLTHENTIKTYGNTLISDM 2418
             D +EPL+ SL   + + S +HIFS+E S+S G++ + L+FM TH + I  YG  LIS++
Sbjct: 2419 LDETEPLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEV 2478

Query: 2419 KFYVNMKQLQEITLFLDIWSPKTKKAQKLGSGPHSGQKCQPQALTEFTTPK-------IP 2471
              Y N+KQLQ + LF+DIW    K +  +  GP        +     T P+       IP
Sbjct: 2479 DLYFNVKQLQNLYLFIDIW----KLSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIP 2534

Query: 2472 WIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFYLDELNSKSDGRLG 2531
            W + +IF N +   D+ PSLG ++ K+   W++S H  D    +  + D L+  S GRL 
Sbjct: 2535 WSFTLIFTNINGSADLGPSLGVLSLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLS 2594

Query: 2532 GLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHSFLIARVSDLQLAI 2591
            G+FE+    + S +SWP +      PL+N++  + +LS K  FDYH FLI  +S  + ++
Sbjct: 2595 GIFELDGASWMSEVSWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSL 2654

Query: 2592 RNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIENKKSYVQTLKES 2651
             +E+D  G + DLL V+ +   +NI  TAL +AN+ D+Y T  RMR +NK  Y++TL+ES
Sbjct: 2655 HSEKDIVGTMPDLLKVNFTCEMINICSTALVAANILDLYNTVMRMRQDNKILYLETLRES 2714

Query: 2652 NP-ESSGKIHFSNNELLAPLRLRTNLTAEIGSFRLYVFPSTLFDSEVLVLKANKMNVEAA 2710
            +  E+ G      + L +   L+T+++  I   +L V P  LFD EVLV+    ++  A 
Sbjct: 2715 DTLETRGNPDNYRDILRSLNLLQTDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAG 2774

Query: 2711 TQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQAALLEGDIILAAPSV 2770
            T   +K KT L  ++ D  ++L+  K E+ E+  + +SV +Y   A+ + G  I+  P +
Sbjct: 2775 TFAGEKLKTILELEVYDGYVALSTSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKL 2834

Query: 2771 FVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATHVRALSVRRGHTEPS 2830
             + +T+WQ+     +E+LY  +F DK+ +KWNL P+NFI+EMW THV+AL+VRR      
Sbjct: 2835 NIAMTSWQEENSDILEYLYKCTFEDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLD 2894

Query: 2831 PSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATPPIEWFGVNRKRFP 2890
                   DE + ++IK     +K KY+P+EEP I+MP +RDLG+ATPP+EWFGVNRKR P
Sbjct: 2895 TDMQ--TDEEVQKRIKEEENISKLKYVPIEEPRIDMPQIRDLGDATPPLEWFGVNRKRLP 2952

Query: 2891 GMAHQLIVVPLQKLIYVAEDQYNRTLGDNLG 2921
               HQ +VVP+QKL++ AE QY  +L DN G
Sbjct: 2953 AFTHQTVVVPVQKLVHAAEKQY-ASLLDNSG 2982

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/1568 (31%), Positives = 803/1568 (51%), Gaps = 82/1568 (5%)

Query: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60
            M++ S  R + ++ +KD S  FLVDWIL V++C+   FY+GRI A++++  L++ +W++ 
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120
            KIKIN+++++VS LGGRI FKNL+V+  D+TIS LEGS TW+YWLL+ R   +  E+   
Sbjct: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAEL-IENNKS 119

Query: 121  DASENAKLPCRFLLQCDGLEVFVYNKIDVYESVL-------RDHFTNVTKDGQETESNDD 173
             + + AKLPC+  ++C+GLE+F+YN+   Y++V+       RD F     +    E   D
Sbjct: 120  SSGKKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSD 179

Query: 174  IT----INTEXXXXXXXXXXXXXXXXXXXXXXTDAPKLSAKTKLFPIQLEANRAAIVLGN 229
             +    ++ +                      TD  K        PI+L+ +R +++LGN
Sbjct: 180  GSSADKLDEDLSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLPIELKFSRGSLLLGN 239

Query: 230  RNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTF 289
            + T  V +  +E  KG+ D+      LD YR K  ++  +    ++ N+GY +   +K  
Sbjct: 240  KFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFK 299

Query: 290  VVEKTMDKIWQTVKK--QCISISKLLLPNQGKTINNQQAYIDSWKGLDLYHHT----KAV 343
            +    + K+W+T  +  Q ++   +    +     +   +   WKGL LY  +    KA 
Sbjct: 300  IDRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDDNFYHKWKGLSLYKASAGDAKAS 359

Query: 344  QEENVDTTVLHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQ 403
              ++V+   L   EYA+++ ++K  +V++ Y  D+PG+VP  +       D  +  N   
Sbjct: 360  DLDDVEFD-LTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAHPTIPDIDGPDVGN--- 415

Query: 404  DDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENF 463
            +   P F  D+ I+  ++ YGPWA + +  + R+ SP+VSR      K  PGS RIY  F
Sbjct: 416  NGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRIYTLF 475

Query: 464  KLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCS 523
            ++++   + +   IPTRESSKD EF+K YK T + +R FGW+++   +     FN+++C 
Sbjct: 476  RMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFCKDTYANFNISVCP 535

Query: 524  QADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTA 583
                  N  +V  L  EI+SSVNH++L +     I  +IGYP GWN +A W+  + S   
Sbjct: 536  TVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNSKAIWIINMKSEQL 595

Query: 584  ELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFXXXXXXXXXXXXX 643
            E FLLR+HI+L++D  +DFSA D   YELFRPF Y++ W    Y ++             
Sbjct: 596  EAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPL 655

Query: 644  XXXXXCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSE 703
                 C+LSL GD L+  + +P  SI+    + ++ + +P+ ++ ++ P WNTL+EF+  
Sbjct: 656  DFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLNTPPWNTLNEFMKH 715

Query: 704  TTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGD 763
               G   DF++ G+Y+ +  +D+DN DT++I+  S ST    +GFV+RYL N+K+NYFG+
Sbjct: 716  KEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVMRYLTNVKMNYFGE 775

Query: 764  FNHFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVADTINEN---- 819
            F +F T+EEY+  L   E     TK       + V  L +S+ D  YQ +   NE+    
Sbjct: 776  FFNFVTSEEYTGVLGAREVGDVTTK-------SSVADL-ASTVDSGYQNSSLKNESEDKG 827

Query: 820  TIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDL 879
             + +S L RT NETD+W TF V DG +I+PE +Y       L F  L  D R  NY+MD+
Sbjct: 828  PMKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDFRSCNYYMDI 887

Query: 880  TAFFSRIYLNHSNEFSFNRVV--------AIEESHSENTGYLDDLNLHGHRMFGVPPVEE 931
             A  +   +        N V         A E+ H    G L DL +HGHRM+G+PP E 
Sbjct: 888  MAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEH----GLLSDLTIHGHRMYGLPPTEP 943

Query: 932  TYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVTSLTISI 991
            TY C+WDI++G L  DSD +F+  F  +  K+GF Y D ENIL+Y      D+TSLT+ +
Sbjct: 944  TYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTSLTVHV 1003

Query: 992  GRVSSIVRTNHGGS-ATLSLNDITINSWDLSNSRYSKRVDLLVAAISV---CAI-DEKKT 1046
             ++   ++     S + +S   I     D  N +YS+R+D+ +  +++   C + D   T
Sbjct: 1004 EKIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMGDGVDT 1063

Query: 1047 VLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLYDDLL 1106
                 +T +  T F    ++   R  Q+  + ++DSP+HRC FLL     +  T Y +L 
Sbjct: 1064 SFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDT-YQNLY 1122

Query: 1107 GSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDI--IDTKNXXXXXXXXXXX 1164
            G+I PS S+PTL  P    T D I E ++G Y  L+        I  +            
Sbjct: 1123 GAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLETTNPFKNIFAETPSTMEPSRASF 1182

Query: 1165 XXXSNTVSNDLSGQLAEEF------ESENTTVNISTLSVFVTPKAFTFAENAAHFMLTMS 1218
                N    D S      F      E +N  V++S + + V P  F FA++    + + +
Sbjct: 1183 SEDDNDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIFAKSLLEQLYSEN 1242

Query: 1219 TESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVN-ISDETALDKTQLEALDRLEL 1277
               ++D  E+ IV   S  ++  G    S++ +    +N I  ET  +  +L  LDR++ 
Sbjct: 1243 MVQVLDDIEIGIVKRLS--NLQEGITSISNIDIHIAYLNLIWQETGEEGFEL-YLDRIDY 1299

Query: 1278 SVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIFKSSKNRLTKVLPIAW 1337
             +S  S+            + N +  + + + ++    +++  + +     L++  P A 
Sbjct: 1300 QMSEKSL------------EKNRTNKLLEVAALA-KVKTVRVTVNQKKNPDLSEDRPPAL 1346

Query: 1338 -FEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLKLAKAFCKEGKSCIELG 1396
               I  F     ++  +V+ L   S    I ++ +EW  EY         +   S   + 
Sbjct: 1347 SLGIEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQ 1406

Query: 1397 KLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVRDTASWKIITRLRHVS 1456
              RS    E I ++    +   I   PY+ITKPA+I RLSK HVR+  SWKIITRLRH+ 
Sbjct: 1407 NTRSNSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHIL 1466

Query: 1457 KHTSHVSETTSQCDDIPEEVR-NICKD-KSQFLDIFVDWKNWDVYEVEQSSLFTLLFSGE 1514
             +     +  S  D++ +E +    KD K+ F+ +F  W+NW+  +V +S ++  LF+ E
Sbjct: 1467 TYLP--DDWQSNIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAE 1524

Query: 1515 STVHEEDL 1522
            +  H+++L
Sbjct: 1525 NEKHKQNL 1532

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/1208 (32%), Positives = 642/1208 (53%), Gaps = 80/1208 (6%)

Query: 1762 VLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNLSGISIIVNY--TELLLDFYFNQLKL 1819
            VLS    ++  +     PF IR     LD  F       I+++   T+  +  +  + + 
Sbjct: 1778 VLSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFMTSHQTKEQY 1837

Query: 1820 LRISNSVTKVD---YRSNTLLTDIGLDTDIVKLTLSDNRVYI------EELTDSLNGTVS 1870
            LR S    ++     R    L ++ +   ++KLT S+ R  +      E+L       + 
Sbjct: 1838 LRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGINLLY 1897

Query: 1871 ELIKIFKNKN-ADNEPAAPKFK-PCSFKMNAIYIGLLTDLKTTNYVLEFNETAFSCASRA 1928
             L  +F + N    E  AP      +   +  Y G+L  + +T +V E +    S  +  
Sbjct: 1898 SLKPLFFSSNLPKKEKQAPSIMINWTLDTSITYFGVLVPVASTYFVFELHMLLLSLTNTN 1957

Query: 1929 EAL--EETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIED--DIKKTL 1984
              +  EET            I+N+  L+    +   LSK+ D    +  ++   D +++ 
Sbjct: 1958 NGMLPEETKVTGQFS-----IENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVDTEQSF 2012

Query: 1985 QIETPHSRVMLAPSTLIAVIFFIQE--------AKVSLQKVKQKGKFNSSSN-AIEIPPY 2035
            Q+E+ H RV L+P +L+ +++   +        ++     +     F   S+ + E+P  
Sbjct: 2013 QVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWNTKMFTGKSDKSKEMPIN 2072

Query: 2036 FETLSVNILSNKLCLGWIFEEDTDEN-GIVIGYESLFAAYEKPYGKLTIVDGYVATAQGK 2094
            F   S++ILS K C+GWIF+     N G+++GY  LF+AYEK +GK T+VD + + A G 
Sbjct: 2073 FR--SIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFTVVDAFFSVANGN 2130

Query: 2095 ESNNFFF-ANGVPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVN 2153
             S+ FF   N   + NRS L +MQI++WF      KD F R + + LDV  + + ++++ 
Sbjct: 2131 TSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFVPSFMDVIE 2190

Query: 2154 VMRSSIESFQXXXXXXXXXXXXXXXTHNVAENLSDKVSIL--------SIRSINCIAKYG 2205
                S+ +FQ                ++ +   +   S          +IRS+N   KY 
Sbjct: 2191 STLQSMRAFQELKKNILDVSESLRAENDNSYASTSVESASSSLAPFLDNIRSVNSNFKYD 2250

Query: 2206 GGIINLYTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILF 2265
            GG+  +YT +DI   S + S E+ SP + ++  Y H+    K H  R+L+ V+ THN L+
Sbjct: 2251 GGVFRVYTYEDIETKS-EPSFEIKSPVVTINCTYKHDEDKVKPHKFRTLITVDPTHNTLY 2309

Query: 2266 SSCVPVLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVIN 2325
            + C P+L+  +  +QK +++ ++++K    K   Q         DYK L  + D A+ + 
Sbjct: 2310 AGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSSQNV-------DYKRLLDQFDVAVKLT 2362

Query: 2326 VGAQNITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSRE 2385
               Q ++L+CEP+AK+QAD+GF +F  SM T+  D  +PL  SL     + S +HIFSRE
Sbjct: 2363 SAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASIKHIFSRE 2422

Query: 2386 ISSSAGINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQ 2445
            +S+S  +  + L  + TH + I  YG  L+SD+  + N+KQLQ + LFLDIW    + + 
Sbjct: 2423 VSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIW----RFSS 2478

Query: 2446 KLGSGPHSGQKCQPQALTEFTTP-------KIPWIYQIIFKNTSAVIDMDPSLGSINFKV 2498
             L + P      +   ++  T+        +IPW + +IF N S  +D+ PSLG I+ + 
Sbjct: 2479 ILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTNVSGDVDLGPSLGMISLRT 2538

Query: 2499 PTFWISSHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPL 2558
               W+++ H  +    +  + D ++  S+GRL GLFE+ N  + S + WP + +K   PL
Sbjct: 2539 QRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPL 2598

Query: 2559 INLAFKMSHLSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFL 2618
            ++ +  +  ++ K  FDYH FLI  +S++   + NE+D  G+L DLL VS S   + +  
Sbjct: 2599 VSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSS 2658

Query: 2619 TALASANLYDIYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRLRTNLTA 2678
            TAL  AN+ DIY T  RMR +NK SY++TL++SNP  S +     + L +   LRT+L+ 
Sbjct: 2659 TALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLRTDLSV 2718

Query: 2679 EIGSFRLYVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNE 2738
             I S ++ + P +LFD EVLV++ +K+++ + T + +K KTDL  Q+ D++ +L+  K E
Sbjct: 2719 NISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEE 2778

Query: 2739 LTEEQFAELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVD 2798
            L EE  A +++++Y   A+ + G  I+  P + V +TT Q+    ++E+L++ SF DK+ 
Sbjct: 2779 LDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKIS 2838

Query: 2799 IKWNLDPINFIREMWATHVRALSVRR--------GHTEPSPSKPFFEDENIAEKIKIVNL 2850
            ++WNL P++FI+EMW THV+AL+VRR        G TE          E + E IK    
Sbjct: 2839 VRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTE----------EELEESIKKEEA 2888

Query: 2851 GTKYKYIPLEEPHIEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAED 2910
             +K+ YI LEEP IE+P +RDLG+ATPP+EWFGVNRK+FP   HQ  V+P+QKL+Y+AE 
Sbjct: 2889 ASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFTHQTAVIPVQKLVYLAEK 2948

Query: 2911 QYNRTLGD 2918
            QY + L D
Sbjct: 2949 QYVKILDD 2956

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1573 (31%), Positives = 763/1573 (48%), Gaps = 140/1573 (8%)

Query: 4    SSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQYKIK 63
            SS FR + IS  +D S  FL DW+L + + +L+ FY GR+L + +T  L++  W++Y +K
Sbjct: 2    SSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVK 61

Query: 64   INLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDGDAS 123
            +           GR+FFKNLTV++ D T S L GS TWRYWLL +R   ++ +SE     
Sbjct: 62   V-----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQSEKA--- 107

Query: 124  ENAKLPCRFLLQCDGLEVFVYNKIDVYESVL-----------RDHFTNVTKDGQETESND 172
              AKLPCRF ++C GLE F+YN+   ++++L           +  F++ +    E  S +
Sbjct: 108  --AKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFFSDPSPRATEETSTE 165

Query: 173  DITINTEXXXXXXXXXXXXXXXXXXXXXXTDAPKLSAKTKLFPIQLEANRAAIVLGNRNT 232
            + +   +                           + +  +L P++    + A+++GN+ T
Sbjct: 166  NDSAAQKSHLETSMSSPSASTESLNDRTYQLPNSMPSFLRLLPLEYSVQKGALIIGNKKT 225

Query: 233  RHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTFVVE 292
              V V  FE+ KG  D  +  + +D Y+ K+  D+      LR NL Y ND P+K     
Sbjct: 226  SSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKA 285

Query: 293  KTMDKIWQTVKKQCISISKLLLPNQGKTINNQQAY---IDSWKGLDLYHHTKAVQEENVD 349
              + K+     +  + + K  L    KT + ++     ++ W+GL LY        ++V 
Sbjct: 286  NRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDLRNPLERWRGLGLYWKENDPAWDDVF 345

Query: 350  TTVLHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQDDDTPA 409
               L + EYARYS+VMK E + + Y  D PG+VP  +       D  +  N       P 
Sbjct: 346  HFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGA---PPD 402

Query: 410  FGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSVDF 469
            F  DI ++ A ++YGPWAH  +  I ++FSP+VSRD     +   GS R++   ++S+  
Sbjct: 403  FSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMI 462

Query: 470  RDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQADRLP 529
               S+  IPTRE SKD +F+KRYK T D  R FGWL +SL EG E+  N+A+C  +    
Sbjct: 463  MSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFD 522

Query: 530  NELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAELFLLR 589
            N+L +  + PEI++SVNH++L    T  I+A IGYP GWN +A W F+L S  A +F+L+
Sbjct: 523  NKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILK 582

Query: 590  DHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFXXXXXXXXXXXXXXXXXXC 649
            DHI+L+ D+ +DF   D   Y+LFRPF YE  W  T Y ++                  C
Sbjct: 583  DHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENC 642

Query: 650  FLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFGEC 709
            +LS  GD L  S  +P  SI        + L +PL +L+++ P WNTLHEF+ +   G  
Sbjct: 643  YLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRA 702

Query: 710  PDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHFKT 769
             DFS+ G+Y+    +DV+N DTI+I+ +S  T    +G+V+R+L+ +K+NYFGDF HFKT
Sbjct: 703  CDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKT 762

Query: 770  TEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVAD--TINENTIHKSSLL 827
            TEEY  +L    D   + K   EQ  N  E+ T+   +         T +     K SL 
Sbjct: 763  TEEYMEEL---RDAYVEPKANSEQSANSTETTTAGEGEDKQNAPKNHTTDPVMAKKLSLK 819

Query: 828  RTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLTAFFSRIY 887
            R  NE DVW TF V DGC+I+P+NLYDC   F   F  L+ D+RY NY+MDL A  S + 
Sbjct: 820  RMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVI 879

Query: 888  LNHSNEFSFNRVVAIEESHS---ENTGYLDDLNLHGHRMFGVPPVEETYLCKWDISIGSL 944
            + + ++     + +  E       N G + DL++H HRMFG+PP EETY CKWD S+G L
Sbjct: 880  VRNLSDCDPAHLFSGSEGRCPSRANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVL 939

Query: 945  STDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVTSLTISIGRVSSIVRTNHGG 1004
               SD   + SF +A  K+ F++KD ENI+ Y I    D+TS+    G +   V+ N   
Sbjct: 940  DISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIR--VKINDVA 997

Query: 1005 S---ATLSLNDITINSWDLSNSRYSKRVDLLVAAISVCAIDEKKTVLFTCD--TAVELTK 1059
                  + + ++T    D  N RYS R D+ + +I+V   +  K      D  +++++TK
Sbjct: 998  VDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQVKEGGKDGSLIGDFSSSLKITK 1057

Query: 1060 FVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLYDDLLGSITPSISLPTLS 1119
            F    N   H + Q++ +  ND+PFHRC FLL    +  S  Y  LLGSI P +S+P + 
Sbjct: 1058 FCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPL-AIQRSDNYRKLLGSIVPGVSIPGMV 1116

Query: 1120 EPLTFQTFDNIYERLLGSYINLINFDTDIIDTKNXXXXXXXXXXXXXXSNTV--SNDLSG 1177
            EP+T +    I +  L    N +    +   +K               S+T   SN  S 
Sbjct: 1117 EPITPENVTMILDEFLKGEKNSLQMGNEHFCSKKEEDGYAFNFASGLMSSTENDSNVESE 1176

Query: 1178 QLAEEFESENTTVNISTLSVFVTPKAFTFAENAAHFMLTMSTESIMDYFEMNI------- 1230
             L  +      +++   +  F +     ++      + +   E ++ + E  +       
Sbjct: 1177 SLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEIEVVLHFIETTLKRKQCKN 1236

Query: 1231 VNIFSVGHITNGKFFNS----------SVMLKNVKVNIS-----------DETALDKTQL 1269
            V +FS         F S           +++K + V+IS             T  D T L
Sbjct: 1237 VKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITAL 1296

Query: 1270 EALDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQF-----NIFKS 1324
              ++ L L VSN S             ++     I +D   S +   L+F     +I KS
Sbjct: 1297 VKVESLALCVSNTS-------------RNGPLENIHEDQLCSTSIKDLEFWMTSEDIRKS 1343

Query: 1325 SKNRLTKVLPIAWFEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLKLAKA 1384
            S            F     +T + SD  ++   IF    +A +D   E    +  +L KA
Sbjct: 1344 S------------FNATSIDTWVHSDKTELC-CIFLKNTAANIDTITEVVSVHKERLQKA 1390

Query: 1385 FCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVRDTA 1444
                               ++   R++       I   P +ITKPAYITRL   HVR+  
Sbjct: 1391 ------------------QRDFFYRISTASDEYQIIHDPPVITKPAYITRLPNQHVRENK 1432

Query: 1445 SWKIITRLRHVSKH--TSHVSET----TSQCDDIPEEVRNICKDKSQFLDIFVDWKNWDV 1498
            SWKIITRLRH+  +   S ++E      S   + P     I      FL+IF  W++W+ 
Sbjct: 1433 SWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEI------FLNIFSKWRSWES 1486

Query: 1499 YEVEQSSLFTLLF 1511
             +VEQ  ++   F
Sbjct: 1487 SDVEQCYMYRKAF 1499

 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/1186 (37%), Positives = 673/1186 (56%), Gaps = 61/1186 (5%)

Query: 1773 QTSAFVPFIIRILISGLDFNFKNLSGISIIVNYTELLLDFY--FNQLKLLRISNS----V 1826
            + SA  P  I     GL   F+  +  S+ +      LD        + L++S S     
Sbjct: 1774 EISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELT 1833

Query: 1827 TKVDYRSNTLLTDIGLDTDIVKLTLSDNRVYIEELTDSLNGTVSEL--IKI--------F 1876
             K+  +   + + + L++ + K  L D R  IE LT  L      L  +KI        F
Sbjct: 1834 AKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALF 1893

