Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19085g8.259ON1372137268030.0
SAKL0H17094g8.259ON1422138635240.0
Ecym_43118.259ON1376138134640.0
AGR089C8.259ON1370138933670.0
TDEL0F038608.259ON1399141533320.0
NCAS0B050008.259ON1409137233320.0
KLTH0G13750g8.259ON1399139033240.0
Suva_10.1708.259ON1416137932840.0
KAFR0B027108.259ON1416138332800.0
Kwal_56.238258.259ON1396138932730.0
Skud_12.1548.259ON1417136832470.0
Smik_12.1458.259ON1418138832460.0
Kpol_392.88.259ON1427141332410.0
YLR086W (SMC4)8.259ON1418138032390.0
NDAI0B019708.259ON1415137232170.0
ZYRO0C01716g8.259ON1413137131950.0
KNAG0G020208.259ON1444139331390.0
TBLA0E044108.259ON1422141130020.0
TPHA0J007208.259ON1393139429940.0
CAGL0L12188g8.259ON1398141028770.0
NDAI0G033208.68ON123113416626e-70
Suva_6.528.68ON126413296582e-69
Smik_6.718.68ON122813186386e-67
KLTH0A02706g8.68ON122813466351e-66
Skud_6.648.68ON123013126306e-66
YFL008W (SMC1)8.68ON122513236252e-65
NCAS0C040008.68ON122313246225e-65
KLLA0D07502g8.68ON124313415922e-61
Kwal_23.50438.68ON12257714387e-43
TDEL0C009608.68ON12227484092e-39
KNAG0G009108.68ON12267484073e-39
TBLA0G035308.68ON12327773984e-38
SAKL0B02288g8.68ON12281753441e-31
TPHA0P003408.68ON12191643385e-31
KAFR0C032008.68ON12231633369e-31
Ecym_73038.68ON12221693172e-28
SAKL0F07282g7.186ON117010383135e-28
CAGL0F02079g8.68ON12231623135e-28
AGL023W8.68ON12221613101e-27
ZYRO0F03828g8.68ON12171623101e-27
Kpol_1011.58.68ON12217182974e-26
Suva_6.1047.186ON11707352841e-24
Smik_7.3467.186ON11707372804e-24
Kpol_1063.207.186ON11717262786e-24
AGR236W7.186ON11707312761e-23
Suva_6.1491.295ON12307592625e-22
CAGL0D05258g7.186ON11707392625e-22
KAFR0G029307.186ON11707182625e-22
Kwal_55.204217.186ON11707322608e-22
Ecym_43907.186ON11708262591e-21
Kpol_1018.21.295ON12117322535e-21
TDEL0D016201.295ON12237192446e-20
TPHA0C044407.186ON11703082358e-19
NDAI0G020707.186ON11711902349e-19
YFR031C (SMC2)7.186ON11702382303e-18
KLTH0E04774g7.186ON11707182277e-18
KLLA0D16005g7.186ON11702072213e-17
ZYRO0D15642g7.186ON11701862161e-16
Kwal_14.24351.295ON12474402134e-16
KAFR0A016101.295ON12273082115e-16
KLLA0A00286g1.295ON12247532062e-15
TDEL0H026107.186ON1170862018e-15
NCAS0E019207.186ON1170731982e-14
TBLA0D046107.186ON1174731982e-14
TPHA0I010901.295ON12162001982e-14
ZYRO0G21296g1.295ON12271091982e-14
KLTH0H09966g1.295ON12241211982e-14
KNAG0L011607.186ON1170731963e-14
Skud_6.1197.186ON1170731963e-14
SAKL0D06116g1.295ON1229731954e-14
Ecym_63221.295ON12321961954e-14
AAL182W1.295ON12311981911e-13
KNAG0B052301.295ON12251051883e-13
NCAS0A093301.295ON12271101874e-13
NDAI0G056301.295ON12291051856e-13
Smik_10.1671.295ON1229821822e-12
YJL074C (SMC3)1.295ON12302011812e-12
Skud_10.1701.295ON12302011793e-12
CAGL0H02805g1.295ON12192501767e-12
TBLA0C027401.295ON11191391703e-11
SAKL0B09526g7.101ON10994611292e-06
Kwal_26.72047.101ON11174531274e-06
KLTH0D02816g7.101ON10941621265e-06
TDEL0E013404.237ON1106851169e-05
KNAG0D043404.238ON22203991113e-04
KNAG0L006307.101ON11082511104e-04
KLLA0F07997g7.101ON11191901095e-04
ZYRO0B12122g4.237ON1109791079e-04
AEL337C7.101ON10973221040.002
Ecym_26257.101ON10971511020.004
CAGL0F01155g7.101ON11054681020.004
Skud_15.1217.101ON10931861010.004
KAFR0D013307.101ON10801811010.004
TBLA0E021907.101ON10894511010.004
NCAS0J013904.237ON1096791000.006
CAGL0H05071g4.237ON111079990.007
CAGL0D00924g4.238ON1980193980.010
TPHA0B008404.237ON111968980.011
Skud_12.4684.237ON112068970.012
YLR383W (