Query: 1877 KNKNADNEPAAPKFKPCSF--KMNAIYIGLLTDLKTTNYVLEFNE--TAFSCASRAE-AL 1931
               + D E  A    P  +  +++  Y+GLL  L TT+Y+ E NE  ++ SC   AE + 
Sbjct: 1894 GTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTSYISEINELSSSLSCDEAAEFSF 1953

Query: 1932 EETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKL--IEDDIKKTLQIETP 1989
               H         L +  +  L+ + E+   LSK+ +  F +KL  + ++  K+LQIE+ 
Sbjct: 1954 PLVHGE-------LSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIEST 2006

Query: 1990 HSRVMLAPSTLIAVIFFIQEAK--VSLQKVKQKGKFNSSSNAIEIPPYFETL-SVNILSN 2046
            H R+ L P +LI ++    EA     LQ +K      SS +A +     +T  S+ ILS 
Sbjct: 2007 HFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGVKSSDDAKDFFNISQTFHSIQILSY 2066

Query: 2047 KLCLGWIFEEDTDEN-GIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFF-ANG 2104
              CLGWIF  D   N G+  GY+ LFAA+EKPYGKLT++D Y   A+G  SN+F+   + 
Sbjct: 2067 DFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDE 2126

Query: 2105 VPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQX 2164
            V   NRS L SMQI +WF     E +LFVR+N ++LDV  L+ S+ I      S+  FQ 
Sbjct: 2127 VDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQE 2186

Query: 2165 XXXXXXXXXXXXXXTHNV-AENLSDKVSILS-IRSINCIAKYGGGIINLYTPDDIAQDSP 2222
                             V A +   K+ ILS I  +NC  +Y GG+  LY+ DDI + + 
Sbjct: 2187 LKRQYLDPFKPEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKT- 2245

Query: 2223 KSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQKQ 2282
              S +L SPS++V  +Y      +++H +R+L++V+S+HN LF +CVP++  +  +I++ 
Sbjct: 2246 GPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQL 2305

Query: 2283 MERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQ 2342
            ++  N    +       +T+N Q    +Y++L + +D + ++N+  Q I+L+CEP+AK+Q
Sbjct: 2306 LKDLNKSSVE-----TPRTSNMQE-GINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQ 2359

Query: 2343 ADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFMLT 2402
            AD+GF  F + +FT+  D  EPLSLSL    I  ++RHIFSRE+S+S  I  +   FMLT
Sbjct: 2360 ADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLT 2419

Query: 2403 HENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLGSGPHSGQK--CQPQ 2460
            H +TI TYG   I  +  Y N+KQLQ++ +F++IW    K   K+ S P    K    P 
Sbjct: 2420 HPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIW----KLDSKILSQPELDNKFVIGPT 2475

Query: 2461 ALTEFTTPK---------IPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDW 2511
             L +  T K          PW + +I       ID+  SLG ++      W  + H  DW
Sbjct: 2476 NLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDW 2535

Query: 2512 SHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSK 2571
            + ++S  LD+L+  SDGRLGG F ++N  + S I WP+ +  FE+PL+ L   +   + K
Sbjct: 2536 TQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVK 2595

Query: 2572 IGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYA 2631
            + FDYH  LIA V  L L++ N+RD  G++++LL VS+S  S  +FLTALA AN++D+Y 
Sbjct: 2596 LTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYN 2655

Query: 2632 TFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRLRTNLTAEIGSFRLYVFPST 2691
            T  RMR +N+KSY++TL +SN   +     S+  L +   LRT L+  +    + V+PST
Sbjct: 2656 TILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPST 2715

Query: 2692 LFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEE 2751
            LFD EV+  KA   +  + T+  +K KT L  ++ ++ ++L+ +K++L E   +++ V+E
Sbjct: 2716 LFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKE 2775

Query: 2752 YNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIRE 2811
            Y   A+ ++G  IL+ P++ +G+TTW  +    +E LYS+SFG K+ ++WNL  INF+RE
Sbjct: 2776 YIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLRE 2835

Query: 2812 MWATHVRALSVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRD 2871
            MWATH RA+++RR H     SK FFEDE++ +K+K V+LG +Y YIPLEEPHIE+P  +D
Sbjct: 2836 MWATHARAMALRRSHN--GQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKD 2893

Query: 2872 LGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917
            LG ATPP+EWFGVNRK+FPG+ HQ ++VPLQKL ++AE ++ R LG
Sbjct: 2894 LGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILG 2939

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/1567 (30%), Positives = 801/1567 (51%), Gaps = 80/1567 (5%)

Query: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60
            M++ S  R + ++ +KD S  FLVDWIL ++ C+   FY+GRI A++++  L++ +W++ 
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120
            K+KIN+++++VS LGGRI FK+L+V+  D+TIS LEGS TW+YWLL+ R   +  ++   
Sbjct: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAEL-IDNNKS 119

Query: 121  DASENAKLPCRFLLQCDGLEVFVYNKIDVYESVL-------RDHFTNVTKDGQETESNDD 173
             +  N KLPC+F L+C+GLE+F+YN+   Y++V+       RD F     +    E   D
Sbjct: 120  PSKNNVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPEPFSD 179

Query: 174  IT----INTEXXXXXXXXXXXXXXXXXXXXXXTDAPKLSAKTKLFPIQLEANRAAIVLGN 229
             +    ++ +                      TD  K     K  PI+L  +R +++LGN
Sbjct: 180  GSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLPIELNFSRGSLLLGN 239

Query: 230  RNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTF 289
            + T  V +  +E  +G+ D+      +D YR K  ++  +    ++ N+GY +   +K  
Sbjct: 240  KFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFK 299

Query: 290  VVEKTMDKIWQTVKKQCISISKLLLPNQGK--TINNQQAYIDSWKGLDLYHHTKAVQEEN 347
            +    + K+W+   +    +SK ++  + K  T ++  ++   WKGL LY  T    + N
Sbjct: 300  LDTGKVSKLWKAFIRVLQLVSKPVVSKRTKKNTRSSNDSFYQKWKGLSLYKATSGEAKAN 359

Query: 348  VDTTV---LHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQD 404
                +   L   EYA+++ ++K  +V+++Y  D+PG+VP  +    S  D  +  N   +
Sbjct: 360  DLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAHPTISDIDGPDVGN---N 416

Query: 405  DDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFK 464
               P F  D+ I+  ++ YGPWA + +  + R+ SP+VSR      K  PGS R+Y  F+
Sbjct: 417  GAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIKKLPPGSRRVYTLFR 476

Query: 465  LSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQ 524
            +++   + +   IPTRE+SKD EF++ YK T + +R FGW+++   +     FN+++C  
Sbjct: 477  MNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNISVCPT 536

Query: 525  ADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAE 584
             +   N  +V  +  EI+SSVNH++L +     I  +IGYP GWN +A W+  + S   E
Sbjct: 537  VEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNSKAIWIINMKSEQLE 596

Query: 585  LFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFXXXXXXXXXXXXXX 644
             FLLR+HI+L++D  +DFSA D   YELFRPF Y++ W    Y ++              
Sbjct: 597  AFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLD 656

Query: 645  XXXXCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSET 704
                C+LSL GD L   + +P  SI+    + ++ + +P+ ++ ++ P WNTL+EF+   
Sbjct: 657  FNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHK 716

Query: 705  TFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDF 764
              G   DF++ GTY+ +  +D+DN DT++I+  S+ST    +GFV+RYL N+K+NYFG+F
Sbjct: 717  EVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEF 776

Query: 765  NHFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVADTIN----ENT 820
             +F T+EEY+  L   +     TK       + V  L +S+ D  YQ +   N    +  
Sbjct: 777  FNFVTSEEYTGVLGARDVGDVTTK-------SSVVDL-ASTVDSGYQNSSVKNNSEAKGP 828

Query: 821  IHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLT 880
            + +S L RT NETD+W TF V +G +I+PE +Y       L F  L  D R  NY+MD+ 
Sbjct: 829  MKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDFRSCNYYMDIM 888

Query: 881  AFFSRIYLNHSNEFSFNRVV--------AIEESHSENTGYLDDLNLHGHRMFGVPPVEET 932
            A      +        N V         A E+ H    G L DL +HGHRM+G+PP E T
Sbjct: 889  AVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEH----GSLSDLTIHGHRMYGLPPTEPT 944

Query: 933  YLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVTSLTISIG 992
            Y C+WDI++G LS DSD +F+  F  +  K+GF Y D ENIL+Y     +D+TSLT+   
Sbjct: 945  YFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTSLTVHAE 1004

Query: 993  RVS-SIVRTNHGGSATLSLNDITINSWDLSNSRYSKRVDLLVAAISV---CAIDEKKTVL 1048
            R+  S+        + +S   I     D  N  YS+R+D+ V  + +   C + +   + 
Sbjct: 1005 RIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMGDGVDMS 1064

Query: 1049 F-TCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLYDDLLG 1107
            F   +T +  T F    ++   R  Q+  +  +DSP+HRC FLL     +  T Y  L G
Sbjct: 1065 FLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDT-YQKLYG 1123

Query: 1108 SITPSISLPTLSEPLTFQTFDNIYERLLGSYINLIN----FDTDIIDTKNXXXXXXXXXX 1163
            +I PS S+PTL  P    T D I E ++G Y  L+     F     +T +          
Sbjct: 1124 AIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPSKASFT 1183

Query: 1164 XXXXSNTVSND--LSGQLAEEF--ESENTTVNISTLSVFVTPKAFTFAENAAHFMLTMST 1219
                    S+     G   E+   E +N  V++S + + + P  F F ++    + + + 
Sbjct: 1184 EDDNDEEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSLLEQLYSENM 1243

Query: 1220 ESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVN-ISDETALDKTQLEALDRLELS 1278
              ++D  E+ IV   S  ++  G    S++ +    +N I  ET  +  +L  LDR++  
Sbjct: 1244 VQVLDDIEIGIVKRLS--NLQEGITSISNIDIHIAYLNLIWQETGEEGFEL-YLDRIDYQ 1300

Query: 1279 VSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIFKSSKNRLTKVLPIAWF 1338
            +   S+            + N +T + + + ++    +++  + +     L++  P A  
Sbjct: 1301 MREKSL------------EKNRTTKLLEVAALA-RVKTVRVTVNQKKNPDLSEDRPPALS 1347

Query: 1339 EILMFNTVLFSDVGK-VSKLIFGSIKSAILDADVEWTVEYLLKLAKAFCKEGKSCIELGK 1397
              L    +  S  G+ V+ L   S    I ++ +EW  +Y    A    +   S   +  
Sbjct: 1348 LGLEGFEIWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQD 1407

Query: 1398 LRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVRDTASWKIITRLRHVSK 1457
             R+    E I  +    +   I   PY+ITKPA+I RLSK HVR+  SWKIITRLRH+  
Sbjct: 1408 TRTSSKTELISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILT 1467

Query: 1458 HTSHVSETTSQCDDIPEEVRNICKD--KSQFLDIFVDWKNWDVYEVEQSSLFTLLFSGES 1515
            +     +  +  D + +E +    +  K+ F+ +F  W+NW+  +V +S ++  LFS ++
Sbjct: 1468 YLP--DDWQNNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDN 1525

Query: 1516 TVHEEDL 1522
              H+++L
Sbjct: 1526 EKHKQNL 1532

 Score =  644 bits (1662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1215 (32%), Positives = 645/1215 (53%), Gaps = 94/1215 (7%)

Query: 1762 VLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNLSGISIIVNY--TELLLDFYFNQLKL 1819
            VL+    ++  +     PF IR     LD  F       I+++   T+  +  +  + + 
Sbjct: 1778 VLTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDFFMTSHQTKEQY 1837

Query: 1820 LR-------ISNSVTKVDYRSNTLLTDIGLDTDIVKLTLSDNRVYI------EELTDSLN 1866
            LR       I   V+K  Y     L ++ +   ++KLT S+ R  +      E+L     
Sbjct: 1838 LRFSFGDIEIKGGVSKEGYS----LINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGI 1893

Query: 1867 GTVSELIKIFKNKNADNEPAAPKFKPC-----SFKMNAIYIGLLTDLKTTNYVLEFNETA 1921
              +  L  +F + N    P   K  P      +   +  Y G+L  + +T +V E +   
Sbjct: 1894 NLLCSLKSLFFSSNI---PKKEKQVPALMINWTLDTSISYFGILIPVASTYFVFELHMLL 1950

Query: 1922 FSCASRAEAL--EETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIED- 1978
             S  +    +  EET            I+N+  L+    +   LSK+ D    +  ++  
Sbjct: 1951 LSLTNTNNGMLPEETKVTGQFS-----IENILFLIKERSLPIGLSKVLDFSIKVSTLQRT 2005

Query: 1979 -DIKKTLQIETPHSRVMLAPSTLIAVI-----------FFIQEAKVSLQKVKQ-KGKFNS 2025
             D +++ Q+E+ H RV L+P +L+ ++           ++ +    ++  +K   GK   
Sbjct: 2006 IDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTGK--- 2062

Query: 2026 SSNAIEIPPYFETLSVNILSNKLCLGWIFEEDTDEN-GIVIGYESLFAAYEKPYGKLTIV 2084
            S    EIP  F   S++ILS K C+GW+F+  T  + G+++GY  LF+AYE+ +GK T+V
Sbjct: 2063 SDKPKEIPLNFR--SIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVV 2120

Query: 2085 DGYVATAQGKESNNFFF-ANGVPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVR 2143
            D + + A G  S+ FF   N   + NRS L +MQI++WF      KD F R + + LDV 
Sbjct: 2121 DSFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVN 2180

Query: 2144 ILTTSVEIVNVMRSSIESFQXXXXXXXXXXXXXXXTHN---VAENLSDKVSILS-----I 2195
             + + +++++    S+ +FQ                 +    A ++ +  S L+     I
Sbjct: 2181 FVPSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNIYAASSVENAPSSLAPFLNNI 2240

Query: 2196 RSINCIAKYGGGIINLYTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLV 2255
            RS+N   KY GG+  +YT +DI   S + S E+ SP + ++  Y H+    + H IR+L+
Sbjct: 2241 RSVNSNFKYDGGVFRVYTYEDIEAKS-EPSFEIKSPVVTINCTYKHDEDKVRPHKIRTLI 2299

Query: 2256 NVESTHNILFSSCVPVLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLF 2315
             V+ THN L++ C P+L+  +  +QK +++ ++++K    K   Q         DYK L 
Sbjct: 2300 TVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSPQNV-------DYKRLL 2352

Query: 2316 KKIDTAIVINVGAQNITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIE 2375
             + D A+ +    Q ++L+CEP+AK+QAD+GF +F  S+ T+  D   PL  SL     +
Sbjct: 2353 DQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTK 2412

Query: 2376 ISTRHIFSREISSSAGINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLD 2435
             S +HIFSRE+S+S  +  + L  + TH + I  YG  L+SD+  + N+KQLQ + LFLD
Sbjct: 2413 ASIKHIFSREVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLD 2472

Query: 2436 IWS----PKTKKAQKLGSGPHSGQKCQPQALTEFTTPKIPWIYQIIFKNTSAVIDMDPSL 2491
            IW       T+ AQ+  +           +  +  T +IPW + +IF N S  +D+ PSL
Sbjct: 2473 IWRFSSILHTRPAQRSVNKGIDMHSLTSTSHVDLGT-EIPWCFTLIFTNVSGDVDLGPSL 2531

Query: 2492 GSINFKVPTFWISSHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKD 2551
            G I+ +    W+++ H  +    +  + D ++  S+GRL GLFE+ N  + S + W  + 
Sbjct: 2532 GVISLRTQRTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEK 2591

Query: 2552 NKFEAPLINLAFKMSHLSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSF 2611
             K   PL++ +  +  ++ K  FDYH FLI  ++++   + NE+D  G+L DLL VS S 
Sbjct: 2592 GKNTHPLVSTSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSS 2651

Query: 2612 GSVNIFLTALASANLYDIYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLR 2671
              + +  TAL +AN+ DIY T  RMR +NK SY++TL++SNP  S +     + L +   
Sbjct: 2652 DEIILSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKL 2711

Query: 2672 LRTNLTAEIGSFRLYVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINIS 2731
            LRT+L+  I S ++ + P +LFD EVLV++ +K+++ + T + +K KTDL  Q+ D++ +
Sbjct: 2712 LRTDLSVSISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAA 2771

Query: 2732 LAQFKNELTEEQFAELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSS 2791
            L+  K EL EE  A +++++Y   A+ + G  I+  P + V +TT Q+    ++E+L++ 
Sbjct: 2772 LSTSKEELDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFAC 2831

Query: 2792 SFGDKVDIKWNLDPINFIREMWATHVRALSVRR--------GHTEPSPSKPFFEDENIAE 2843
            SF DK+ ++WNL P+NFI+EMW THV+AL+VRR        G TE          E + E
Sbjct: 2832 SFSDKISVRWNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTE----------EELEE 2881

Query: 2844 KIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQK 2903
             I      +K+ YI LEEP IE+P +RDLG+ATPP+EWFGVNRKRFP   HQ  V+P+QK
Sbjct: 2882 SINKEETASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQK 2941

Query: 2904 LIYVAEDQYNRTLGD 2918
            L+Y+AE QY + L D
Sbjct: 2942 LVYLAEKQYVKILDD 2956

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1574 (31%), Positives = 800/1574 (50%), Gaps = 94/1574 (5%)

Query: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60
            M++ S  R + ++ +KD S  FLVDWIL V++C+   FY+GRI A+++T  L++ +W++ 
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60

Query: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120
             IKIN+++++VS LGGRI FK+L+V+  D+TIS LEGS TW+YWLL+ R   +  E+   
Sbjct: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAEL-IENNKD 119

Query: 121  DASENAKLPCRFLLQCDGLEVFVYNKIDVYESVL-------RDHFTNVTKDGQETESNDD 173
              S+N KLPC+F L+C+GLE+F+YN+   Y++V+       RD F     +    ES  D
Sbjct: 120  SLSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEKYLNEHSFPESFSD 179

Query: 174  IT----INTEXXXXXXXXXXXXXXXXXXXXXXTDAPKLSAKTKLFPIQLEANRAAIVLGN 229
             +    ++ +                      TD  KL    K  PI+L+ NR +++LGN
Sbjct: 180  GSSADKLDEDLSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLPIELKFNRGSLLLGN 239

Query: 230  RNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTF 289
            + T  V +  +E  +GV D+      LD YR K  ++  +    ++ N+GY +   +K  
Sbjct: 240  KFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIKQNIGYDDAIGLKFK 299

Query: 290  VVEKTMDKIWQTVKKQCISISKLLL--PNQGKTINNQQAYIDSWKGLDLYHHTKA-VQEE 346
            +    + K+W+T  +    ++K ++   N+ KT  +  ++   WKGL LY       +  
Sbjct: 300  LDTGKVSKLWKTFVRVLRIVTKPIISKKNKKKTGPSDDSFFQKWKGLSLYKAAPGDAKPS 359

Query: 347  NVDTTVLH--EQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQD 404
            ++D         EYA+++ ++K  ++++ Y  D+ G VP  +       D  +  N   +
Sbjct: 360  DLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAHPTIPDIDGPDVGN---N 416

Query: 405  DDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFK 464
               P F  D+ I+  ++ YGPWA + +  + R+ SP+VSR      K  PGS RIY  F+
Sbjct: 417  GAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVKKLPPGSRRIYTLFR 476

Query: 465  LSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQ 524
            ++V   + +   IPTRE+SKD EF++ YK T + +R FGW+++   +     FN+ LC  
Sbjct: 477  MNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFCKDTYANFNVVLCPT 536

Query: 525  ADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAE 584
             +   N  +V  +  EI+SSVNH++L +     +  +IGYP GWN +A W+  + S+  E
Sbjct: 537  VEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNSKAIWIINMKSQQLE 596

Query: 585  LFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFXXXXXXXXXXXXXX 644
             FLLR+HI+L++D  +DFSA +   YELFRPF Y++ W    Y ++              
Sbjct: 597  AFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIYLNVNDHNIVNNPLD 656

Query: 645  XXXXCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSET 704
                C+LSL GD L   I +P  SI+    + ++ + +P+ ++ ++ P WNTL+EF+   
Sbjct: 657  FNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLNTPPWNTLNEFMKHK 716

Query: 705  TFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDF 764
              G   DF++ G+Y+ +  +D+DN DT++I+  S+ST    +GFV+RYL N+K+NYFG+F
Sbjct: 717  EVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVMRYLTNVKMNYFGEF 776

Query: 765  NHFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVADTINE----NT 820
             +F T+EEY+  L   E  +  TK       + V  L +S+ D  YQ +   NE    + 
Sbjct: 777  FNFVTSEEYTGVLGAREVGEIITK-------SSVLDL-ASTLDSGYQNSSLKNESEDKDP 828

Query: 821  IHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLT 880
            + +S L RT NETD+W TF V +G +I+PE +Y       L F  L  D R  NY+MD+ 
Sbjct: 829  VKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDFRSCNYYMDIM 888

Query: 881  AFFSRIYLNHSNEFSFNRVV--------AIEESHSENTGYLDDLNLHGHRMFGVPPVEET 932
            A  +   +        N V         A E+ H    G L DL +HGHRMFG+PP E T
Sbjct: 889  AVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEH----GTLSDLTIHGHRMFGLPPTEPT 944

Query: 933  YLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVTSLTISIG 992
            Y C+WDI++G L+ DSD +F+  F  +  K+GF Y D ENIL+Y     +D+TSLT+   
Sbjct: 945  YFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTSLTVHAE 1004

Query: 993  RVS-SIVRTNHGGSATLSLNDITINSWDLSNSRYSKRVDL----LVAAISVCAIDEKKTV 1047
            R+  S         + ++   +     D  N RYS+R+D+    L+ ++S    D   T 
Sbjct: 1005 RIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMGDGVDTS 1064

Query: 1048 LFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLYDDLLG 1107
                +T +  T F    ++   R  Q+  +  +DSP+HRC FLL     +  T Y  L G
Sbjct: 1065 FLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDT-YQKLYG 1123

Query: 1108 SITPSISLPTLSEPLTFQTFDNIYERLLGSYINLI---NFDTDIIDTKNXXXXXXXXXXX 1164
            +I PS S+PTL  P    T D I E ++G Y  L+   N   DI                
Sbjct: 1124 AIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLETTNPFKDIFAETPSTVEPSRASST 1183

Query: 1165 XXXSNTVSNDLSGQL-----AEEFESENTTVNISTLSVFVTPKAFTFAENAAHFMLTMST 1219
               ++  ++ L  +          +  N  +++S + + V P  F F ++      +   
Sbjct: 1184 EDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDPLLFVFTKSLLKEFYSEDM 1243

Query: 1220 ESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVN-ISDETALDKTQLEALDRLELS 1278
              ++D  E+ IV   S  ++  G    S++ +    +N I  ET  +  +L  LDR++  
Sbjct: 1244 VQVLDDIEIGIVKQLS--NLQEGITSISNIDVHIAYMNLIWQETGEEGFEL-YLDRIDYQ 1300

Query: 1279 VSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIFKSSKNRLTKVLPIAW- 1337
            +S  S+            + N ++ + + +T++    +++  + +     L++  P A  
Sbjct: 1301 MSEKSL------------EKNRTSKLLEVATLA-RIKTVRVTVNQKRNPDLSEDRPPALS 1347

Query: 1338 FEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLKLAKAFCKEGKSCIELGK 1397
              +  F     ++  +V+ L   S    I ++ +EW  EY         +   S   +  
Sbjct: 1348 LGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSIQS 1407

Query: 1398 LRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVRDTASWKIITRLRHVSK 1457
             R     E I ++    +   I   PY+ITKPA+I RLSK HVR+  SWKIITRLRH+  
Sbjct: 1408 TRISSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHI-- 1465

Query: 1458 HTSHVSETTSQCDDIPEEVRNICKD---------KSQFLDIFVDWKNWDVYEVEQSSLFT 1508
                    T   DD  + +  + K+         K+ F+ +F  W+NW+  +V +S ++ 
Sbjct: 1466 -------LTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYG 1518

Query: 1509 LLFSGESTVHEEDL 1522
             LFS ++  H+++L
Sbjct: 1519 KLFSVDNAEHKQNL 1532

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/1214 (32%), Positives = 646/1214 (53%), Gaps = 95/1214 (7%)

Query: 1762 VLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNLSGISIIVNY--TELLLDFYFNQLKL 1819
            VLS    ++  +     PF IR     LD  F       ++++   T+  +  +  + + 
Sbjct: 1778 VLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEVLLSIWDTDFFMTSHQTKEQY 1837

Query: 1820 LR-------ISNSVTKVDYRSNTLLTDIGLDTDIVKLTLSDNRVYIEEL-------TDSL 1865
            LR       I   ++K DY     L ++ +   ++KLT S+ R  +          +  +
Sbjct: 1838 LRFSFGDIEIKGGISKEDYS----LINVDISISMIKLTFSEPRRIVNSFLQDEKLASQGI 1893

Query: 1866 NGTVSELIKIFKN--KNADNEPAAPKFKPCSFKMNAIYIGLLTDLKTTNYVLEFNETAFS 1923
            N   S    +F +       + A  +    +   +  Y G+L  + +T +V E +    S
Sbjct: 1894 NLLSSLKSLLFTSGLPKKKKKKAPARMINWTLDTSITYFGILVPVASTYFVFELHMLLLS 1953

Query: 1924 CASRAEAL--EETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIED--D 1979
              +    +  EE             I+N+  L+    +   LSK+ D    +  ++   D
Sbjct: 1954 LTNTNNGMLPEEAKVTGQFS-----IENILFLIKERSLPIGLSKLLDFSIKVSTLQRTVD 2008

Query: 1980 IKKTLQIETPHSRVMLAPSTLIAVI-----------FFIQEAKVSLQKVKQ-KGKFNSSS 2027
             +++ Q+E+ H RV L+P +L+ ++           ++ +    ++  +K   GK   S 
Sbjct: 2009 TEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWDIKMFTGK---SD 2065

Query: 2028 NAIEIPPYFETLSVNILSNKLCLGWIFEEDTDEN-GIVIGYESLFAAYEKPYGKLTIVDG 2086
               EIP  F   S++ILS K C+GW+F+     + G+++GY  LF+AYEK +GK T+VD 
Sbjct: 2066 KPKEIPINFR--SIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDFGKFTVVDA 2123

Query: 2087 YVATAQGKESNNFFF-ANGVPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRIL 2145
            + + A G +S+ FF   N   + NRS L +MQI++WF      KD F R + + LDV  +
Sbjct: 2124 FFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFV 2183

Query: 2146 TTSVEIVNVMRSSIESFQXXXXXXXXXXXXXXXTHN------VAENLSDKVSIL--SIRS 2197
             + +++++    S+ +FQ                 +        E+ S+ ++    +IRS
Sbjct: 2184 PSFMDVIDSTLQSVRAFQELKKNILDVSEDSHMEDDNPYATSSMESASNSLAPFLDNIRS 2243

Query: 2198 INCIAKYGGGIINLYTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNV 2257
            +N   KY GG+  +YT DDI   S + S E+ SP + ++  Y HN    K H IR L+ V
Sbjct: 2244 VNSNFKYDGGVFRVYTYDDIEAKS-EPSFEIKSPVVTINCTYKHNENEAKPHRIRILIAV 2302

Query: 2258 ESTHNILFSSCVPVLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKK 2317
            + T N L++ C P+L+  +  +QK +++ +++ K    K   Q         DYK L  +
Sbjct: 2303 DPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFTKPSSQNV-------DYKRLLDQ 2355

Query: 2318 IDTAIVINVGAQNITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEIS 2377
             D A+ +    Q ++L+CEP+AK+QAD+GF +F  SM T+  D  +PL  SL   + + S
Sbjct: 2356 FDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQTKAS 2415

Query: 2378 TRHIFSREISSSAGINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIW 2437
             RHIFSRE+S+S  +  + L  + TH + I  YG +L+SD+  + N+KQLQ + LFLDIW
Sbjct: 2416 IRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFLDIW 2475

Query: 2438 SPKTKKAQKLGSGPHSGQKCQPQALTEFTT-------PKIPWIYQIIFKNTSAVIDMDPS 2490
                + +  L + P  G   +   ++  T+        +IPW + +IF N S  +D+ PS
Sbjct: 2476 ----RFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFTNVSGDVDLGPS 2531

Query: 2491 LGSINFKVPTFWISSHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVK 2550
            LG I+ +    W+++ H  +    +  + D ++  S+GRL GLFE+ N  + S + W ++
Sbjct: 2532 LGVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLE 2591

Query: 2551 DNKFEAPLINLAFKMSHLSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMS 2610
             +K   PL++ +  +  ++ K  FDYH FLI  ++++Q  + NE+D  G+L DLL VS S
Sbjct: 2592 KSKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFS 2651

Query: 2611 FGSVNIFLTALASANLYDIYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPL 2670
               + +  TAL +AN+ DIY T  RMR +NK SY++TL++SNP  S +     + L +  
Sbjct: 2652 SDEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLK 2711

Query: 2671 RLRTNLTAEIGSFRLYVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINI 2730
             LRT+L+  I S ++ + P +LFD EVLV++   +++ + T + +K KTDL  Q+ D++ 
Sbjct: 2712 LLRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSA 2771

Query: 2731 SLAQFKNELTEEQFAELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYS 2790
            +L+  K EL EE  A +++++Y   A+ + G  I+  P + V +TT Q+    +IE+L++
Sbjct: 2772 ALSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFA 2831

Query: 2791 SSFGDKVDIKWNLDPINFIREMWATHVRALSVRR--------GHTEPSPSKPFFEDENIA 2842
             SF DK+ +KWNL P+NFI+EMW THV+AL+VR+        G TE          E + 
Sbjct: 2832 CSFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQTE----------EELE 2881

Query: 2843 EKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQ 2902
            E IK     +K+ YI LEEP I++P +RDLG+ATPP+EWFGVNRKRFP   HQ  V+P+Q
Sbjct: 2882 ESIKTKETTSKFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNRKRFPKFTHQTAVIPVQ 2941

Query: 2903 KLIYVAEDQYNRTL 2916
            KL+Y+AE QY + L
Sbjct: 2942 KLVYLAEKQYVKIL 2955

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/1576 (30%), Positives = 809/1576 (51%), Gaps = 90/1576 (5%)

Query: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60
            MD+ S F+ I ++ +KD S  FLVDWIL +I+ +   FYL R LA+ ++  L++++W++ 
Sbjct: 1    MDAISQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRS 60

Query: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120
             +KIN++SI++S LGGR+FFKN+ ++  D+TISFLE + TWRYWLL+ R  G D      
Sbjct: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGYDTPELPD 120

Query: 121  DASENA-KLPCRFLLQCDGLEVFVYNKIDVYESVLRDHFTNVTKDGQETESNDDITINTE 179
             AS N+ KLPCRF L+ +GLE+FVYN+   Y++++   F+   ++  E   N+ +  +++
Sbjct: 121  KASANSVKLPCRFFLEFEGLEIFVYNRGVAYDNII-GQFSKEERNQFEKFLNEQVFTDSK 179

Query: 180  XXXXXXXXXXXXXXXXXXXXXXTDAP---------KLSAKTKLF---PIQLEANRAAIVL 227
                                  +D+          +LS + +     PI  + +  ++++
Sbjct: 180  AEVSNSESNSEEDTFESAGTFKSDSSTTNDRVFQEELSERPQFLDFLPIDFKVSHGSLII 239

Query: 228  GNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIK 287
            GN+ T  + +       G+ D+      LD Y+ +  LD      +++ N+G+  +  +K
Sbjct: 240  GNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIKQNIGFNEEFSMK 299

Query: 288  TFVVEKTMDKIWQTVKK---QCISISKLLLPNQGKTINNQQAYIDSWKGLDLYHHT---K 341
              +    + K+WQ   K    C S  KL      K ++ +  + + W+GL LY  T   K
Sbjct: 300  FKIDRNRVSKMWQQFNKVLLTCYSHMKLSHLRSNK-VSEEDPFYEKWRGLSLYRGTIFGK 358

Query: 342  AVQEENVDTTVLHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNC 401
            +  + N         EYA++S +++  +   T+  DIPGIVP  +    + +D  +  N 
Sbjct: 359  SNDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAHPTLTATDGPDVGNS 418

Query: 402  NQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYE 461
                  P F  +I I   ++ +GPWA + +  +IRL SPI SR+     +  PG  RIY 
Sbjct: 419  GA---PPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTKRLTPGCTRIYT 475

Query: 462  NFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLAL 521
             FK ++   +++   IPTRESSKD EF++ Y+ T + +R FGW+++  ++   I   +A 
Sbjct: 476  QFKTTISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFSKDTYICSTVAQ 535

Query: 522  CSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSR 581
            C   +   N L + L + EI+SSVNH++L +C +     +IG+P GWN++A W  +L+S 
Sbjct: 536  CPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNEEATWTIDLEST 595

Query: 582  TAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFXXXXXXXXXXX 641
              E F+LR+HI+LI+D  TDFS+ +   YELFRPF Y I W    Y L+           
Sbjct: 596  QLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLYLNVNDHNIVNN 655

Query: 642  XXXXXXXCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFL 701
                   C+LS  GDIL   + +P   +     E ++ + +P+ +L ++ P WNTL+EF+
Sbjct: 656  PLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLNTPPWNTLNEFM 715

Query: 702  SETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYF 761
                 G   DF +TG+Y+ +  +D+DN DTI+I+  S ST    +GFV+RYL N+K+NYF
Sbjct: 716  KNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVIRYLTNVKMNYF 775

Query: 762  GDFNHFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQV-ADTINENT 820
            GDF HF T+EEY+ ++   E    + +    Q   D  SL+S  S  +  V  +   ++ 
Sbjct: 776  GDFFHFVTSEEYTGEIRANE---VQNQFTDRQLYEDKASLSSYESIETSSVRKEQTGDSK 832

Query: 821  IHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLT 880
            I +S L R  NETD+W TF V +G I++PE +Y+C     L F  L  D R  NY+MDL 
Sbjct: 833  IKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELLIDFRSCNYYMDLL 892

Query: 881  AFFS----RIYLNHSNEFSFNRVVAIEESHSENTGYLDDLNLHGHRMFGVPPVEETYLCK 936
            A  +    R Y+       +  V       ++  G L D+ +H HRM+G+PP+E TY C+
Sbjct: 893  ASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRMYGLPPLEPTYFCQ 952

Query: 937  WDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVTSLTISIGRVSS 996
            WD S+G+L  + D  FL  F+ +  K+ F   D ENIL+Y     +D+TSLT+ + ++S 
Sbjct: 953  WDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDDMTSLTVDVKKISI 1012

Query: 997  IVRTNHGGSATL-SLNDITINSWDLSNSRYSKRVDLLVAAISVCAI---DEKKTVLFTCD 1052
            ++R +   +  L +  ++  ++ +  N +Y  R+DL +   ++        KK  LF  +
Sbjct: 1013 MIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYTMNGAKKEKLFEFE 1072

Query: 1053 TAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLYDDLLGSITPS 1112
            T V L+ F   +++  H+  QQ  + L+D+P+HRC F+L    L  S +Y DL GSI PS
Sbjct: 1073 TKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILP-PSLQDSEIYQDLFGSIAPS 1131

Query: 1113 ISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDIIDTKNXXXXXXXXXXXXXXSNTVS 1172
             SLP L  PL   T D I + LLG +        +I++++N               N   
Sbjct: 1132 SSLPPLPIPLLPATIDYIVDDLLGCF-------PEILESENPFRIPFSPATSPKLGNPFE 1184

Query: 1173 N----------------DLSGQLAEEFESENTTVNISTLSVFVTPKAFTFAENAAHFMLT 1216
                             + SG  +E F S+N  ++IS  S+ + P+ +++ +N      +
Sbjct: 1185 GSDTESDEELDPLEFKTETSGD-SETFASDNFVIDISYCSLSINPRLWSYLDNCREHFCS 1243

Query: 1217 MSTESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISDETALDKTQLEALDRLE 1276
                 I+D  E+ IVN  S   +  G     ++ L+ + +++      +      LDR++
Sbjct: 1244 QDIVQILDDIEIGIVNHLS--DLQEGIETARNIKLQILYLDLFWGDRQNAGISLYLDRID 1301

Query: 1277 LSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIFKSSKNRLTKVLPIA 1336
            L +             Q + + N  T IT+ + ++    S++  I ++S        P A
Sbjct: 1302 LEMC------------QKMLEENNETKITEVTFLN-KIRSVRATINEASSVGKADERPPA 1348

Query: 1337 WFEILMFNTVLFSDV--GKVSKLIFGSIKSAILDADVEWTVEYLLKLAKAFCKEGKSCIE 1394
               +++  + ++S +   +V+ L   S    I +A ++W  +Y+ K      +   +   
Sbjct: 1349 -LSLVIEGSEIWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQS 1407

Query: 1395 LGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHVRDTASWKIITRLRH 1454
            + + RS   K+ + ++A   +   I   PY+ITKPA+ITRLS+ HVR+  SWKIITRLRH
Sbjct: 1408 IQESRSTTRKQLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRH 1467

Query: 1455 VSKHTS-----HVSETTSQCDDIPEEVRNICKDKSQFLDIFVDWKNWDVYEVEQSSLFTL 1509
            +  +        + E  +Q D        +    + F+ +F +W+NW+  ++ +S ++  
Sbjct: 1468 ILTYLPIDWLRVIDEMRNQQDS-----HTLPDPGNAFISVFSNWRNWEFSDIARSYIYRN 1522

Query: 1510 LFS-GESTVHEEDLFN 1524
            +FS G S   E  + N
Sbjct: 1523 MFSEGHSKKQENSMEN 1538

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/1193 (32%), Positives = 651/1193 (54%), Gaps = 60/1193 (5%)

Query: 1762 VLSLKVGSLQLQTSAFVPFIIRILISGLDFNFKNLSGISIIVNY--TELLLDFYFNQLKL 1819
            VL+    ++ L+     PF  R     LD  F  L    ++++   T+L L  +  + + 
Sbjct: 1782 VLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWDTDLFLISHLTKEEY 1841

Query: 1820 LRISNSVTKVDYRSNTL-----LTDIGLDTDIVKLTLSDNRVYIEELTDSLNGTVSEL-- 1872
             R S     +  + N L       +I +   IVKLTL D R  I          +  L  
Sbjct: 1842 FRFS--FGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFLQDEKILIESLEQ 1899

Query: 1873 ---IKIFKNKN-ADNEPAAPKFKPCSFKMNAIYIGLLTDLKTTNYVLEFNETAFSCASRA 1928
               +K+F+ K  A +   + +    S + N  Y GLL  + +T ++LE +    S     
Sbjct: 1900 FSSLKLFQRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILELHMLLMSL---- 1955

Query: 1929 EALEETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIED--DIKKTLQI 1986
              ++   +  N       I NVC L+    +   LSKI D    +  ++      ++ QI
Sbjct: 1956 NKIQGISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTLQKLKVTPRSFQI 2015

Query: 1987 ETPHSRVMLAPSTLIAVIFFIQEAKVSLQKVKQKGK--------FNSSSNAIEIPPYFET 2038
            E+PH RV L+P +L  +++   +A  +++  K+           F +++N+ E+   F  
Sbjct: 2016 ESPHFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSVAWEKVINFKNTNNSAEVQADFP- 2074

Query: 2039 LSVNILSNKLCLGWIFEEDTD-ENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESN 2097
             S ++LS   C+GW+F  + D E G++IGY  LF+AYEK +GKLT++D Y + A GK S+
Sbjct: 2075 -SFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGKLTLIDAYFSVANGKTSD 2133

Query: 2098 NFFF-ANGVPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMR 2156
             FF   +     NRS+L +MQI++W   + + +D+++R + + LDV  L + ++++    
Sbjct: 2134 TFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEALDVNFLASFIDVIESSL 2193

Query: 2157 SSIESFQXXXX-XXXXXXXXXXXTHNVAENLSDKVS--ILSIRSINCIAKYGGGIINLYT 2213
             SI+ FQ                T +  +     +S     IRSINC  +Y GG+  +++
Sbjct: 2194 ESIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDISPFFTGIRSINCQFQYDGGVFKVFS 2253

Query: 2214 PDDIAQDSPKSSLELTSPSIEVSLDYMHN-FPSQKQHWIRSLVNVESTHNILFSSCVPVL 2272
              + A +  K S E+ SP++ + ++Y +N   +Q   WIR+L+ + STHN LF+ C P++
Sbjct: 2254 SAE-ASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLITINSTHNTLFAKCAPLI 2312

Query: 2273 VNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNIT 2332
               +  IQK ++R +S++       +   TN  + + DYK +    D A+ +    Q ++
Sbjct: 2313 AEFSEGIQKMVKRHSSDR-------EPSGTNISKQNIDYKRMLDSFDVAVEVISAKQLLS 2365

Query: 2333 LTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGI 2392
            L CEPRAK+QAD+GF +F  ++ T+  D  EPL  +L   + E S +HIFSRE S+S G+
Sbjct: 2366 LCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFSREASTSFGV 2425

Query: 2393 NEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLGSGP- 2451
            + + L  M TH N+I   G  LISD+  + N+KQLQ + LFLDIW    K +  L S P 
Sbjct: 2426 DFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIW----KLSNLLNSKPM 2481

Query: 2452 ------HSGQKCQPQALTEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISS 2505
                   +  K      ++ T   IPW + +IF N +  +D+ P+LG ++      W ++
Sbjct: 2482 NEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKRTWFAT 2541

Query: 2506 HHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKM 2565
             H       +  Y   +   S GRL G+ E+    + S ++WP+ +N  + PL++++  +
Sbjct: 2542 DHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVSISLNI 2601

Query: 2566 SHLSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASAN 2625
              + +K+ FDYH FL+  ++++ + I +E+D +G+  DLL V++   ++ +  TAL +AN
Sbjct: 2602 DRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTALVAAN 2661

Query: 2626 LYDIYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRL-RTNLTAEIGSFR 2684
            + DIY T  R+R +NK SY++TLKESN  S  +      ++L  L L +T+++ +I +  
Sbjct: 2662 ILDIYNTVMRLRQDNKISYIETLKESN-TSEPRQALDYKDILRSLNLIQTDVSVDIYTLN 2720

Query: 2685 LYVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQF 2744
            + + P +LFD+E+LV+    ++  + T    K KT+L  Q+ D +++L+  K EL E+  
Sbjct: 2721 IQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEELDEDII 2780

Query: 2745 AELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLD 2804
            A +SVE+Y   A  + G +I+ AP + + +TT+QK     +E+LY+ SFGDK+ ++WNL 
Sbjct: 2781 ATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVRWNLG 2840

Query: 2805 PINFIREMWATHVRALSVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHI 2864
            P+NFI+EMWATHVRA++VRR   + +       +E++ ++IK     ++++Y+PLEEP I
Sbjct: 2841 PVNFIKEMWATHVRAMAVRRSQIDVTFGP--VSEEDVGKRIKKEEEFSRFQYVPLEEPRI 2898

Query: 2865 EMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917
            +MP +RDLG+ATPP+EWFG+NRKRFP   HQ  V+ +QKL++ AE +Y   LG
Sbjct: 2899 DMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVILVQKLVHTAEKEYGSILG 2951

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 504/1573 (32%), Positives = 792/1573 (50%), Gaps = 105/1573 (6%)

Query: 2    DSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQYK 61
            D+ S F  IS+   KD S  FLVDWIL +IL I   FY+GR +AW ++   ++ +W++Y+
Sbjct: 3    DTVSQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYR 62

Query: 62   IKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGI--DFESED 119
            +K+N++S++VS LGGRIFFKNLT++  D+TISFL G  +WRYWL   RI     +  +ED
Sbjct: 63   LKVNIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTELNAED 122

Query: 120  GDAS---ENAKLPCRFLLQCDGLEVFVYNKIDVY---------------ESVLRDH-FTN 160
             D +    N KL CR LL+C+G+E+F+YN+   Y               E  L +H FT+
Sbjct: 123  DDGASLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNEHVFTD 182

Query: 161  -------VTKDGQETESNDDITINTEXXXXXXXXXXXXXXXXXXXXXXTDAPKLSAKTKL 213
                        +E+++ D++ I +                            L      
Sbjct: 183  RASTESSNGSSSEESKAQDEVEIKSYTESSFDESNESQMANDRIFHDEETGKNLFLN--Y 240

Query: 214  FPIQLEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFE 273
             P+Q++ + A+ V+GN+ T  + +   + A+GV D       LD Y+TK+++D  +    
Sbjct: 241  LPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKNVSVS 300

Query: 274  LRTNLGYQNDNPIKTFVVEKTMDKIWQTVKKQCISISKLL-LPNQGKTINNQQA-YIDSW 331
            L+ N+GY  +  +K  +    + K+W    K    + K L L  + K   +  A +   W
Sbjct: 301  LKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGLSRKKKNRPSVTANFHQKW 360

Query: 332  KGLDLYHHT--KAVQEENVDTTV-LHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSS 388
            +GL LY +   + VQ +  D    L   EYA+++ ++K  R  LTY FDIPG VP  +  
Sbjct: 361  RGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGFVPHGAHP 420

Query: 389  INSQSDRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMK 448
              S  D  +  N   +   P FG +I ++  ++ YGPWA + +  I  L +P +SRDQ K
Sbjct: 421  TLSSIDGPDIGN---NGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISRDQ-K 476

Query: 449  ATKP-EPGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNV 507
              KP +PG  R+Y  FKL +   +     IPTRESSKD EF++ YK T + +R FGWL++
Sbjct: 477  PVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGWLDL 536

Query: 508  SLNEGGEILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTG 567
              ++     FN ALCS AD   N + + L + EI+SSVNH++  +  +     N+G+P G
Sbjct: 537  KFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGFPLG 596

Query: 568  WNKQADWLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEY 627
            WN++A W   + S   E FLLR+HI+LI+D  +DFS  +   YELFRPF Y I W    Y
Sbjct: 597  WNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKLDGY 656

Query: 628  KLFXXXXXXXXXXXXXXXXXXCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKL 687
             ++                  C+LS  GDILN  I +P   I     + ++ + +P+ +L
Sbjct: 657  SIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPMFRL 716

Query: 688  SIHPPCWNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFG 747
             ++ P WNTL+EF+     G   DF  TG Y+ +  +DVDN D I I   S ST    +G
Sbjct: 717  MLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLHCYG 776

Query: 748  FVLRYLMNIKLNYFGDFNHFKTTEEYSNDLSMEEDTKTKTKNFQE----QPTNDVESLTS 803
            FV+RYLMNIK+NYFGDF HF T+EEY+  +S        +K + E    +  +D  S   
Sbjct: 777  FVIRYLMNIKMNYFGDFFHFVTSEEYTEKIS--------SKGYGEGSLFEKYSDDASTFV 828

Query: 804  SSSDGSYQVADTINENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSF 863
            S  D + +  D +       + + R  NETD+W+TF + +G +++PE +Y+C     L F
Sbjct: 829  SDFDKNNEEDDKVKVPR-GPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDPCIALHF 887

Query: 864  RRLEFDMRYTNYFMDLTAFFSRIYLN-----HSNEFSFNRVVAIEESHSENTGYLDDLNL 918
              L  D+R TNY+MDL A    I L        NE  F  V        +   Y+ ++N+
Sbjct: 888  GELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEI-FENVRQCNGRDVKGHSYISNINI 946

Query: 919  HGHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSI 978
            HGHRM+G+PP E TY CKWD  +G++  +S+  F+   + + QK+GF + D EN+L+Y  
Sbjct: 947  HGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENVLLYEK 1006

Query: 979  HKPEDVTSLTISIGRVSSIVRTNHGGS-ATLSLNDITINSWDLSNSRYSKRVDLLVAAIS 1037
               +D+T++T+++     I+      S A L LN++   + D  N +YS R+D+ +  + 
Sbjct: 1007 EVVDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIRIPLLK 1066

Query: 1038 VCAID-----EKKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLA 1092
            +          K+   F  +T +  T F    N   HR  Q++ + +ND+PFHRC F+L 
Sbjct: 1067 LSLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRCGFILP 1126

Query: 1093 FDQLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDIIDTK 1152
                N S +Y  L GSI PS SLP L  PL  +TF+ I +  L  Y N  + D  I++  
Sbjct: 1127 ASYQN-SVIYQKLYGSIVPSSSLPPLPLPLLEETFEFIIQDFLHEY-NTTS-DCIILNLP 1183

Query: 1153 NXXXXXXXXXXXXXXSNTVSNDLSGQLAE-----EFESENTTVNISTLSVFVTPKAFTFA 1207
                            +T  + LS  +       E E +N  ++   +S+ + P+ F + 
Sbjct: 1184 YPDSTNLNSDSFNSYPDTAPHTLSDTIIRKSPLPEDERDNYVIDFRYISISIDPELFFYI 1243

Query: 1208 ENAAHFMLTMSTESIMDYFEMNIVNIFS-----VGHITNGKFFNSSVMLKNVKVNISDET 1262
            E   +         ++D  E+ +V   S     +  I N   F   ++  +V     D  
Sbjct: 1244 EKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINN---FKIRILFFDVFWGQRDTG 1300

Query: 1263 ALDKTQLEALDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNIF 1322
             ++      LD L+  ++  S+            + N    +T+ +T+    +S++ ++ 
Sbjct: 1301 GIEL----YLDTLDFEMNEKSI------------EKNREKSLTEVTTL-MKLNSIRASVN 1343

Query: 1323 KSSKNRLTKVLPIAWFEILMFNTVLFSDVGK--VSKLIFGSIKSAILDADVEWTVEYLLK 1380
                   T+  P A   +++     +S   K  ++ +I  SI + I +  V W   +   
Sbjct: 1344 AKYSRGKTEGQPPA-LSLMVEGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGD 1402

Query: 1381 LAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSKFHV 1440
              +      K+  ++ KLR+   KE I R+    +   I   PY+ITKPA+ITRLS+ HV
Sbjct: 1403 QKELIGSVVKTFEKVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHV 1462

Query: 1441 RDTASWKIITRLRHVSKH-TSHVSETTSQCDDIPEEVRNICKD-KSQFLDIFVDWKNWDV 1498
            R+  SWKIITRLRH+  +     +ET ++   + E   N  KD KS F+ +F  W+NW+ 
Sbjct: 1463 RENRSWKIITRLRHIMTYLPDDWNETVAK--QLKERKYNASKDAKSIFMSVFSSWRNWEF 1520

Query: 1499 YEVEQSSLFTLLF 1511
             +V +S ++  +F
Sbjct: 1521 SDVARSYIYNKVF 1533

 Score =  600 bits (1547), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 400/1250 (32%), Positives = 655/1250 (52%), Gaps = 97/1250 (7%)

Query: 1739 DDMKAITPDHDSEKKNGH-------VDLVWVLSLKVGSLQLQTSAFVPFIIRILISGLDF 1791
            DD+   TP +DS K           VDL +       SL +     VPF  R     ++F
Sbjct: 1772 DDLPKPTPTNDSPKPTPTKINPFLLVDLDFTCFFSNVSLDIM--PIVPFQFRQETKKMEF 1829

Query: 1792 NFKNLSGISIIVNY--TELLLDFYFNQLKLLRISNSVTKVDYRSNTLLTDI---GLDTDI 1846
             F +    +   N   ++L L  +  + +  R+S     V Y +  L+  I    +   I
Sbjct: 1830 KFSSQRTQNFQFNIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSASI 1889

Query: 1847 VKLTLSD-NRVYIEELTDSLNGTVS-ELIKIFKNKNADNEP---AAPKFKPCSFKMNA-- 1899
            VKLT S+ +R+    L D    + S + +++  N  + +EP     P      +++NA  
Sbjct: 1890 VKLTFSEPHRMLFSFLQDEREVSRSVKKLQVLGNLFS-SEPEINTIPAGAKIDWRLNADI 1948

Query: 1900 IYIGLLTDLKTTNYVLEFNETAFSCASRAEALEETHANDNLREMSLVIQNVCILVLNPEV 1959
             Y+G+L  + TT +V E +    S A          A++   ++S  + N+  L+ +  +
Sbjct: 1949 KYLGILIPVSTTFFVFEMHTLLASLADVDYGEIYREADEASGQVS--VDNILFLIKDRTI 2006

Query: 1960 LPTLSKIFDIGFALKLIEDDIKK--TLQIETPHSRVMLAPSTLIAVIFFIQEAKVSLQKV 2017
              TLS+I D+ F +  I+  ++   + QIE+PH R   +P +L+ +++        L  +
Sbjct: 2007 PSTLSRIIDLSFKISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILW----GGHQLLAL 2062

Query: 2018 KQKGKFNSSSNAIEIPP-------------YFETL---SVNILSNKLCLGWIFEEDTD-E 2060
                + + S N  +  P             +F TL   S +ILS   C+GW+F+ + D +
Sbjct: 2063 HSHYRRHHSKNLWDFLPKKEKKVEEDKTTSFFSTLTFGSCHILSYNFCVGWLFQNNGDTD 2122

Query: 2061 NGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFF-ANGVPELNRSHLSSMQIN 2119
             G+++GY  LF+AYEK  GKLT+VD + + + G+ S+ F+   N   + NRS L ++QI 
Sbjct: 2123 AGLILGYNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQII 2182

Query: 2120 FWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQXXXXXXXXXXXXXXXT 2179
            +W       KD+F+R++ + LDV  L++ V+I+     SI+ FQ                
Sbjct: 2183 YWLKAAAEMKDVFIRLHGETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQSEAR 2242

Query: 2180 ----------------------------HNVAENLSDKVSILSIRSINCIAKYGGGIINL 2211
                                         ++A  LSD      IR +NC  KY GGI  +
Sbjct: 2243 SEEEEEESEEHNRRETVPGKEKKEDAPRKDIAPFLSD------IRKVNCQFKYDGGIFKV 2296

Query: 2212 YTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPV 2271
            Y+ +DI + +   S E+ SP + + LDY +N    K H IR+L+ V STHN+LF+ C P+
Sbjct: 2297 YSFEDI-ESNLDPSFEIRSPGVTIDLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPL 2355

Query: 2272 LVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNI 2331
            L+ L+ +IQ  +++ +S+KK      Q  +  +Q I  DYK L    D    I    Q +
Sbjct: 2356 LMALSQDIQHMVKKHSSKKKP--EPKQRVSRPSQNI--DYKRLLNSFDILFKIISSEQKL 2411

Query: 2332 TLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAG 2391
            +L+CEP+AK+QA++GF +F  ++ T+  D SEPLS +L       + RHIFSRE S+S G
Sbjct: 2412 SLSCEPKAKVQANVGFDSFMFAILTNDLDTSEPLSFALVVKNTRSAIRHIFSREPSASFG 2471

Query: 2392 INEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKT---KKAQKLG 2448
            ++ + + FM TH N I  +G  LISD++ Y N+KQLQ + LFLDIW        K  K  
Sbjct: 2472 LDLIDVTFMFTHPNIINMFGACLISDVEVYFNVKQLQNLYLFLDIWKLSNLLRPKPMKKP 2531

Query: 2449 SGPHSGQKCQPQALTEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHR 2508
               H      P +  +     IPW + +IF N +  +D+ PSLG ++  +   W +S H 
Sbjct: 2532 EDHHVAIDAPPSSPMDVGN-IIPWCFTLIFANINGKVDLGPSLGLLSLSMRKAWFASDHY 2590

Query: 2509 VDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHL 2568
                  +  Y+D++   + GRL G+ E+    + + ++WP  D+ +  PL+ L+F +S++
Sbjct: 2591 ESKRQLLHAYIDQIKLTAKGRLSGIVELDGALWAAEVNWPKYDDPY--PLVALSFVISNI 2648

Query: 2569 SSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYD 2628
            S K+ FDYH FLI  V +    + +ERD SG + DLL V ++   +++  TAL +ANL D
Sbjct: 2649 SLKVAFDYHMFLIGTVLNTVFHLHSERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLD 2708

Query: 2629 IYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRL-RTNLTAEIGSFRLYV 2687
            +Y T  RMR +   SY++TL+ESN  +  K      ++L  L L +T++  +I +  + +
Sbjct: 2709 LYNTIMRMRQDTNVSYLETLRESN-TTDTKETVDYKDILKVLNLIQTDVVVDINTLNVQI 2767

Query: 2688 FPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAEL 2747
             P +LFD EVLV+    +     T   +K +T L  Q+ + + SL+  K E+ E+  +++
Sbjct: 2768 SPISLFDVEVLVVNIANVCANVKTHAGEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKI 2827

Query: 2748 SVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPIN 2807
            SVE+Y   A+ + G  I   P + + + T+QK     +E+ Y S+FGDK+ ++WNL P+N
Sbjct: 2828 SVEDYMVYASKIVGGTIFDIPKLEISMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVN 2887

Query: 2808 FIREMWATHVRALSVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMP 2867
            FI+EMW TH++AL+VRR  +    +    E+ ++ ++++     +K  YI +EEP I+ P
Sbjct: 2888 FIKEMWTTHIKALAVRRSQSLVGTTGD--EEGDVEKRMRDEETLSKLTYIAIEEPQIDTP 2945

Query: 2868 LLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917
             ++DLG+ATP +EWFG+NRK+FP   HQ ++VP+QKLI+ AE +Y   +G
Sbjct: 2946 QIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEKEYANIVG 2995

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/1555 (31%), Positives = 784/1555 (50%), Gaps = 95/1555 (6%)

Query: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60
            MD  + F  I +  E+     FLV+W   +++ +   FYL R + +++TK L++ +W++Y
Sbjct: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60

Query: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120
            K+ IN+QS+  S +GG+++FKN+++   D TIS L+G+FTWRYWLL+ R   +   S   
Sbjct: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLK-NSNIN 119

Query: 121  DASENAKLPCRFLLQCDGLEVFVYNKIDVYESVLRDHFTNVTKDGQETESNDDITI---- 176
            D  EN+K  CRF L+CDG+E+F+YNKI VYE +L +      KD     + DD +I    
Sbjct: 120  D--ENSK--CRFKLECDGVELFIYNKIAVYEDILNE-LAKSDKDSSRKFATDDESIFGRV 174

Query: 177  NTEXXXXXXXXXXXXXXXXXXXXXXTDAPKLSA---KTKLFPIQLEANRAAIVLGNRNTR 233
             T+                            SA        P ++  +  A+V+GN++T 
Sbjct: 175  KTDSSVMFDPLDESSEQSKVGQTILNSVSNQSAVPLYLDFLPAEVILSSGAVVVGNKHTP 234

Query: 234  HVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTFVVEK 293
             V + ++ + +G+ D+    S+LD Y+ +   +L      ++ N+ + N +  K   ++ 
Sbjct: 235  SVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSVKPNISFGNGSSSKKHKIDG 294

Query: 294  TMDKIWQTVKKQCI--SISKLL-LPNQGKTINNQQAYIDSWKGLDLYHHTKAVQEENVDT 350
                +WQ +K  C+  +IS +L      K +  Q+ ++ SWKGL +Y    +    +   
Sbjct: 295  KPFNLWQKLK-DCLLFTISHILAFTGNKKGLTGQEEFLTSWKGLAMYDVATSDTFSDEIP 353

Query: 351  TVLHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQDDDTPAF 410
              L   EYA+Y+ ++ A+R+ L Y +D PG++           D   S         P +
Sbjct: 354  FDLQNHEYAKYTTILNADRIKLLYSYDTPGVITETLIKGYENGDIPPS---------PEY 404

Query: 411  GTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSVDFR 470
              D+ +Y A  YYGPWAH+ +Q  I++FSP VSRD     KP  G  R + NF+  +   
Sbjct: 405  SIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAHRKPVLGKSREHANFRCEIVIM 464

Query: 471  DKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQADRLPN 530
            + SV  IPT+E SKD  F+ +YK+T D  RAFGW+++ LN+   I   L L +      N
Sbjct: 465  EDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKLNKDTNISIELGLQASECGFEN 524

Query: 531  ELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAELFLLRD 590
              +  L+NP I +SVNH+VLF      I A   YP  WN    W     S   ELF+LRD
Sbjct: 525  TFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWNSAITWALHFISSDLELFILRD 584

Query: 591  HISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFXXXXXXXXXXXXXXXXXXCF 650
            H +L+ DLFTDF++ DA+ YELFRP  Y+  W  + Y L+                  C+
Sbjct: 585  HFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSLYLNANDANIVNNPLDFNENCY 644

Query: 651  LSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFGECP 710
            +S+ G+     + LP  +I +E    ++ + +P   + +  P W+TLHEF+++   G   
Sbjct: 645  ISIHGNSARIGVKLPIETISEESITISYEIYTPKFDIQLKTPPWHTLHEFMAQRFVGRSH 704

Query: 711  DFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHFKTT 770
            +FS +G+Y+S+  VD+DN DTI ++ +++   FL++GF+LRY+MN+KLNYFG+F  F+TT
Sbjct: 705  EFSASGSYLSYNDVDIDNVDTINLECKTNHATFLAYGFLLRYVMNLKLNYFGEFAQFRTT 764

Query: 771  EEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDGSYQVA--DTINENTIHKSSLLR 828
            EEYS +L+   D  T   N      ND +  T      SY  +  D ++   I K+SL R
Sbjct: 765  EEYSEELAQRNDVATDIFN-----NNDDDQTTELVEPNSYGESGFDILHGKKIDKASLKR 819

Query: 829  TKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLTAFFSRIYL 888
            T NE D+W+TFF  DGC ++PE+ YD +  F L F  + FDMRY +Y+ DL    +  Y+
Sbjct: 820  TVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFDMRYLSYYADLAFSMNSTYI 879

Query: 889  NHSNEFSFNRVVAIEESH----SENTGYLDDLNLHGHRMFGVPPVEETYLCKWDISIGSL 944
                + S N V  +  S+    S   GYL + N+H HRMFG+PP EETYL K D+S+G L
Sbjct: 880  KRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFGLPPAEETYLFKIDVSLGYL 939

Query: 945  STDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPEDVTSLTISIGRVSSIVRTNHGG 1004
            S +SD + L  F++ I K  F + + E++L Y + +  D++ L+     +S  +R N+  
Sbjct: 940  SFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDISCLSFFADDIS--IRLNNID 997

Query: 1005 S---ATLSLNDITINSWDLSNSRYSKRVDLLVAAIS--VCAIDEKKTVLFTCDTAVELTK 1059
            +    +LS+ ++++   D   S+YS R ++ +      V ++D+   VL T  T++    
Sbjct: 998  TNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSMDDHNIVLGTISTSISFAI 1057

Query: 1060 FVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLYDDLLGSITPSISLPTLS 1119
            F    + K     Q   +LL+D+PF RC FL    +   S LY  L  SI PS S+P L 
Sbjct: 1058 FSRNPDFKTTNNLQTQHILLSDAPFCRCSFLHP-QEYQTSDLYKLLYASIPPSSSIPLLP 1116

Query: 1120 EPLTFQTFDNIYERLLG----SYINLINFDTDIIDTK-----NXXXXXXXXXXXXXXSNT 1170
            EP+    FD I+E LLG     YI+   FD    DTK     +              +  
Sbjct: 1117 EPIGPNNFDTIFENLLGDIYQDYISEGTFDIS-NDTKLQLNIDEFKKHSENSFSKHKTKN 1175

Query: 1171 VSNDLSGQLAE------EFESENTTVNISTLSVFVTPKAFTFAENAAHFMLTMSTESIMD 1224
            ++ D+  +L E      E    N  ++I  L VF          +    + T +    +D
Sbjct: 1176 LTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFA---------DLYRQLTTFTISDTID 1226

Query: 1225 YFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISDETALDKTQLEALDRLE-LSVSNIS 1283
               ++IVN FS        FF +S + +   V    +  L   +  AL+ ++   VS+I+
Sbjct: 1227 GLGVDIVNNFS------KTFFGASSVTEAKVVCPRIDFRLRMYEYYALEDVKHYFVSDIN 1280

Query: 1284 VISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFN---------IFKSSKNRLTKVLP 1334
             +   L+  Q  ++ + ++ +   + +S  + +   N         I+ S  +  +    
Sbjct: 1281 KLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYPSESSEFSYKST 1340

Query: 1335 IAWFEILMF-NTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLLKLAKAFCKEGKSCI 1393
                E   F +  L +D       +F  I     D+  E+     LK    F K     +
Sbjct: 1341 FEELEGYAFYDDDLVTDANLQRGCVF--INQEHSDSISEFIKTLYLKF-NTFIK----SV 1393

Query: 1394 ELGKLRSIDMKETII-RVAELGKISGIDSVPYIITKPAYITRLSKFHVRDTASWKIITRL 1452
             + K  +  MK  ++ R+A+ G+  GI   P +ITKPA ITRLS+ HVR++ SW+I+TRL
Sbjct: 1394 TISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRESRSWRIVTRL 1453

Query: 1453 RHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQFLDIFVDWKNWDVYEVEQSSLF 1507
            RHV  +       T+  +    + R+    K QFLDIF  W++W+  +VE+  L+
Sbjct: 1454 RHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVERCFLY 1508

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/1201 (37%), Positives = 682/1201 (56%), Gaps = 69/1201 (5%)

Query: 1760 VWVLSLKVGSLQLQTSAFVPFIIRILIS----GLDFNFKNLSGISIIVNYTELL-LDFYF 1814
            + ++ + + ++ +Q    +PFI+R         +DF     S +S+     ELL L+F  
Sbjct: 1767 IAMVKMNIAAINIQLQLLLPFILRYSCKEFEINVDFGRILQSSLSLQDTSVELLSLEF-- 1824

Query: 1815 NQLKLLRISNSVTKV---DYRSNTLLTDIGLDTDIVKLTL----SDNRVY---IEELTDS 1864
             Q   ++ S+S  K+   D  +   L  I LD+   KL++     + R++   IE+   +
Sbjct: 1825 -QEPYMKYSHSYLKLIGMDLGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSDIEQAVKN 1883

Query: 1865 LNGTVSELIKIFKNKNADNEPAAPKFKPCSFKMNAIYIGLLTDLKTTNYVLEFNETAFSC 1924
            +    S +++  K+    NE    +  P    +N  YIGLL D  TT YVLEFN   FS 
Sbjct: 1884 IEILRSTMLET-KSSTVQNEFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSF 1942

Query: 1925 A---SRAEALEETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIEDDIK 1981
            +   + +  +  T ++D   E      ++C L+ +  V  TLSK+ D    +K+I   + 
Sbjct: 1943 SKDKTSSNPVVPTFSSDYSSE------SICFLIKDRRVKETLSKVLDFSLRIKVIRSSLL 1996

Query: 1982 --KTLQIETPHSRVMLAPSTLIAVIFFIQEAKVSLQKVKQ--KGKFNSSSNAIEIPPYFE 2037
              ++LQIE+ +   +L+P +L+ ++ F+ E  + ++ +    K +  SS++ + I P   
Sbjct: 1997 AIQSLQIESSYLHAVLSPMSLVRLLSFVNEFSI-MKSIYHDIKPRSTSSNSTLSILP-IS 2054

Query: 2038 TLSVNILSNKLCLGWIFEEDTDEN-GIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKES 2096
              S +ILS  LC+GW+F+   + N G++ GYE LFA Y+KPYGKLT++D Y + A G  S
Sbjct: 2055 IKSAHILSYNLCIGWLFDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSS 2114

Query: 2097 NNFFF-ANGVPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVM 2155
            + ++   N    +NRS+L SMQIN+W   +   KDLF+R+N ++LDV +L     IV+  
Sbjct: 2115 STYYPDGNEKGAMNRSYLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEA 2174

Query: 2156 RSSIESFQXXXXXXXXXXXXXXXTHNVAE-NLSDKVSILSIRSINCIAKYGGGIINLYTP 2214
              S+  F+                  + E N  D     S+RSINCI  Y G  + LY+ 
Sbjct: 2175 TQSLHKFKKLKETILDPLKVTSNDPILGEWNYLDNPLASSVRSINCIINYAGSSMKLYSR 2234

Query: 2215 DDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQ-HWIRSLVNVESTHNILFSSCVPVL- 2272
            DDI   +   S E+ SP+  V++DY + +PS+K+ HWIR+L  V +THN LF  CVP+L 
Sbjct: 2235 DDIQHGT--CSFEIRSPAHTVTIDYKY-YPSKKKSHWIRTLATVNTTHNTLFPVCVPLLN 2291

Query: 2273 ---VNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQ 2329
               +   T ++    +F++    L     E          +Y++L +  D A++INVG Q
Sbjct: 2292 EMWLTFNTMLKNSCSQFSNGAPNLASAKAE---------INYRDLLEAFDIAVIINVGKQ 2342

Query: 2330 NITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSS 2389
             I+LTCEP AKIQA +GF  F I +FT+S    EPL LS+    +  S+RH+FSREISSS
Sbjct: 2343 EISLTCEPTAKIQATIGFEKFDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREISSS 2402

Query: 2390 AGINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWS-PKTKKAQKLG 2448
              + ++ + F LTH   I TYG+TLIS   FY N+KQ++++ LFL+IWS  K K    + 
Sbjct: 2403 LSLQQISMVFSLTHSEYIHTYGSTLISKPLFYFNVKQIEDLNLFLEIWSIEKQKSVNDII 2462

Query: 2449 SGPHSGQKCQ-----PQALTEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWI 2503
              P +    +     P+           W Y +I     A ID+ PSLG +  K    W 
Sbjct: 2463 LAPVTASSFESVPSMPKLQRVPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWG 2522

Query: 2504 SSHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAF 2563
             S H +DW+  +   + E+   S GRLGG   IK+I + S I+WP+ +N    PL+ L+ 
Sbjct: 2523 LSSHNIDWTQKLLISMKEICMSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSL 2582

Query: 2564 KMSHLSSKIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALAS 2623
             +   ++K+ FDYH F I+ + +  + + N++DE G L DLL VS+S  ++ +F+T+LA 
Sbjct: 2583 ALGAFNTKLSFDYHMFFISTIQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAY 2642

Query: 2624 ANLYDIYATFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPL-RLRTNLTAEIGS 2682
            ANL+DIY+T  RMR ++ ++ +  L ESN E      F N+++LA L  LRT L+     
Sbjct: 2643 ANLFDIYSTIRRMRNDSGRTNLDLL-ESN-ELKKISSFDNSKMLASLLSLRTELSVNAQL 2700

Query: 2683 FRLYVFPSTLFDSEVLVLKANKM------NVEAATQTEQKTKTDLTWQIRDINISLAQFK 2736
              L++F +TL  +EV+VL+  K+         + T ++ K +T+LTWQ++D+++SL+ FK
Sbjct: 2701 LNLHIFSTTLIGTEVVVLRTRKVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFK 2760

Query: 2737 NELTEEQFAELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDK 2796
            ++L E Q  ++ V +Y + A+++ G IIL APS+FV + TWQ      IE LYSSSFG+ 
Sbjct: 2761 HQLDENQLDKIDVIDYVKLASIIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNG 2820

Query: 2797 VDIKWNLDPINFIREMWATHVRALSVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKY 2856
            V I WNL PINFI++MW+ H+ A+ +R      S      +DE+I  K+  V+LGTKY Y
Sbjct: 2821 VSITWNLRPINFIKDMWSIHINAMKLRHMQKGNSSEIHIPKDEDIEAKLAKVDLGTKYIY 2880

Query: 2857 IPLEEPHIEMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTL 2916
             PLEEP+IEMP ++DLG+ATPP+EWFG+NR RFPG+ HQ++VVPLQKL  VAE +Y R L
Sbjct: 2881 KPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRIL 2940

Query: 2917 G 2917
            G
Sbjct: 2941 G 2941

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/1589 (30%), Positives = 796/1589 (50%), Gaps = 128/1589 (8%)

Query: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60
            MD+ S F+ + ++ +++ S  FLV WIL VIL +   FYLGR +A+++T  L++ +W+  
Sbjct: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60

Query: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDFESEDG 120
            K+K+N+QS+++S LGGRIFFKN+T++  D TIS LEG+ TWRYWL +TR    +F+    
Sbjct: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTR--KPEFQEASV 118

Query: 121  DASE-------NAKLPCRFLLQCDGLEVFVYNKIDVYESVLR----------DHFTN--V 161
            D ++       N +LPCRF++  +GLE+F+YNK   Y+++++          + F N  +
Sbjct: 119  DETQTKPTSIKNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEKFLNEQI 178

Query: 162  TKDGQETESNDDITINTEXXXXXXXXXXXXXXXXXXXXXXTDAPKLSAKTKLFPIQLEAN 221
              D    +S DD   +T                       TD    S+  +  PIQ    
Sbjct: 179  LSDSATVKSMDDSQFDTSESTSTDKSESSATNDRVFQEEETDT---SSFLRFLPIQFLVT 235

Query: 222  RAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDALFELRTNLGYQ 281
            R +++LGN+ T  + +   + A  + D       LD Y+ K+S +L +    L+ N+G+ 
Sbjct: 236  RGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEATLKQNIGFD 295

Query: 282  NDNPIKTFVVEKTMDKIWQTVKKQCISISKLLLPNQGKTINNQQ--AYIDSWKGLDLYHH 339
             D  +K  +    + ++W    +    + K L         N+    +   W+GL LY  
Sbjct: 296  EDVSMKFKLDRGKVSEVWNHFTRMLGILYKPLRFTHMHRRKNEHEDKFQAKWRGLALYKG 355

Query: 340  TKAVQEENVDTTV---LHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRD 396
            T   +  N    +       EYA++S ++K+ +V+ T   D+PGIVP  +    S  D  
Sbjct: 356  TGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHGAHPTISVLDGP 415

Query: 397  ESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGS 456
            +  N       P +  DI I+  +V +GPWA +    + +L SP+VSR      +  PG 
Sbjct: 416  DVGNSGA---PPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKPVKRLTPGC 472

Query: 457  LRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEIL 516
             RIY   ++ V   D +   IPTRESSKD EF++ Y+ T   +R FGW+++  ++   + 
Sbjct: 473  RRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLKFSKETTVN 532

Query: 517  FNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLF 576
               ALC   D   N + + L   E +SSVNH++L +C       +  +P GWN +A W  
Sbjct: 533  TTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGWNDEATWTI 592

Query: 577  ELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYKLFXXXXXX 636
             L+S   E F+LR+HI+LI+D  TDFS+ +   YELFRPF Y I W    Y L+      
Sbjct: 593  NLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYSLYLNVNDH 652

Query: 637  XXXXXXXXXXXXCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNT 696
                        C+LS  GD L+    +P TSI     + ++ +K+P+ +L ++ P WNT
Sbjct: 653  NIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLLLNTPPWNT 712

Query: 697  LHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNI 756
            L+EF+     G   DF + G+Y+ +  +D+DN DTI++D  S  T    +GFV+RYL+N+
Sbjct: 713  LNEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGFVVRYLINV 772

Query: 757  KLNYFGDFNHFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSD--GSYQVAD 814
            K+NYFGDF HF T+EEY+  +   ED         +  ++     T   +D  G  ++  
Sbjct: 773  KMNYFGDFFHFVTSEEYTGAIRANEDDMQYASESDDDRSSISSFDTMQGNDAPGRRRL-- 830

Query: 815  TINENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTN 874
                  + +S L RT NETD+W TF V +G +++PE +Y+C     L F  L  D+R  N
Sbjct: 831  ---HTELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGELVIDLRSCN 887

Query: 875  YFMDLTAFFSRIYLNHSNEFSFNRVVA------IEESHSENT------GYLDDLNLHGHR 922
            Y+MDL A        + N+ S  R V+       E  H  N       G L  L +HGHR
Sbjct: 888  YYMDLLA--------NMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHR 939

Query: 923  MFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPE 982
            M+G+PP+E TY C+WD  +G+L   SD +FL  F  +  ++GF Y D ENIL+Y     +
Sbjct: 940  MYGLPPMEPTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYD 999

Query: 983  DVTSLTISIGRVSSIVRTNH-GGSATLSLNDITINSWDLSNSRYSKRVDLLVAAI--SVC 1039
            D+TS+T+++ ++S +++       A+  LN++     D  N +YS R+DL++  +  S+ 
Sbjct: 1000 DMTSVTVNLEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLF 1059

Query: 1040 AIDEKKTV--LFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLN 1097
              +E  T   LFT +T V++T FV   +   HR TQ+  + L+D+P+HRC F+L   +  
Sbjct: 1060 IKEEDGTTKKLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILP-QEYQ 1118

Query: 1098 HSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLI-------------NF 1144
             +  Y +L G+I PS SLP L  PL   T D I E LLG + +L+             ++
Sbjct: 1119 DAEQYQELFGAIAPSSSLPPLPVPLIPSTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDY 1178

Query: 1145 DTDIIDTKNXXXXXXXXXXXXXXSNTVSNDLSGQLAEEFESENTTVNISTLSVFVTPKAF 1204
             TD+ D  +              S  + ND       + E ++  +++S +S+ + P   
Sbjct: 1179 ATDVSD--DETEEDIDPLEFNTPSEAIQND-------KCERDSFIIDVSFISIEICPDIL 1229

Query: 1205 TFAENAAHFMLTMSTESIMDYF-EMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISDETA 1263
               ++   F++  STE+I+    ++ I  +  + ++  G F      L NVK+NI     
Sbjct: 1230 ---DSIGTFLMLFSTENIVQIIDDIEIATVNRLSNLREGAF-----KLTNVKINILYLDL 1281

Query: 1264 LDKTQLEA-----LDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQ 1318
               ++ +      LDR++ ++   +V           E++ E   I  + T+     S++
Sbjct: 1282 FWGSRTDTGVGIYLDRIDFAMCEKTV-----------EENKEKKLI--ELTVLNKIRSVR 1328

Query: 1319 FNIFKSSKNRLTKVLPIAWFEILMFNTVLFSDV-GKVSKLIFGSIKSAILDADVEWTVEY 1377
              + +++ N   +  P A   ++    +  S V  +V+ L   S    + +A +EW   Y
Sbjct: 1329 GTVNQTAANSKNEERPPALSLVIEGWEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGY 1388

Query: 1378 LLKLAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVPYIITKPAYITRLSK 1437
                        K+   + K +    KE I  +    +   I   PY+ITKPA+ITRLS+
Sbjct: 1389 FDNQGLQIQDMIKTSDTIQKRKIESRKELISSLTAASEYYQISHDPYVITKPAFITRLSR 1448

Query: 1438 FHVRDTASWKIITRLRHVSKH-------TSHVSETTSQCDDIPEEVRNICKDKSQFLDIF 1490
             HVR+  SWKIITRLRH+  +       T + S T S+     ++ + I      F+ +F
Sbjct: 1449 GHVRENRSWKIITRLRHILTYLPEDWHSTINRSLTQSKTAATTQDAKGI------FISVF 1502

Query: 1491 VDWKNWDVYEVEQSSLFTLLFSGESTVHE 1519
             +W+NW+  ++ +S ++  LF  + +  E
Sbjct: 1503 SNWRNWEFSDIARSYIYRKLFLNQHSNQE 1531

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/1180 (33%), Positives = 641/1180 (54%), Gaps = 70/1180 (5%)

Query: 1779 PFIIRILISGLDFNFKNLSGISIIVNY--TELLLDFYFNQLKLLRIS--NSVTKVDYRSN 1834
            PF IR     LD  F       I+++    ++ L  +  + +  R S  +   K +  ++
Sbjct: 1800 PFFIRHEAKQLDIYFNRFGSNEILLSVWDADIYLTSHLTKQQYFRFSFGDLQLKGNMVND 1859

Query: 1835 TLLTDIGLDTDIVKLTLSDNRVYIEE-------LTDSLNGTVS-ELIKIFKNKNADNEPA 1886
                ++ L   I+KLT+SD +  I         LT+S+   ++ +L  + KN+ +  E  
Sbjct: 1860 PYHINLYLSASILKLTVSDVQKLIPSFLQDEKILTESIEDFITLDLFGLSKNQKSKPEKD 1919

Query: 1887 APKFKPCSFKMNAIYIGLLTDLKTTNYVLEFNETAFSCASRAEALEETHANDNLREMSLV 1946
              KF   S   N  Y GLL  + +  ++ E      S       +     N +       
Sbjct: 1920 NNKFS-WSIDTNINYFGLLAPIGSAYFLFELRMLLASLTKMGSDI----PNQSDISGQFS 1974

Query: 1947 IQNVCILVLNPEVLPTLSKIFDIGFALKLIED--DIKKTLQIETPHSRVMLAPSTLIAVI 2004
            ++NV   +    +   LSK+ D    +  ++   +   T QIE+ H RV L+P +L+ ++
Sbjct: 1975 VENVLFFIKERALPVRLSKLLDFSIKVSALQKKKNTSNTYQIESSHFRVCLSPESLVRLL 2034

Query: 2005 FFIQEAKVSLQKVKQ---------KGKFNSSSNAIEIPPYFETLSVNILSNKLCLGWIFE 2055
            +   +   S+Q  K          + K N+   A ++P      S +ILS   C+GW+F 
Sbjct: 2035 WATNQVSTSIQYYKDHHVDNKWDLRSKLNNIPKAPDLP--LNVPSFHILSYNFCVGWLFS 2092

Query: 2056 EDT-DENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFFANGVPE-LNRSHL 2113
             D+  E G+++GY  LF+AYEK  GKLT+VD + + A G  S+NFF      +  NRS+L
Sbjct: 2093 VDSKSEPGLILGYNRLFSAYEKNLGKLTLVDVFFSIANGNSSDNFFSEGKEKDKYNRSYL 2152

Query: 2114 SSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQXXXXXXXXXX 2173
             +MQI++WF      +DLFVR + + LDV  L++ ++++    +S+++FQ          
Sbjct: 2153 PNMQISYWFKDAGTMRDLFVRFHGEALDVTFLSSYLDVIESALTSVQTFQELKKDLIPGL 2212

Query: 2174 XXXXXTHNVAENLSDKVSILS-----IRSINCIAKYGGGIINLYTPDDIAQDSPKSSLEL 2228
                    V ++ + +++ LS     IRSI+C  KY GG+  +++ +D A+   + S E+
Sbjct: 2213 PKK---QKVNDDKTLELNTLSPFLANIRSISCQFKYDGGVFKIFSLED-AETQSEPSFEV 2268

Query: 2229 TSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQKQMERFNS 2288
             SP++ + L+Y H     KQHWIRSL+ + STHNIL++ C P+L +    IQ  +++ +S
Sbjct: 2269 NSPNVVIDLNYKHLENRTKQHWIRSLIKINSTHNILYAKCAPLLSDFFERIQGMVKKHSS 2328

Query: 2289 EKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQADLGFS 2348
             ++  + K   Q       + DYK L    D A+ I    Q ++L+CEP+AK+QAD+GF 
Sbjct: 2329 SEESTLSKPSSQ-------NLDYKRLLDSFDIALKITSAKQQLSLSCEPKAKVQADIGFQ 2381

Query: 2349 NFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFMLTHENTIK 2408
            +F  ++ T+  D +EPLS SL   + E S +HIFSRE S+S G++ V +  M TH + I 
Sbjct: 2382 SFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETSTSIGVDFVDVTLMFTHPDVIN 2441

Query: 2409 TYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLGSGPHSGQKCQPQALTEFTTP 2468
             +G  LIS++  + N+KQLQ + LFLDIW        K  +     +     ++ + + P
Sbjct: 2442 VHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKPANDIVKAKTDSSLSIAQLSDP 2501

Query: 2469 K--IPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFYLDELNSKS 2526
            +  IPW + +IF N    +D+ PSLG I+ ++   W ++ H  +    +  + D  +  S
Sbjct: 2502 ESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFATDHYKNMRKVLHAFTDGTSLSS 2561

Query: 2527 DGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHSFLIARVSD 2586
             GRL G+FE+K   + S ++WP        PL+++   +  +S+K  FDYH FLI  +++
Sbjct: 2562 KGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMNIDEISTKAAFDYHMFLIGAINN 2621

Query: 2587 LQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIENKKSYVQ 2646
             ++ + +E+D +G++ DLL V+    S+ +  TAL +AN+ DIY T  RMR +NK SY++
Sbjct: 2622 TRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAANILDIYNTAMRMRQDNKISYIE 2681

Query: 2647 TLKESNPESSGKIHFSNNELLAPLR-LRTNLTAEIGSFRLYVFPSTLFDSEVLVLKANKM 2705
            TL+ESN E+  K   +  ++L  L  L+T+++ +I +  + + P TLFD EVLV+    +
Sbjct: 2682 TLRESN-EAESKPPINYTDILRSLNLLQTDVSVDIYTLNIQISPITLFDVEVLVITIESI 2740

Query: 2706 NVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQAALLEGDIIL 2765
            +  + T + +K  T+L  Q+ D ++SL+  K E+ E   +++SV+ Y + A+ + G  I+
Sbjct: 2741 SARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATVSKISVKNYLQYASKIVGGTII 2800

Query: 2766 AAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATHVRALSVRR- 2824
              P + V +TT+Q+     +E+LY+  F DK+ ++WNL PINFI+EMW TH+RA++VRR 
Sbjct: 2801 EIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLGPINFIKEMWTTHIRAIAVRRS 2860

Query: 2825 -------GHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATP 2877
                   G +E    K   E+EN +          ++KY+ LE P I+MP +RDLG+ATP
Sbjct: 2861 QVVGVLDGQSEEDVEKRIKEEENFS----------RFKYVALEPPRIDMPQIRDLGDATP 2910

Query: 2878 PIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917
            P+EWFGVNRKRFP   HQ  V  +QKL+Y AE +Y   LG
Sbjct: 2911 PMEWFGVNRKRFPAFTHQTAVFLVQKLVYSAEREYANILG 2950

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/1186 (37%), Positives = 673/1186 (56%), Gaps = 61/1186 (5%)

Query: 1773 QTSAFVPFIIRILISGLDFNFKNLSGISIIVNYTELLLDFY--FNQLKLLRISNS----V 1826
            + SA  P  I     GL   F+  +  S+ +      LD        + L++S S     
Sbjct: 1596 EISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKVSQSQVELT 1655

Query: 1827 TKVDYRSNTLLTDIGLDTDIVKLTLSDNRVYIEELTDSLNGTVSEL--IKI--------F 1876
             K+  +   + + + L++ + K  L D R  IE LT  L      L  +KI        F
Sbjct: 1656 AKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIHLLALGALF 1715

Query: 1877 KNKNADNEPAAPKFKPCSF--KMNAIYIGLLTDLKTTNYVLEFNE--TAFSCASRAE-AL 1931
               + D E  A    P  +  +++  Y+GLL  L TT+Y+ E NE  ++ SC   AE + 
Sbjct: 1716 GTDSTDEEVFAGALWPREWLWQLDMKYVGLLVPLGTTSYISEINELSSSLSCDEAAEFSF 1775

Query: 1932 EETHANDNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKL--IEDDIKKTLQIETP 1989
               H         L +  +  L+ + E+   LSK+ +  F +KL  + ++  K+LQIE+ 
Sbjct: 1776 PLVHGE-------LSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQIEST 1828

Query: 1990 HSRVMLAPSTLIAVIFFIQEAK--VSLQKVKQKGKFNSSSNAIEIPPYFETL-SVNILSN 2046
            H R+ L P +LI ++    EA     LQ +K      SS +A +     +T  S+ ILS 
Sbjct: 1829 HFRIALCPFSLIRILSLAYEATHLSGLQALKDNAGVKSSDDAKDFFNISQTFHSIQILSY 1888

Query: 2047 KLCLGWIFEEDTDEN-GIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFF-ANG 2104
              CLGWIF  D   N G+  GY+ LFAA+EKPYGKLT++D Y   A+G  SN+F+   + 
Sbjct: 1889 DFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGSTSNDFYIQPDE 1948

Query: 2105 VPELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQX 2164
            V   NRS L SMQI +WF     E +LFVR+N ++LDV  L+ S+ I      S+  FQ 
Sbjct: 1949 VDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAGGFARSLHLFQE 2008

Query: 2165 XXXXXXXXXXXXXXTHNV-AENLSDKVSILS-IRSINCIAKYGGGIINLYTPDDIAQDSP 2222
                             V A +   K+ ILS I  +NC  +Y GG+  LY+ DDI + + 
Sbjct: 2009 LKRQYLDPFKPEEPVKRVPAGSAFSKLPILSSISHVNCKVRYAGGVFKLYSLDDIKRKT- 2067

Query: 2223 KSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQKQ 2282
              S +L SPS++V  +Y      +++H +R+L++V+S+HN LF +CVP++  +  +I++ 
Sbjct: 2068 GPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPIISEMALDIRQL 2127

Query: 2283 MERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQ 2342
            ++  N    +       +T+N Q    +Y++L + +D + ++N+  Q I+L+CEP+AK+Q
Sbjct: 2128 LKDLNKSSVE-----TPRTSNMQE-GINYRSLLQDVDISFMMNIDKQQISLSCEPKAKVQ 2181

Query: 2343 ADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFMLT 2402
            AD+GF  F + +FT+  D  EPLSLSL    I  ++RHIFSRE+S+S  I  +   FMLT
Sbjct: 2182 ADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSFVFMLT 2241

Query: 2403 HENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLGSGPHSGQK--CQPQ 2460
            H +TI TYG   I  +  Y N+KQLQ++ +F++IW    K   K+ S P    K    P 
Sbjct: 2242 HPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIW----KLDSKILSQPELDNKFVIGPT 2297

Query: 2461 ALTEFTTPK---------IPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDW 2511
             L +  T K          PW + +I       ID+  SLG ++      W  + H  DW
Sbjct: 2298 NLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSDW 2357

Query: 2512 SHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSK 2571
            + ++S  LD+L+  SDGRLGG F ++N  + S I WP+ +  FE+PL+ L   +   + K
Sbjct: 2358 TQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAVK 2417

Query: 2572 IGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYA 2631
            + FDYH  LIA V  L L++ N+RD  G++++LL VS+S  S  +FLTALA AN++D+Y 
Sbjct: 2418 LTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVYN 2477

Query: 2632 TFARMRIENKKSYVQTLKESNPESSGKIHFSNNELLAPLRLRTNLTAEIGSFRLYVFPST 2691
            T  RMR +N+KSY++TL +SN   +     S+  L +   LRT L+  +    + V+PST
Sbjct: 2478 TILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPST 2537

Query: 2692 LFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEE 2751
            LFD EV+  KA   +  + T+  +K KT L  ++ ++ ++L+ +K++L E   +++ V+E
Sbjct: 2538 LFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVKE 2597

Query: 2752 YNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIRE 2811
            Y   A+ ++G  IL+ P++ +G+TTW  +    +E LYS+SFG K+ ++WNL  INF+RE
Sbjct: 2598 YIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLRE 2657

Query: 2812 MWATHVRALSVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRD 2871
            MWATH RA+++RR H     SK FFEDE++ +K+K V+LG +Y YIPLEEPHIE+P  +D
Sbjct: 2658 MWATHARAMALRRSHN--GQSKSFFEDEHLGDKLKDVDLGDEYTYIPLEEPHIEIPQTKD 2715

Query: 2872 LGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917
            LG ATPP+EWFGVNRK+FPG+ HQ ++VPLQKL ++AE ++ R LG
Sbjct: 2716 LGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAESEWARILG 2761

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/1354 (32%), Positives = 655/1354 (48%), Gaps = 113/1354 (8%)

Query: 212  KLFPIQLEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYDAL 271
            +L P++    + A+++GN+ T  V V  FE+ KG  D  +  + +D Y+ K+  D+    
Sbjct: 27   RLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQ 86

Query: 272  FELRTNLGYQNDNPIKTFVVEKTMDKIWQTVKKQCISISKLLLPNQGKTINNQQAY---I 328
              LR NL Y ND P+K       + K+     +  + + K  L    KT + ++     +
Sbjct: 87   MSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRVRKRYLSRGSKTESTRKDLRNPL 146

Query: 329  DSWKGLDLYHHTKAVQEENVDTTVLHEQEYARYSRVMKAERVSLTYYFDIPGIVPANSSS 388
            + W+GL LY        ++V    L + EYARYS+VMK E + + Y  D PG+VP  +  
Sbjct: 147  ERWRGLGLYWKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPHGAFP 206

Query: 389  INSQSDRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVSRDQMK 448
                 D  +  N       P F  DI ++ A ++YGPWAH  +  I ++FSP+VSRD   
Sbjct: 207  TLEPLDGPDVGNGGA---PPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSHP 263

Query: 449  ATKPEPGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFGWLNVS 508
              +   GS R++   ++S+     S+  IPTRE SKD +F+KRYK T D  R FGWL +S
Sbjct: 264  TERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLELS 323

Query: 509  LNEGGEILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIGYPTGW 568
            L EG E+  N+A+C  +    N+L +  + PEI++SVNH++L    T  I+A IGYP GW
Sbjct: 324  LAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLGW 383

Query: 569  NKQADWLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWVFTEYK 628
            N +A W F+L S  A +F+L+DHI+L+ D+ +DF   D   Y+LFRPF YE  W  T Y 
Sbjct: 384  NAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGYS 443

Query: 629  LFXXXXXXXXXXXXXXXXXXCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSPLVKLS 688
            ++                  C+LS  GD L  S  +P  SI        + L +PL +L+
Sbjct: 444  MYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRLN 503

Query: 689  IHPPCWNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKFLSFGF 748
            ++ P WNTLHEF+ +   G   DFS+ G+Y+    +DV+N DTI+I+ +S  T    +G+
Sbjct: 504  MNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYGY 563

Query: 749  VLRYLMNIKLNYFGDFNHFKTTEEYSNDLSMEEDTKTKTKNFQEQPTNDVESLTSSSSDG 808
            V+R+L+ +K+NYFGDF HFKTTEEY  +L    D   + K   EQ  N  E+ T+   + 
Sbjct: 564  VVRFLVGVKMNYFGDFVHFKTTEEYMEEL---RDAYVEPKANSEQSANSTETTTAGEGED 620

Query: 809  SYQVAD--TINENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRSFLLSFRRL 866
                    T +     K SL R  NE DVW TF V DGC+I+P+NLYDC   F   F  L
Sbjct: 621  KQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACFAFEFDSL 680

Query: 867  EFDMRYTNYFMDLTAFFSRIYLNHSNEFSFNRVVAIEESHS---ENTGYLDDLNLHGHRM 923
            + D+RY NY+MDL A  S + + + ++     + +  E       N G + DL++H HRM
Sbjct: 681  DIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCPSRANFGSISDLHIHAHRM 740

Query: 924  FGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENILIYSIHKPED 983
            FG+PP EETY CKWD S+G L   SD   + SF +A  K+ F++KD ENI+ Y I    D
Sbjct: 741  FGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENIMNYKIVPILD 800

Query: 984  VTSLTISIGRVSSIVRTNHGGS---ATLSLNDITINSWDLSNSRYSKRVDLLVAAISVCA 1040
            +TS+    G +   V+ N         + + ++T    D  N RYS R D+ + +I+V  
Sbjct: 801  MTSIIFHAGEIR--VKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVDIHSITVQV 858

Query: 1041 IDEKKTVLFTCD--TAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKFLLAFDQLNH 1098
             +  K      D  +++++TKF    N   H + Q++ +  ND+PFHRC FLL    +  
Sbjct: 859  KEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRCSFLLPL-AIQR 917

Query: 1099 STLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDIIDTKNXXXXX 1158
            S  Y  LLGSI P +S+P + EP+T +    I +  L    N +    +   +K      
Sbjct: 918  SDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQMGNEHFCSKKEEDGY 977

Query: 1159 XXXXXXXXXSNTV--SNDLSGQLAEEFESENTTVNISTLSVFVTPKAFTFAENAAHFMLT 1216
                     S+T   SN  S  L  +      +++   +  F +     ++      + +
Sbjct: 978  AFNFASGLMSSTENDSNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDS 1037

Query: 1217 MSTESIMDYFEMNI-------VNIFSVGHITNGKFFNS----------SVMLKNVKVNIS 1259
               E ++ + E  +       V +FS         F S           +++K + V+IS
Sbjct: 1038 NEIEVVLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDIS 1097

Query: 1260 -----------DETALDKTQLEALDRLELSVSNISVISKILKYPQNLEQSNESTGITDDS 1308
                         T  D T L  ++ L L VSN S             ++     I +D 
Sbjct: 1098 MREEPSPNSSEKSTVQDITALVKVESLALCVSNTS-------------RNGPLENIHEDQ 1144

Query: 1309 TISCNFDSLQF-----NIFKSSKNRLTKVLPIAWFEILMFNTVLFSDVGKVSKLIFGSIK 1363
              S +   L+F     +I KSS            F     +T + SD  ++   IF    
Sbjct: 1145 LCSTSIKDLEFWMTSEDIRKSS------------FNATSIDTWVHSDKTELC-CIFLKNT 1191

Query: 1364 SAILDADVEWTVEYLLKLAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSVP 1423
            +A +D   E    +  +L KA                   ++   R++       I   P
Sbjct: 1192 AANIDTITEVVSVHKERLQKA------------------QRDFFYRISTASDEYQIIHDP 1233

Query: 1424 YIITKPAYITRLSKFHVRDTASWKIITRLRHVSKH--TSHVSET----TSQCDDIPEEVR 1477
             +ITKPAYITRL   HVR+  SWKIITRLRH+  +   S ++E      S   + P    
Sbjct: 1234 PVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAG 1293

Query: 1478 NICKDKSQFLDIFVDWKNWDVYEVEQSSLFTLLF 1511
             I      FL+IF  W++W+  +VEQ  ++   F
Sbjct: 1294 EI------FLNIFSKWRSWESSDVEQCYMYRKAF 1321

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/1203 (35%), Positives = 648/1203 (53%), Gaps = 84/1203 (6%)

Query: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60
            M+  S F  IS+  EK  S  FL  W+L  I  +   FYL R+   + T  L + +W++Y
Sbjct: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60

Query: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDF----- 115
            K+KIN++SI+VSFLGG +F KN+++++ DFT+SFLE    WRYWLL++  R +++     
Sbjct: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNS--REVEYKVQAN 118

Query: 116  ----ESEDGDAS------ENAKLPCRFLLQCDGLEVFVYNKIDVYESVLRDHFTNVTKDG 165
                +S+  DAS      +N+KLPC  L++C G EVFVYN+   YE+VLR      TK+ 
Sbjct: 119  LSSEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLR----LFTKEE 174

Query: 166  QETES------------NDDITINTEXXXXXXXXXXXXXXXXXXXXXXT-DAPKLSAKTK 212
            +E  S            ++D  +N+                       T    K   K+ 
Sbjct: 175  REKFSSFLNEHDLGDIVSEDTNVNSMDKDYFESVTTENSSESTVINDRTYKKNKDERKSI 234

Query: 213  LF---PIQLEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYD 269
            LF   PIQL     A+ LGNR T  + V  +E   GV D+  +   +D Y++K+++   D
Sbjct: 235  LFNFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQD 294

Query: 270  ALFELRTNLGYQNDNPIKTFVVEKTMDKIWQTVKKQCISISKLLLPN----------QGK 319
                ++ NL Y ++   +  + +  + +IW T     I I   ++PN          + K
Sbjct: 295  VNISVKPNLAYDSEFTNELDIDKGKLSRIWNTF----IDIMD-MIPNPFTKIYHKHMKKK 349

Query: 320  TINNQQAYIDSWKGLDLYHHT------KAVQEENVDTTVLHEQEYARYSRVMKAERVSLT 373
              + +  +++ W+GL LY           + E + D      +EYA++S ++K    +L+
Sbjct: 350  EHDVESMFVNKWRGLSLYKDNLRDAGRYGLDEASYD---FLNREYAKFSSILKCPNFTLS 406

Query: 374  YYFDIPGIVPANSSSINSQSDRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQD 433
            YY D PGIVP  +   N + D  +  N       P F  D+ +  A++YYGPW ++ +  
Sbjct: 407  YYLDSPGIVPHGAHQTNVKKDGPDIGNSGS---PPEFLVDLQVSKASIYYGPWTNRQVSY 463

Query: 434  IIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYK 493
            +IR+ SP+VS++Q+   K EPGS RI+  FK+SV   D+S   IPTRE SKD+EFIK++ 
Sbjct: 464  LIRMLSPVVSKNQIPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFV 523

Query: 494  TTGDTHRAFGWLNVSLNEGGEILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRC 553
             T D  R FGWL+ +LN+G +  FN +L    D L N   +  L+ E+ +SVNH++L + 
Sbjct: 524  KTNDDFRPFGWLDFNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKS 583

Query: 554  NTQTIKANIGYPTGWNKQADWLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELF 613
                + A+IGYP GWN QADW F++ ++  E FLL++HISL SD+F+DF++ D   YELF
Sbjct: 584  KEFDVVADIGYPLGWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELF 643

Query: 614  RPFTYEIKWVFTEYKLFXXXXXXXXXXXXXXXXXXCFLSLSGDILNTSINLPFTSIVKEP 673
            RPFTY + W    Y ++                  C+LSL GD L+    +P   I +  
Sbjct: 644  RPFTYSLNWDIEGYSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPY 703

Query: 674  HETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTIL 733
             E  F + +P+ +L ++ P WNTL EF+ +   G   DF + G+Y+ +  +D+DN DTI 
Sbjct: 704  TEIAFNIYTPMFRLLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTIT 763

Query: 734  IDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHFKTTEEYSNDLSMEEDTKTKTKNFQEQ 793
            ++  S ST    +G V+RYLMN++ NYFGDF HF T+EEYS  L      K   ++  EQ
Sbjct: 764  MECTSRSTTLFCYGVVIRYLMNVQANYFGDFVHFITSEEYSEILQ-----KNNKRSNDEQ 818

Query: 794  PT---NDVESLTSSSSDGS--YQVADTINENTIHKSSLLRTKNETDVWITFFVNDGCIII 848
             +   +   S+ +SSSD +  Y     +++  + ++ +LRT+NE D+W TF V DG +I+
Sbjct: 819  GSFTYSTTSSVQNSSSDDTVLYTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALIL 878

Query: 849  PENLYDCQRSFLLSFRRLEFDMRYTNYFMDLTAFFSRIYLNHSNEFSFNRVVAI--EESH 906
            PE LY+      L F  L    R +NY+MD       + +N    FS + +     +  H
Sbjct: 879  PEGLYNGNLCSSLLFSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDH 938

Query: 907  SENT--GYLDDLNLHGHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVG 964
            + N   G L D+ +H HRMFG+PP + TY C+W I  GSL  DS+ +FL SF     K+G
Sbjct: 939  NLNIVHGTLSDVTIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLG 998

Query: 965  FTYKDAENILIYSIHKPEDVTSLTISIGRVSSIVRTN-HGGSATLSLNDITINSWDLSNS 1023
            F Y + EN L+Y +   +D+T LT+   +V  +V  +     A+L +  + +NS D  N 
Sbjct: 999  FGYSNLENKLVYKVESSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNE 1058

Query: 1024 RYSKRVDLLVAAISVCAIDEK----KTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLL 1079
            RYSKR++L +   S+   D +    K +L    T ++ T FV++ + +N    Q+  + L
Sbjct: 1059 RYSKRINLKIPEFSISIFDVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITL 1118

Query: 1080 NDSPFHRCKFLLAFDQLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYI 1139
            +DSP+HRC F+L       S LY++L G ITPS S+P L  P+   T D + E  L  Y 
Sbjct: 1119 HDSPYHRCFFILP-TMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYS 1177

Query: 1140 NLI 1142
            +L+
Sbjct: 1178 DLL 1180

 Score =  592 bits (1527), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 390/1184 (32%), Positives = 624/1184 (52%), Gaps = 107/1184 (9%)

Query: 1806 TELLLDFYFNQLKLLRISNSVTKVDYRSNTLLTD-------IGLDTDIVKLTLSDNRVYI 1858
             +L L  Y N ++  R+S      D     +LTD       I + T ++KLTL+D +   
Sbjct: 1849 ADLYLTSYQNGVQYFRLSYQ----DINLEAMLTDSKSKLITINIVTSLIKLTLADPK--- 1901

Query: 1859 EELTDSL---NGTVSELIKIFKNKN----ADNEPAAPKF-KPCSFKMN--AIYIGLLTDL 1908
             ++T+SL     T  + ++  K  N    ++ E        P  F +N    Y GLL  +
Sbjct: 1902 -KITNSLLQDEKTFEQSLESIKTLNTLFSSNREVRTSAVDNPYKFMVNFDLTYFGLLFPV 1960

Query: 1909 KTTNYVLEFNETAFSCASRAEALEETHAN-DNLRE---MSLVIQNVCILVLNPEVLPTLS 1964
             T+ ++LE +       S        + N   L+E    +L +QN   ++ +PEV   +S
Sbjct: 1961 DTSYFILELH-------SLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVS 2013

Query: 1965 KIFDIGFALKLIEDDI---KKTLQIETPHSRVMLAPSTLIAVI---------FFIQEAKV 2012
            K+ D    L   E  I   K++ ++E+ H RV L P +L+ ++         F   +   
Sbjct: 2014 KVLDFSVNLS-TETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHT 2072

Query: 2013 SLQKVKQKGKFNSSSNAIEIPPYFETLSVNILSNKLCLGWIFE-EDTDENGIVIGYESLF 2071
             LQ  K K K +  S  +   P  E  S++ LS   C+GWIFE   +   G+++GY+ LF
Sbjct: 2073 RLQIFKTKKKASVVSENLIGAPLIE-YSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLF 2131

Query: 2072 AAYEKPYGKLTIVDGYVATAQGKESNNFFF-ANGVPELNRSHLSSMQINFWFSGQFIEKD 2130
            +AYE  YGKLT+VDG+ + A G  S+ F+   N   + NRS+L ++QI +W       K 
Sbjct: 2132 SAYEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQ 2191

Query: 2131 LFVRMNADKLDVRILTTSVEIVNVMRSSIESFQXXXXXXXXXXXXXXXTHNVAENLSDKV 2190
            LFVR   + +DVR L+    I+N+   S++ FQ                    +++S K 
Sbjct: 2192 LFVRFYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVEAEKKVGEDDISTKF 2251

Query: 2191 SIL--SIRSINCIAKYGGGIINLYTPDDIAQDSPKSSLELTSPSIEVSLDYMHNFPSQKQ 2248
            S+    ++ INC   Y GG+  +Y P        + ++E+T+P + + +DY +    +K 
Sbjct: 2252 SLFFSKVQRINCQCIYDGGVFTVY-PVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKP 2310

Query: 2249 HWIRSLVNVESTHNILFSSCVPVLVNLTTEIQKQMERFNSEKKQLVHKTQEQTTNTQRIS 2308
            HWIRS +N+E T+N L S     L      + + + +F+        K Q     T    
Sbjct: 2311 HWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSP-------KEQPPAPKTVSPP 2363

Query: 2309 FDYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQADLGFSNFRISMFTDSPDHSEPLSLS 2368
             DYK + +  D +  I+ G Q ++L+CEP AK+ A++GF +F  S+ T+  D +EPLS S
Sbjct: 2364 IDYKRILEDFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCS 2423

Query: 2369 LQWSEIEISTRHIFSREISSSAGINEVYLDFMLTHENTIKTYGNTLISDMKFYVNMKQLQ 2428
            L  ++I+ S  H FS E ++S  ++ V +  + TH +    YG TLISD+  Y N+KQLQ
Sbjct: 2424 LTVNDIKTSINHEFSTEPTASFSVDFVDITTLFTHPDI---YGTTLISDVSLYFNIKQLQ 2480

Query: 2429 EITLFLDIWSPKTKKAQKLGSGPHSGQKCQPQALTEFTTPK----------IPWIYQIIF 2478
             + +FLDIW+   K+  KL       QK  P    E               IPW + +I 
Sbjct: 2481 NLMVFLDIWN--LKRLIKL-----RPQKSVPVKKPESRVSSSTKSSSNTTIIPWSFTVII 2533

Query: 2479 KNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFYLDELNSKSDGRLGGLFEIKN 2538
             + +  I + PSLG+++ K+   WIS++H  D   ++ F+ D L+  S GRLGGL ++ N
Sbjct: 2534 TDINGDIHLGPSLGNLSLKLKKNWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVAN 2593

Query: 2539 IFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHSFLIARVSDLQLAIRNERDES 2598
            I +  ++ +   +   ++PL+++   + +++ K  FDYH FLI RV ++   + +E+D  
Sbjct: 2594 ISWILNVRYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLI 2653

Query: 2599 GLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIENKKSYVQTLKESNPESSGK 2658
            G L DLL + +    ++I  TAL ++N+ DI  T +R R +++ SY++TL ESNP    K
Sbjct: 2654 GNLPDLLKLHLVCDEIDICSTALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQ-K 2712

Query: 2659 IHFSNNELLAPLRL-RTNLTAEIGSFRLYVFPSTLFDSEVLVLKANKMNVEAATQTEQKT 2717
               S  ++L  L L RT++  EI   ++ + P +LFD EV+V     ++  + TQ+ +K 
Sbjct: 2713 SSISYTDILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKL 2772

Query: 2718 KTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQAALLEGDIILAAPSVFVGITTW 2777
             TDL  +I    +SL++   EL EE  +E+SV++Y   A  L G  IL+ P +FVG+TTW
Sbjct: 2773 MTDLQMKIYKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTW 2832

Query: 2778 QKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATHVRALSVRR----GHTEPS--- 2830
            Q      IE+L++  F DK+ ++WNL P+NFI+E+WATHV++L+VRR    G  EP    
Sbjct: 2833 QLENSKIIEYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVP 2892

Query: 2831 -----PSKPFFEDENI----AEKIKIVNLGTKYK------YIPLEEPHIEMPLLRDLGNA 2875
                 PS P    E +    +E     N   +Y       Y+PL+EP IEMP ++DL +A
Sbjct: 2893 GIIGEPS-PLVSSEELEMLRSESSNADNDNNEYSEEDKFIYVPLKEPQIEMPKIKDLEDA 2951

Query: 2876 TPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLGDN 2919
            TPP+EWFGVNRK+FP + HQ  ++ +QK+++VA+ +Y + LGD+
Sbjct: 2952 TPPLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVLGDS 2995

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 80/140 (57%), Gaps = 2/140 (1%)

Query: 1373 WTVEYLLKLAKAFCKEGKSCIELGKLRSIDMKETII-RVAELGKISGIDSVPYIITKPAY 1431
            W ++YL K  + F    K  ++L + R + +++++I ++    +   ID  PY+ITKPA 
Sbjct: 1404 WLIKYLNKQVEFFYNL-KGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPAL 1462

Query: 1432 ITRLSKFHVRDTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQFLDIFV 1491
            I RLS  HVR+  SW+I+TRLRH+  +     E +S        V +    K+ FL +F 
Sbjct: 1463 IMRLSNSHVRENRSWRIVTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFS 1522

Query: 1492 DWKNWDVYEVEQSSLFTLLF 1511
            +W+NW+V +V +S ++  +F
Sbjct: 1523 NWRNWEVSDVARSYIYRRVF 1542

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/1207 (34%), Positives = 621/1207 (51%), Gaps = 90/1207 (7%)

Query: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60
            MD  S F+ +S+   ++ S  FLVDW+L  I+ +   FYLGRI  ++LT  L++ VW++ 
Sbjct: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60

Query: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRI----RGIDFE 116
            K+KIN++S++++ LGG I F+NL ++  D+TIS LEG+  WRYWL ++R       +D E
Sbjct: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQYQENLDNE 120

Query: 117  SE------DGDASENAKLPCRFLLQCDGLEVFVYNKIDVYESVL-------RDHFTNVTK 163
             E      +  ++   K PCRFLL C+GLE+FVYNK   YE+++       R  F     
Sbjct: 121  EERLENGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQFEKFVD 180

Query: 164  DGQETE---------------SNDDITINT-EXXXXXXXXXXXXXXXXXXXXXXTDAPKL 207
            D   TE               +   +T+ T                          AP  
Sbjct: 181  DQTMTELFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQNDGQAPNN 240

Query: 208  SAKTKLFPIQ---------------LEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSS 252
                +LF  Q               +   R ++VLGNR T  + V   + +KG+ D+   
Sbjct: 241  LENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGIIDLCPP 300

Query: 253  ISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTFVVEKTMDKIWQTVKKQCISISKL 312
               LD ++ K+  +LYD    ++ N+G+ +D           + K+WQ   +        
Sbjct: 301  KEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFAR------IF 354

Query: 313  LLPNQG-KTINNQQ--AYIDSWKGLDLYHHTKAVQE-ENVDTTVLHEQEYARYSRVMKAE 368
            LLP  G K +  Q+   + ++WKGL LY       E ENVD    +  EYAR   ++K+ 
Sbjct: 355  LLPTLGPKHLQTQEDITFRENWKGLSLYRQNMEEDELENVDFDFAN-HEYARVISILKSA 413

Query: 369  RVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQDDDT---PAFGTDIHIYTAAVYYGP 425
            ++  TY +DIPG+VP          + +E+L   +  ++   P FG DI +Y A + YGP
Sbjct: 414  KIVFTYEYDIPGLVP---------KEPEETLQGPEVGNSGAPPEFGVDIQLYGANICYGP 464

Query: 426  WAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSVDFRDKSVLHIPTRESSKD 485
            WA + +  +  L SP+VSR         PGS RIY  FK S+   ++S   IPTRE SKD
Sbjct: 465  WAERQLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREKSKD 524

Query: 486  EEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQADRLPNELYVLLLNPEIKSSV 545
            +EF++ Y  T +  R FGW+++   +    + +  +C   +  PN +     N EI++SV
Sbjct: 525  QEFLRHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIRTSV 584

Query: 546  NHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAELFLLRDHISLISDLFTDFSAN 605
            NHE+L R  +   +A++GYP GWN QA+W   L S   E+F+LR+HI+LISD+F DFS+ 
Sbjct: 585  NHELLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADFSSG 644

Query: 606  DALRYELFRPFTYEIKWVFTEYKLFXXXXXXXXXXXXXXXXXXCFLSLSGDILNTSINLP 665
            D   YELFRPF Y I W    Y ++                  C+LSL GD L   + +P
Sbjct: 645  DPTPYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDVKIP 704

Query: 666  FTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFGECPDFSMTGTYISFPSVD 725
              ++     E T+ + +P+ +L ++ P WNTL+EF+     G   +F + G Y  F  +D
Sbjct: 705  RQTVANRCTEITYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFSELD 764

Query: 726  VDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHFKTTEEYSNDLSMEEDTKT 785
            +DN DTI ++  S  T    +GFV+RYLMN+K+NYFGDF+HF T EEY+N    EE    
Sbjct: 765  IDNVDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEE---P 821

Query: 786  KTKNFQEQPTN-DVESLTSSSSDGSYQVADTINEN--TIHKSSLLRTKNETDVWITFFVN 842
            K +N  ++ +  ++ S     +D +       N+      +S L RT+NE D+W  F V 
Sbjct: 822  KNENLGDEHSGFNISSTEDVETDRTNPEGRPANKGIPMPKRSELKRTENEMDIWFVFSVW 881

Query: 843  DGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLTAFFS----RIYLNHSNEFSFNR 898
            +G +I+PE +Y+      L F  LE D+R TNY+MDL A  +    + Y++      F  
Sbjct: 882  EGALILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDLFEC 941

Query: 899  VVAIEESHSENTGYLDDLNLHGHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLE 958
            V        ++ GYL  L +HGHRM+G+PP E TY C+W + I  L  +SD +F   FL 
Sbjct: 942  VRKDNGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKGFLT 1001

Query: 959  AIQKVGFTYKDAENILIYSIHKPEDVTSLTISIGRVSSIVR-TNHGGSATLSLNDITINS 1017
               K+GF +K+ ENIL+Y  +   D+TS+T+ +  +  ++   +    + L    IT  +
Sbjct: 1002 CFSKIGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKITFTA 1061

Query: 1018 WDLSNSRYSKRVDLLVAAIS--VCAIDEKKT---VLFTCDTAVELTKFVVRSNMKNHRVT 1072
             D  N  YS+RVD     I+  +  +DE +     L    T +  T F+      +HR  
Sbjct: 1062 IDFENEAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADHRYR 1121

Query: 1073 QQNCVLLNDSPFHRCKFLL-AFDQLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIY 1131
            Q+  + L+DS ++RC FLL  F Q   S LY +LLGSI+PS +LP L  P+  +T D I 
Sbjct: 1122 QREYITLHDSAYYRCSFLLPCFFQ--ESVLYKELLGSISPSATLPPLPLPVLAETIDYII 1179

Query: 1132 ERLLGSY 1138
            E  LG Y
Sbjct: 1180 EDCLGEY 1186

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/1103 (33%), Positives = 610/1103 (55%), Gaps = 45/1103 (4%)

Query: 1837 LTDIGLDTDIVKLTLSDNRVYIEEL---TDSLNGTVSELIKIF---KNKNADNEPAAPKF 1890
            + ++ + T ++KLTL + R  +  L     +L  +V  + K++   ++ +  N+ +  + 
Sbjct: 1919 VVEVQISTSLMKLTLCEPRRALHNLLQDEQTLVESVDHIQKLWNFLRSASGGNDRSPSRN 1978

Query: 1891 KPCSFKMNAIYIGLLTDLKTTNYVLEFNETAFSCASRAEALEETHANDNLREMSLVIQNV 1950
               +   N  Y GLL  + +  Y+ E +    S  +  E  EE    D      +V+++ 
Sbjct: 1979 TRWALDANLKYFGLLVPVSSICYIFELHSLFASLTNANEQYEEY---DRHFSGQIVVESC 2035

Query: 1951 CILVLNPEVLPTLSKIFDIGFALKLIEDDIKKTLQ---IETPHSRVMLAPSTLIAVIFFI 2007
             +LV    +   LSK+ D      L    +  +LQ   IE+ + R+ L P  L+ +++ +
Sbjct: 2036 YLLVKELSLPANLSKVLDFSIRF-LTSQKVPNSLQSYQIESSYFRLCLFPELLVDILWSV 2094

Query: 2008 QEAKVSLQKVKQKG----KFNSSSNAIEIPPYFETLSVNILSNKLCLGWIFE-EDTDENG 2062
               +  L   K+       ++S+  A       +  S++ILS   C+GW+FE  D  E G
Sbjct: 2095 HYLQSLLNHFKKHHTPWLPYSSNKTAKSGESTLDFRSIHILSYNFCVGWLFEVGDNSEPG 2154

Query: 2063 IVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFFANGVPE-LNRSHLSSMQINFW 2121
            +++GY+ LF+AYEK +GKLT++DGY++ A G  S+ F+      +   R++LS+MQI +W
Sbjct: 2155 LILGYDRLFSAYEKHFGKLTLIDGYLSVANGNTSDTFYSQKSEKDSYTRTYLSNMQIFYW 2214

Query: 2122 FSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQXXXXXXXXXXXXXXXTHN 2181
              G+ + KDLFVR + + +DVR L+TS ++V     SI+ F                +  
Sbjct: 2215 LKGENLLKDLFVRFHGEVIDVRFLSTSFKLVEKTLHSIKRFNEMKKAKIKQTGSSTKSKL 2274

Query: 2182 VAENLSDKVS--ILSIRSINCIAKYGGGIINLYTPDDIAQDSPKSSLELTSPSIEVSLDY 2239
              E  S+ ++  +  IR+IN    + GG+  +Y+P ++   + +  LE+ SP ++++++Y
Sbjct: 2275 NMEAASNTLAPFLAHIRTINSQLNFAGGVFKVYSPTELDSKA-EPLLEIKSPGVQMAINY 2333

Query: 2240 MHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQKQMERFNSEKKQLVHKTQE 2299
              N   +K H IR    +E THN+LF+ C P+L +    I+  +   +SE K   H ++ 
Sbjct: 2334 EFNETREKSHCIRFFTTIEPTHNMLFAKCAPLLSDFNHNIKNMIRNLSSEDKS--HPSKP 2391

Query: 2300 QTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQADLGFSNFRISMFTDSP 2359
             T      S DYK+L    D A  I  G Q ++ +CEP+AK+Q D GF++F   + TD  
Sbjct: 2392 VTD-----SIDYKSLLNPYDIAFEIASGKQKLSFSCEPKAKVQLDAGFNSFLFRVTTDKV 2446

Query: 2360 DHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFMLTHENTIKTYGNTLISDMK 2419
            D  EP ++S    +IE S RHIFSR+ S++  ++ + +  M T+ N    YG  L+SDM 
Sbjct: 2447 DSVEPFNVSFSMDKIESSVRHIFSRDSSAAFMLDYIDIVMMFTYPNV---YGVALVSDMN 2503

Query: 2420 FYVNMKQLQEITLFLDIWS----PKTKKAQKLGSGPHSGQKCQPQALTEFTTPK---IPW 2472
             Y NMKQ Q + +FLDIW      +TK ++         +K      +  +       PW
Sbjct: 2504 IYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDKSDAKKSLSPPFSPSSNDSRKVFPW 2563

Query: 2473 IYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFYLDELNSKSDGRLGG 2532
             + IIF N   V+D+ PSLG +   +   WI++ H+ D   +   +   +   S+GRL G
Sbjct: 2564 SFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQGDQKRTWHTFAHGITVNSEGRLSG 2623

Query: 2533 LFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHSFLIARVSDLQLAIR 2592
            +FE+      S ISWP +D     PLI+++  ++ +S K  FDYH FLI  +  +++ + 
Sbjct: 2624 MFELDQASSVSEISWPEEDLLRVGPLISVSMAINRMSIKSAFDYHMFLIGSMKSVKVHLH 2683

Query: 2593 NERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIENKKSYVQTLKESN 2652
            NE D   +L DLL VS+ F S+ +  TAL +AN  DIY T  RM+ +N+ SY++TLKESN
Sbjct: 2684 NESDTYAILPDLLQVSLEFESIVLCATALTAANALDIYNTIMRMQQDNRISYIETLKESN 2743

Query: 2653 PESSGKIHFSNNELLAPLR-LRTNLTAEIGSFRLYVFPSTLFDSEVLVLKANKMNVEAAT 2711
              S+     +  E+L  L  LRT+++  +   ++++ P +LFD+EVLV+    +N  + T
Sbjct: 2744 I-SASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHISPMSLFDAEVLVVSVRDVNARSET 2802

Query: 2712 QTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQAALLEGDIILAAPSVF 2771
            Q+ +K KT+L  QI D+N SL+  K EL EE  ++++V++Y   A+   G  I+  P + 
Sbjct: 2803 QSGEKLKTELQLQISDVNASLSSSKEELDEETVSKIAVDDYMLYASKFSGGTIIKLPQLL 2862

Query: 2772 VGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATHVRALSVRRGHTEPSP 2831
            V +TTWQ+     +E+L++  F DK+ +KWNL P+NFI+EMWATHVR+L+VRR  T+   
Sbjct: 2863 VSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNFIKEMWATHVRSLAVRR--TQLGN 2920

Query: 2832 SKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATPPIEWFGVNRKRFPG 2891
            S P  E  N ++K   V   +K+ Y+PL+EP+IEMP ++DLG+ATPP+EWFGV+RK  P 
Sbjct: 2921 SSPELEVANESDKEDTVK--SKFIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKNLPA 2978

Query: 2892 MAHQLIVVPLQKLIYVAEDQYNR 2914
              HQ  V+ +QKL++ AE +Y +
Sbjct: 2979 ATHQTAVLLIQKLVHTAEKEYAK 3001

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/224 (25%), Positives = 113/224 (50%), Gaps = 20/224 (8%)

Query: 1299 NESTGITDDSTISCNFDSLQFNIFKSSKNRLT---KVLPIAWFEILMFNTVLFSDVGKVS 1355
            NE   +  + T+  N  +L+ ++ ++  + ++     L ++  ++ ++++ +  +V  V+
Sbjct: 1336 NEDEKVILEKTMFSNIHTLRISLLEAHPSSISMKPAALQLSIEDLELWSSTVDENVNSVN 1395

Query: 1356 KLIFGSIKSAILDADVEWTVEYLLKLAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGK 1415
               FG     + ++ +E    YL    K       S  EL  LR    K+ I  +    +
Sbjct: 1396 VTSFGF---TLDESQLERISGYLFGQIKVLRDTITSAKELENLRKKTQKDLICDLTSASE 1452

Query: 1416 ISGIDSVPYIITKPAYITRLSKFHVRDTASWKIITRLRHVSKHTSH--------VSETTS 1467
               I   PY+ITKPA+I RLS+ HVR+  SW+IITRLRH+  +  +        V+   S
Sbjct: 1453 YYQISHDPYVITKPAFIMRLSEGHVRENRSWRIITRLRHILTYLPNDWRTADHLVTVQDS 1512

Query: 1468 QCDDIPEEVRNICKDKSQFLDIFVDWKNWDVYEVEQSSLFTLLF 1511
            +  ++P+      +D+  F+ +F +W+NWD+ ++ +S ++  +F
Sbjct: 1513 ENPNVPQ------RDEDIFVSVFSNWRNWDLSDITRSYIYKKIF 1550

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/1472 (29%), Positives = 703/1472 (47%), Gaps = 120/1472 (8%)

Query: 119  DGDASENAKLPCRFLLQCDGLEVFVYNKI----------------------------DVY 150
            D D ++N KL   F + C G E+F+YN+                             D++
Sbjct: 175  DYDYNKNKKLDSLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIF 234

Query: 151  ESVLRD-----------------HFTNVTKDGQETESNDDITINTEXXXXXXXXXXXXXX 193
            E V  +                 HF +  K  +E+ SN  I+ +++              
Sbjct: 235  EEVSSEIKNCNEYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNID---- 290

Query: 194  XXXXXXXXTDAPKLSAKT------KLFPIQLEANRAAIVLGNRNTRHVGVFKFEQAKGVY 247
                     +  K+SA         + P+ +  N+ AI +GN+ TR + V  F +A G+ 
Sbjct: 291  ---------NRNKISAHIMRKLHLDILPLDININKGAITIGNKFTRSLLVINFTEAHGLL 341

Query: 248  DIFSSISDLDYYRTKISLDLYDALFELRTNLGYQNDNPIKTFVVEKTMDKIWQTVKK--Q 305
            D     S LD ++ K++ ++ D    ++ N+GY  +   +       + +IW  ++    
Sbjct: 342  DYALPDSKLDVFKNKVTFEINDIDMSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLN 401

Query: 306  CISISKLLLPNQGKTINNQQAYIDSWKGLDLYH----HTKAVQEENVDTTVLHEQEYARY 361
             I   +L    +         ++  W GL LY      +  +  ++VD       EYA+ 
Sbjct: 402  LIPTGRLKTWYESLRYKEDTTFVKKWDGLVLYKDSVKSSTKLGADDVDFD-FANHEYAKV 460

Query: 362  SRVMKAERVSLTYYFDIPGIVPANSSSINSQSDRDESLNCNQDDDTPAFGTDIHIYTAAV 421
            S   KA ++  +   DIPGIVP  S    S++      +    +  P F  D+ +  A++
Sbjct: 461  SNFFKAPQIIFSIESDIPGIVPHGSHPPLSKA---HGPDIGNHESPPTFLIDLQLSHASI 517

Query: 422  YYGPWAHKHMQDIIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSVDFRDKSVLHIPTRE 481
            Y+G W ++++ D+  L  P++S+DQ    K +PG  R++  F  SV   D S + +PTRE
Sbjct: 518  YFGSWVNRNIVDLRDLMFPVISKDQKPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTRE 577

Query: 482  SSKDEEFIKRYKTTGDTHRAFGWLNVSLNEGGEILFNLALCSQADRLPNELYVLLLNPEI 541
             SKD +F+K+Y  T D  RAFGW+++S  +G E + N+ +   +    N L+      E+
Sbjct: 578  PSKDSDFLKQYLETKDDFRAFGWIDLSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEV 637

Query: 542  KSSVNHEVLFRCNTQTIKANIGYPTGWNKQADWLFELDSRTAELFLLRDHISLISDLFTD 601
             +SVNH +LF+ N+  I ANIGYP GWN   +W+F ++S+  ++FLLR+HI+L+SD+  D
Sbjct: 638  TTSVNHNLLFKSNSLNIAANIGYPLGWNDPVNWIFNINSKQLDIFLLREHITLLSDMIID 697

Query: 602  FSANDALRYELFRPFTYEIKWVFTEYKLFXXXXXXXXXXXXXXXXXXCFLSLSGDILNTS 661
            FS  +   YELFR FTY +      Y  +                  C+LS  GD+  + 
Sbjct: 698  FSTQEPTPYELFRSFTYNLNLKIGGYSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSE 757

Query: 662  INLPFTSIVKEPHETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFGECPDFSMTGTYISF 721
            I +P  S+ ++    ++ + +P+ +L ++ P WNTL EF+     G   DF ++GTY+ +
Sbjct: 758  ITIPIISLAQQYVTISYEIFTPMFRLFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIY 817

Query: 722  PSVDVDNTDTILIDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHFKTTEEYSNDLSMEE 781
              +D+DN D++ IDF S+ST    FGFV++Y+MN + NYFG F  F TTEEYS     E 
Sbjct: 818  SELDIDNVDSLTIDFESNSTVLYCFGFVIKYMMNFQANYFGSFIKFITTEEYS-----EL 872

Query: 782  DTKTKTKNFQEQPTNDVESLTS-SSSDGSYQVADTINENTIHKSSLLRTKNETDVWITFF 840
                   N     TND+ S+      D      + IN+ TI +S LLRT+NETD+W+ F 
Sbjct: 873  IRNNVNDNLGSINTNDLTSIEGLQKMDSITNDVEDINQKTIKRSDLLRTENETDIWLNFK 932

Query: 841  VNDGCIIIPENLYDCQRSFLLSFRRLEFDMRYTNYFMDLTAFFSRIYLNHSNEF------ 894
            VNDG +I+PE LY+      LSF  L  +MR  NY+MD+   +  +Y N+ N F      
Sbjct: 933  VNDGALILPEELYNGDSCVSLSFGELFINMRTCNYYMDV---YITLYDNNLNRFEKIDPH 989

Query: 895  SFNRVVAIEESHSENTGYLDDLNLHGHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLF 954
                 +      S   G + D+ +HGHRM+G+PP E TY C+W I+IG+   DSD  FL 
Sbjct: 990  ELFEYIQTRNRSSSVEGNISDITIHGHRMYGLPPKELTYFCQWSINIGTFLIDSDMIFLL 1049

Query: 955  SFLEAIQKVGFTYKDAENILIYSIHKPEDVTSLTISIGRVSSIVRTN-HGGSATLSLNDI 1013
            SF++++ K+GF   + EN L+Y      D+T L++ +  +  I+        A +  + I
Sbjct: 1050 SFIQSLNKIGFFLSNKENSLLYESDTVNDMTLLSVDVESLKVILSDPLLEARAEIGASSI 1109

Query: 1014 TINSWDLSNSRYSKRVDLLVA----AISVCAIDEKKTVLFTCDTAVELTKFVVRSNMKNH 1069
             I + D  N +Y+KR+D+  +    ++    ID  K  +    T + +T F    N  NH
Sbjct: 1110 IIRNIDFENEKYTKRLDVNASEFYFSLDSLKIDSGKKNILDVRTKLNITNFFKTDNHINH 1169

Query: 1070 RVTQQNCVLLNDSPFHRCKFLLAFDQLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDN 1129
              TQ+  + L+DSP+HRC FLL  ++   S+ Y +L GSITPS SLP L  P  + T + 
Sbjct: 1170 LDTQRKFIGLHDSPYHRCFFLLP-EKFQESSSYKELYGSITPSFSLPMLPIPHIYSTTNF 1228

Query: 1130 IYERLLGSYINLINFDTDIIDTKNXXXXXXXXXXXXXXSNTVSNDLSGQLAEE--FESEN 1187
            I E +L  Y   +  D     + N               +    +    L  E  +E++N
Sbjct: 1229 IVEGILDDYSEFLLSDHHNQMSINAELNSVDTTPLKDSFDMQITNFQNILTTEDPYETDN 1288

Query: 1188 TTVNISTLSVFVTPK-AFTFAENAAHFMLTMSTESIMDYFEMNIVNIFSVGHITNGKFFN 1246
              VN+  L+V V P   FT  + +  F    S  + +D  EM IVN              
Sbjct: 1289 FVVNVKYLTVTVNPDIVFTIEKFSTEFNKKFSMNNQIDGIEMAIVN-------------- 1334

Query: 1247 SSVMLKNVKVNISDETALDKTQLEALDRL--ELSVSNISVISKILKYPQNLEQS-NESTG 1303
                L ++K NIS +  ++   +E +D       V  I     +LK+  + E + N + G
Sbjct: 1335 ---RLSDLKENISSKINVN-LNVEKIDAAWGHRDVCFIGTYINMLKFELSQESTYNNNGG 1390

Query: 1304 ITDDSTISCNFDSLQFNIFKSSKNRLTKVLPIAWFEIL-MFNTVLFSDVGKVSKLIFGSI 1362
            +  D T+   F S++  I   S N  +   P     +L  F     +   +++ L   S 
Sbjct: 1391 LQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSLMLEGFEAWSSTTTKQLTTLNLTSF 1450

Query: 1363 KSAILDADVEWTVEYLLKLAKAFCKEGKSCIELGKLRSIDMKETIIRVAELGKISGIDSV 1422
               + +  + W + Y+      F K   S   +   ++   K  I  +   G+   ID  
Sbjct: 1451 DITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDEQASYQKTFITSLIWAGEKYQIDHD 1510

Query: 1423 PYIITKPAYITRLSKFHVRDTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKD 1482
            PY+ITKPA + RLS +H+R+  SW+I+T+LRH+  +     E     +D+ +      + 
Sbjct: 1511 PYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTYLPEDWEDRLDEEDLIKRSGLEKEA 1570

Query: 1483 KSQFLDIFVDWKNWDVYEVEQSSLFTLLFSGE 1514
             S FL++F +W+NW+V ++E+S ++ ++F  E
Sbjct: 1571 ASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEE 1602

 Score =  548 bits (1412), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 353/1119 (31%), Positives = 593/1119 (52%), Gaps = 61/1119 (5%)

Query: 1834 NTLLTDIGLDTDIVKLTLSDNRVYI-------EELTDSLN--GTVSELIKIFKNKNADNE 1884
            N  L D+ + + I+KLT SD R  +       +EL +SL    ++  L     N+ A++E
Sbjct: 1950 NEKLIDLEISSSILKLTTSDPRRMLFSFLQDEKELKNSLTFLRSLESL-----NRKANSE 2004

Query: 1885 PAAPKFKPCSFKMN--AIYIGLLTDLKTTNYVLEFNETAFSCASRAEALEETHANDNLRE 1942
             +   F    + +N  + Y+G+L  ++ T YV E ++   + +++ E     H       
Sbjct: 2005 DSETLFSSYEWIVNFKSKYMGVLLPIQATYYVFELHDALSTVSNKEEPSSAVHKK---FH 2061

Query: 1943 MSLVIQNVCILVLNPEVLPTLSKIFDIGFALKL----IEDDIKKTLQIETPHSRVMLAPS 1998
              L   ++  L+ +  +    SKI D  F++KL      ++  ++ +IE+   RV L P 
Sbjct: 2062 GDLSFDHIIFLIKDQSIPHKFSKILD--FSIKLSTHRTVNNFDRSFEIESSFFRVCLTPF 2119

Query: 1999 TLIAVIFFIQEAKVSLQKVKQKGKFN----------SSSNAIEIPPYFETLSVNILSNKL 2048
            +LI  ++   +    L     +   N           ++N+ E    F   S +ILS   
Sbjct: 2120 SLIQTMWGYYQLLYLLNSYYDQSTVNFFVFNDNNIDGATNS-EKENVFSVRSFHILSYNF 2178

Query: 2049 CLGWIFEE-DTDENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFFANG--V 2105
             +GW++++ D    G+++GY  LF+ YE  +GKLT+VDG+ + A G  S + F+++G   
Sbjct: 2179 SIGWLYQDSDNTIPGLILGYNRLFSTYEDNHGKLTLVDGFFSLANGS-SGDTFYSSGDES 2237

Query: 2106 PELNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQXX 2165
             + NRS+L ++QI +W       K LF++ + + LDV      V I+     SI+ FQ  
Sbjct: 2238 SKFNRSYLPNIQILYWIKEIEKMKHLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTL 2297

Query: 2166 XXXXXXXXXXXXXTHNVAEN--LSD-KVSILS-IRSINCIAKYGGGIINLYTPDDIAQDS 2221
                           +   N  L++ K  I   ++ +NC   Y GG+  L++   +  + 
Sbjct: 2298 KREKINPLVKAKPERDEKSNSALTNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMT-NK 2356

Query: 2222 PKSSLELTSPSIEVSLDYMHNFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQK 2281
             + +L + SP +++ L Y +     K+HWI  L+++E T N+L S CVP L +  ++I+ 
Sbjct: 2357 LEPTLMIKSPKVKIMLSYDYFEKELKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKD 2416

Query: 2282 QMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAKI 2341
             +E       Q V+  +E   N  +   +  +L +  D    +  G Q++TL CEP+AKI
Sbjct: 2417 IVEL------QDVN-MEENMDNNVKDPINITSLLENFDICFKLISGTQHVTLDCEPKAKI 2469

Query: 2342 QADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFML 2401
              D+GF +F  S+ T   +  +PL +SL+ ++I+ S +H FS E S+S  ++++ +  + 
Sbjct: 2470 NTDVGFGSFEFSILTPHLNPIDPLDISLKINDIKTSVKHQFSNEASASFEVSKLDVILIF 2529

Query: 2402 THENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKL---GSGPHSGQKCQ 2458
            TH    + +G  L+ D+K + N+KQ Q I++FLDIW       +KL    S      K  
Sbjct: 2530 THP---EVFGTGLVDDVKLHFNLKQFQNISIFLDIWDVSKSTEKKLFKKDSNTLVDAKSS 2586

Query: 2459 PQALTEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFY 2518
            P A T   +  +PW +  I  N +  I+M  +LG++   +   WIS+ H  +    +  +
Sbjct: 2587 PIAQTIVNSSTLPWSFVFIATNINGDINMGSTLGNLALNLQRTWISTDHFHNKRQLLHLF 2646

Query: 2519 LDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHS 2578
             D +   S+GRLGG  EI +I +   +++  K     +PL++L F +  +S K+ FDYH 
Sbjct: 2647 TDNVKISSEGRLGGFVEIDDITWKLDVNYVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHM 2706

Query: 2579 FLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRI 2638
            FLI+ V DL+  + +E+D   +L DLL V+++   + +  TAL ++N+ DIY T  R R 
Sbjct: 2707 FLISTVKDLKFHVLSEKDIDDILPDLLTVNLTCDEIKVCTTALVASNILDIYNTIMRTRQ 2766

Query: 2639 ENKKSYVQTLKESNPESSGKIHFSNNELLAPLRLRTNLTAEIGSFRLYVFPSTLFDSEVL 2698
            +NK SY++TL ESN     +     + L +   L+T+L+A I    L + PS+L+D+EV+
Sbjct: 2767 DNKNSYIETLLESNNNVLKRKPLYEDILKSLNLLQTSLSANIHELNLQISPSSLYDAEVI 2826

Query: 2699 VLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQAAL 2758
            +++   +     T+T +K KTDL  ++ +  +SL  F  ELTEE  AE+S E Y   A+ 
Sbjct: 2827 IIRVQDVFSSTETRTGEKIKTDLEMRVYNATLSLTSFGKELTEEDIAEMSAETYISYAST 2886

Query: 2759 LEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATHVR 2818
            L    I   P + + +TT+Q   +  +++ YS SF  KVD+ WNL PINFI+E+WATHVR
Sbjct: 2887 LTSGRIFEIPQLTINMTTFQNADNMILQYTYSCSFDGKVDVTWNLGPINFIKEVWATHVR 2946

Query: 2819 ALSVRRGHTEPSPSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLLRDLGNATPP 2878
            +L VR      +       + +  E +K++   +  +YI LEEP+IEMP ++DL +ATPP
Sbjct: 2947 SLEVRTVQFMGNHDISLENEGDTDESVKVL---SNIEYIALEEPYIEMPQIKDLKDATPP 3003

Query: 2879 IEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLG 2917
            +EWFG+NRK FP   HQ ++VP+QKL+ VA+ +Y + LG
Sbjct: 3004 LEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLG 3042

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/103 (44%), Positives = 67/103 (65%)

Query: 7   FRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQYKIKINL 66
           F  +S+S E+  S  FLV WIL V+      FY+ ++  + LT   ++ +W+   IK+ +
Sbjct: 8   FANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKVTI 67

Query: 67  QSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTR 109
           +SI++SFL G IFFKN+ ++  D TIS LE S TWRYWLL+TR
Sbjct: 68  ESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTR 110

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1256 (31%), Positives = 666/1256 (53%), Gaps = 74/1256 (5%)

Query: 1717 LDSSDLT---LTEMMKHARALLASIDDMKAITPDHDSE-----KKNGHVDLVWVLSLKVG 1768
            +DSS  T   LTE + + R  +  +  ++A+ P+  +E     + +G+     +   +V 
Sbjct: 1654 IDSSSATTKDLTESLPYVRDEIKYL--VEALVPELFAEPPIERESSGNKIHAVLFQGQVA 1711

Query: 1769 SLQLQTSAFVPFIIRILISGLDFNFKNLSGISIIVNYTELLLDFYFNQLKL--LRISNSV 1826
            ++ L+     PFII       +   ++   +   +N  E  ++    + KL   + +++ 
Sbjct: 1712 NITLKLQILSPFIILYCAENFELQAESTDSVIFDLNSGESYMEISSAKQKLDYFKYTHTC 1771

Query: 1827 TKVDYRSNT--LLTDIGLDTDIVKLTLSDNRVYIEELTDSLNGTVSELIKIFKNKN-ADN 1883
             K+   S++  L   I  D  I+KL++ D +  I +L   +   +  +  +    N + +
Sbjct: 1772 LKLSGTSSSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKAALFSMKSLSDILNISQS 1831

Query: 1884 EPAAPKFK------PCSFKMNAIYIGLLTDLKTTNYVLEFNETAFSCASRAEALEETHAN 1937
             P A  F       P +  + A Y GLL     T Y+LEFN   F      + L +    
Sbjct: 1832 SPTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEFNN--FEAKHTRDGLPDAITP 1889

Query: 1938 DNLREMSLVIQNVCILVLNPEVLPTLSKIFDIGFALKLIEDD--IKKTLQIETPHSRVML 1995
                ++   I++   L+ +  +   L+K+ D      ++ D     +++QIE+ H ++ L
Sbjct: 1890 RPCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQIESTHLKITL 1949

Query: 1996 APSTLIAVIFFIQEAKVSLQKVKQKGKFNSSS-----NAIEI--PPYFETL--SVNILSN 2046
            AP T++ ++  I E  +  ++  ++  +  SS      A E   P  +  +  S +ILS+
Sbjct: 1950 APMTVVRLLSLINEFGIIRKQFTEESIYTPSSAHNNSTATECLEPSVWRLIIKSGHILSH 2009

Query: 2047 KLCLGWIFE-EDTDENGIVIGYESLFAAYEKPYGKLTIVDGYVATAQGKESNNFFFANGV 2105
               + W+F+  ++  +G++ GY+ LF+ YEKPYGKLT+++ Y + A+   S   F+++ V
Sbjct: 2010 DFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAKILASEADFYSSVV 2069

Query: 2106 PE--LNRSHLSSMQINFWFSGQFIEKDLFVRMNADKLDVRILTTSVEIVNVMRSSIESFQ 2163
             +  +N S+LS MQ+ +WF+      DLF+R++  KL V I   S EIV ++  +I+S Q
Sbjct: 2070 RKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDI---SAEIVTLLEETIQSIQ 2126

Query: 2164 XXXXXXXXXXXXXXXTHNVAE------NLSDKVSILSIRSINCIAKYGGGIINLYTPDDI 2217
                               ++      N +++++   +RS+NCI  Y G  + L++ D  
Sbjct: 2127 TFNNLKKALVDPFRTKKQDSDISKEPYNWNNQLAT-GVRSLNCIINYAGVTLKLHSHDGR 2185

Query: 2218 AQDSPKSSLELTSPSIEVSLDYMHNFPS-QKQHWIRSLVNVESTHNILFSSCVPVLVNLT 2276
               SP   LELTSPS +V++DY + FP+ +K H  R+L+    THN  +S+   ++ +L 
Sbjct: 2186 GDASP---LELTSPSYKVAIDYKY-FPNLEKTHRFRTLITATPTHNTFYSTSAFLIHDLC 2241

Query: 2277 TEIQKQMERFNSEKKQLVHKTQEQTTNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCE 2336
                K ++  ++E K     +   +++ +    D   L   ID  I++NVG Q +T +CE
Sbjct: 2242 YRFSKLLKTSSTENKS---SSASTSSSIKVEGSDNSTLLGSIDLVIILNVGKQEVTFSCE 2298

Query: 2337 PRAKIQADLGFSNFRISMFTDSPDHSEPLSLSLQWSEIEISTRHIFSREISSSAGINEVY 2396
            P+AK+QA +GF  F I +F ++ +  E L L+++   +  ++RHI+SRE+ +S  +  + 
Sbjct: 2299 PKAKVQATVGFEKFDIKIFNNNINDEESLCLAIEIENLMTNSRHIYSREVCASLKLRHIS 2358

Query: 2397 LDFMLTHENTIKTYGNTLISDMKFYVNMKQLQEITLFLDIWSPKTKKAQKLGSGPHS--- 2453
            + F +      + YG+TLIS   FY NMKQLQ++ LF+D W P+ K     GS P     
Sbjct: 2359 MVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQWFPQ-KTPMNTGSYPEGVLV 2417

Query: 2454 ---GQKCQPQALTEFTTPKIPWIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVD 2510
                +    +     ++    W Y +I   + A I++ PSLG +N      W  S  +VD
Sbjct: 2418 DDISRSIGSKFYKGSSSSSFTWGYSVIVAGSCAEIELGPSLGVLNVTSEDVWAISKQQVD 2477

Query: 2511 WSHSVSFYLDELNSKSDGRLGGLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSS 2570
            WS  +   + +L+  S GRLGG F ++N      + WP   + F+ PL+ +      + +
Sbjct: 2478 WSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQVPLVCVKLGSDTVDT 2537

Query: 2571 KIGFDYHSFLIARVSDLQLAIRNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIY 2630
            K+ FDYH+F I+ +     ++ NERDE G L DLL V++SF SVNIFLTALA+AN+ DI 
Sbjct: 2538 KLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNIFLTALAAANISDIK 2597

Query: 2631 ATFARMRIENKKSYVQTLKESN-----PESSGKIHFSNNELLAPLRLRTNLTAEIGSFRL 2685
             +  R++ +N+ SY+ +   S+     PE  G I F    LL     RT L+  +G FRL
Sbjct: 2598 NSITRLKKDNELSYLSSFLASDQPSDEPEEDGGI-FDTLSLL-----RTQLSLNLGVFRL 2651

Query: 2686 YVFPSTLFDSEVLVLKANKMNVEAATQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFA 2745
             + P++LFDS+VL+L A KM      Q + K KTDL WQ+ D++++L  F N L E   A
Sbjct: 2652 QISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNNSLDESYLA 2711

Query: 2746 ELSVEEYNRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDP 2805
             + V +Y   ++ ++G  I +APS+ V +TTWQ+     IE LYS+SFG  V I+WNL P
Sbjct: 2712 TMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTVKIRWNLGP 2771

Query: 2806 INFIREMWATHVRALSVRRGHTEPSPSKPFFEDENIAEKIKI-VNLGTKYKYIPLEEPHI 2864
            I+FI++MW  H+ A+ +R G+               ++ + + ++LG+ Y+Y+PL+EP I
Sbjct: 2772 ISFIKDMWQAHMNAMQLREGYYHGLAESGVAVTPLNSKAVPLEMHLGSDYQYLPLQEPDI 2831

Query: 2865 EMPLLRDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLGDNL 2920
            EMP ++DLG+ATPPIEWFGVNR +FPG  HQ ++VPLQKL   AE +Y + LG  L
Sbjct: 2832 EMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFVIVPLQKLARTAEKEYEKILGRAL 2887

 Score =  622 bits (1603), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 441/1529 (28%), Positives = 714/1529 (46%), Gaps = 132/1529 (8%)

Query: 32   LCILAPFYLGRILAWVLTKGLDFWVWRQYKIKINLQSIKVSFLGGRIFFKNLTVVSNDFT 91
            + I A FY+GR+L ++++K  +  +W+QY++ +++QS+  S L G++ FKN++V S D  
Sbjct: 1    MVIFAIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQL 60

Query: 92   ISFLEGSFTWRYWLLHTRIRGIDFESEDGDASENAKLPCRFLLQCDGLEVFVYNKIDVYE 151
            IS L+G+ TWRYWL+    R           + +    CRF L+ +G E FVYN+  VY+
Sbjct: 61   ISVLKGTITWRYWLIGRYRRS---------GTADGARRCRFALKFEGFEYFVYNRNGVYD 111

Query: 152  SVLRDHFTNVTKDGQETESNDDITINTEXXXXXXXXXXXXXXXXXXXXXXTDAPKLSAKT 211
             + R+       DG++T +   +++ +                        D P +    
Sbjct: 112  RIARE------LDGEDTSAEPTVSVPS---------------VEEVIAELQDDPLIR--- 147

Query: 212  KLFPIQLEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISD----LDYYRTKISLDL 267
            +  P++   N+ AIVLGN+ T  V +  +E+  G   I   + D       +RT+  +  
Sbjct: 148  RFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSI--EVPDDTRAPSSFRTEAKIS- 204

Query: 268  YDALFELRTNLGYQNDNPIKTFVVEKTMDKIWQTVKKQCISISKLLLPNQGKTINNQQA- 326
             +    ++ N+ Y+ DNP+K +V  K   ++W+  K    ++ +  L  + K   +Q   
Sbjct: 205  -NCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTVLEATLHAKRKKEQHQTPK 263

Query: 327  YIDSWKGLDLYHHTKAVQEENVDTTV---LHEQEYARYSRVMKAERVSLTYYFDIPGIVP 383
            + D+W+GL +Y       +E +D  V   +   EYA+ + V+KA+++ +TY + +PG   
Sbjct: 264  WYDNWRGLSMY---DVNLDEELDEEVKFDIEHHEYAKCTTVLKADQMDVTYSYGMPGTAR 320

Query: 384  ANSSSINSQSDRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQDIIRLFSPIVS 443
                     +D D + N   +        DI +Y A   YGPWA++ +Q  +R+FSP V 
Sbjct: 321  V--------TDSDNAENPLLERPELDHSVDILVYDANCTYGPWANRQVQQCLRVFSPTVC 372

Query: 444  RDQMKATKPEPGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYKTTGDTHRAFG 503
            R+    T  E         FKLSV   + SVL +P +ESSKD  F+++YK T D  R FG
Sbjct: 373  RNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKESSKDAAFLEKYKQTRDETRPFG 432

Query: 504  WLNVSLNEGGEILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRCNTQTIKANIG 563
            W+++ + +   I   +A     +   N L+  L++  I +SVNH+ L +  +  I  +  
Sbjct: 433  WIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTISTSVNHDTLLKAKSHDITVDFS 492

Query: 564  YPTGWNKQADWLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELFRPFTYEIKWV 623
            YP GW  +A+W F + S  AELF+LRDH+ LISDL TDFS  + + YE FRPF Y  +W 
Sbjct: 493  YPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTDFSGGEEVLYEQFRPFDYRFRWD 552

Query: 624  FTEYKLFXXXXXXXXXXXXXXXXXXCFLSLSGDILNTSINLPFTSIVKEPHETTFLLKSP 683
               Y  +                  C+LS+ GD    + +LP TSI+++     F + +P
Sbjct: 553  IRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEITFSLPITSIIQKYVTVDFNIFTP 612

Query: 684  LVKLSIHPPCWNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTILIDFRSSSTKF 743
               L ++ P W+T  E L     G   +F++ G+Y S+  VDVDN D + I   +     
Sbjct: 613  HFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSYSEVDVDNVDALNIACETDYIVV 672

Query: 744  LSFGFVLRYLMNIKLNYFGDFNHFKTTEEYSNDLSMEEDTKTKT-KNFQ-EQPTNDVESL 801
            L +G +L+ ++N+K+NYFG+  HF+TTEEY  +L         T + F  +   +D + +
Sbjct: 673  LCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRNKQNPSTCRPFNSDGNVHDSDVV 732

Query: 802  TSSSS---DGSYQVADTINENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLYDCQRS 858
             + S+   D S+         TI KS+L R+ NE DVW TF    GC   PEN+Y     
Sbjct: 733  ATESNEIIDASFDAFG--GPPTIKKSALKRSINELDVWFTFISKGGCFFFPENIYKFDAC 790

Query: 859  FLLSFRRLEFDMRYTNYFMDLTAFFSRIYLNHSNEFS----FNRVVAIEESHSENTGYLD 914
                F  LE  +R+ NY++D       IY     +      F  +  I      +  YL 
Sbjct: 791  LGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHTDIDARTLFKVIEDIGIPIDASDAYLS 850

Query: 915  DLNLHGHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKDAENIL 974
              +   H+M G+ P EE+Y C++D+ + +L    D   L +F+  ++ + F +KD EN L
Sbjct: 851  QFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHCDLAVLKAFVNTLRNLAFGFKDVENSL 910

Query: 975  IYSIHKPEDVTSLTISIGRVS-SIVRTNHGGSATLSLN--DITINSWDLSNSRYSKRVDL 1031
             Y   +  D+  ++  I  V+  +   +      LSLN    T+ S+DL+N RYS+R DL
Sbjct: 911  QYEREQVFDLNKISCVIENVTVKLQNVDKDEDIWLSLNLPVTTLTSFDLANERYSRRSDL 970

Query: 1032 LVAAI--SVCAIDEKKTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPFHRCKF 1089
             +  +   +   D + T L    T V +T F         RV Q+  +L+ND+PFHRC F
Sbjct: 971  SIPELLFGIYRGDSESTCLGAFSTGVTVTLFERFEQFARCRVLQRKHILVNDAPFHRCSF 1030

Query: 1090 LLAFDQLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLINFDTDII 1149
            +L   +     +Y  L G I PS SLP   EP++   F+ I+E+LLG        D+   
Sbjct: 1031 MLP-PEYKKMPIYRSLYGCIPPSSSLPLFPEPISADNFEVIFEKLLGEIYQEYASDSSYQ 1089

Query: 1150 DTKNXXXXXXXXXXXXXXSNTVSNDLSGQLAEEF-ESENTTVNISTLSVFVTPKAFTFAE 1208
             T +               N   N   G  +  F  S+N    +S+  V   P       
Sbjct: 1090 ITDD-----SISSTEHDYHNQTVNAAIGTSSSLFIRSQNHQQTLSSFIVEFDPIDGYLDL 1144

Query: 1209 NAAHFMLTM-------STESIMDYFEMNIVNIFSVGHITNGKFFNSSVMLKNVKVNISDE 1261
            +A  FML +       S +  +D  E+ I+N F      +       V+  N+ +     
Sbjct: 1145 SATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQTFGEDNGISEVRVLCPNISL----- 1199

Query: 1262 TALDKTQLEALDRLELSVSNISVISKILKYPQNLEQSNESTGITDDSTISCNFDSLQFNI 1321
            +A +K    ++ +L   + N+ + S+I     NL+   E T      T+    D ++ NI
Sbjct: 1200 SATNKQSKFSMFKLSSKIKNLDITSRIKSSDPNLKPDPEKT------TLCYKIDYIRANI 1253

Query: 1322 FKSSKNRLTKVLPIAWFEILMFNTVLFSDVGKVSKLIFGSIKSAILDADVEWTVEYLL-- 1379
             +        V+P          + LFS   ++ +      K ++LD +V+     L   
Sbjct: 1254 VQDG-----IVVPPKQ------PSQLFSCSIELLEGYLSYDKLSLLDNNVQSCSVTLSPG 1302

Query: 1380 --KLAKAFCKEGKSCIEL--GKLRSID------MKETIIRVAELGKISGIDSVPYIITKP 1429
              KL   F     S  +L   +L S +       +E ++ +   G+   I   P +ITKP
Sbjct: 1303 TDKLLFEFLNPFISTFDLLQRELSSFEDTLLASKREFLLNILRGGRDYEIQHDPPVITKP 1362

Query: 1430 AYITRLSKFHVRDTASWKIITRLRHVSK------HTSHVSETTSQCDDIPEEVRNICKDK 1483
            A ITR S  H+R   SW+II RLRH+        H S      +Q    PEE        
Sbjct: 1363 ANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSFTRHLGTQDFTSPEEA------G 1416

Query: 1484 SQFLDIFVDWKNWDVYEVEQSSLFTLLFS 1512
             +FL IF DW++W+  +V+ S +   +F+
Sbjct: 1417 KEFLSIFSDWRSWEPTDVQGSFVHEKVFT 1445

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 58.5 bits (140), Expect = 8e-10,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 40/61 (65%)

Query: 4  SSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQYKIK 63
          SS FR + IS  +D S  FL DW+L + + +L+ FY GR+L + +T  L++  W++Y +K
Sbjct: 2  SSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGVK 61

Query: 64 I 64
          +
Sbjct: 62 V 62

>TPHA0E01950 Chr5 complement(402763..403758) [996 bp, 331 aa] {ON}
            Anc_5.398 YDR347W
          Length = 331

 Score = 39.3 bits (90), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 79/179 (44%), Gaps = 20/179 (11%)

Query: 2489 PSLGSINFK--VPTFWISSHHRVDWSHSVSFYLDELNS----KSDGRLGGLFEIKNIFFD 2542
            PSL  +N K  +P  + S   R  W   V  + DELN      +D R      I  +  D
Sbjct: 27   PSLDHLNEKDGLPGLYSSQGLRNAWYERVQHHTDELNKFVDENTDER-----PILQLIND 81

Query: 2543 SSISWPVKDNKFEAPLI-NLAFKMSHL-SSKIGFDYH-------SFLIARVSDLQLAIRN 2593
             S S+  ++    A +I NL F  + L +S + FDY        + LI    D++L  +N
Sbjct: 82   HSKSFTKRNLVKNAAMIHNLTFANNSLTASNVNFDYQLPLANKKTTLIKDSVDIKLNYKN 141

Query: 2594 ERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIENKKSYVQTLKESN 2652
            E D+    K    +  SFGS+  F T L ++NL      F  +     ++Y  +++ SN
Sbjct: 142  EPDKITYKKLYPAILSSFGSMVEFRTLLLNSNLGISGDGFTWLVARKHQAYDYSMESSN 200

>Skud_10.298 Chr10 (530592..530621,530625..531251) [657 bp, 218 aa]
            {ON} YJR074W (REAL)
          Length = 218

 Score = 32.7 bits (73), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 13/87 (14%)

Query: 2753 NRQAALLEGDIILAAPSVFVGITTWQKIPDTDIEFLYS----SSFGDK--------VDIK 2800
            N++  L  G II   P  F+  +T +++PDT   ++ S      FGD         VD+ 
Sbjct: 33   NKEVELYGGAIITVVPPGFLDASTLREVPDTQEVYVNSRRETEDFGDGLATNESIIVDLL 92

Query: 2801 WNLDPINFIREMWATHVRALSVRRGHT 2827
              +D  + ++E W  HV  L+   G T
Sbjct: 93   ETVDKAD-LKEAWKFHVEDLTELNGTT 118

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 305,306,836
Number of extensions: 13742611
Number of successful extensions: 45008
Number of sequences better than 10.0: 56
Number of HSP's gapped: 45579
Number of HSP's successfully gapped: 94
Length of query: 2923
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2795
Effective length of database: 38,804,151
Effective search space: 108457602045
Effective search space used: 108457602045
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)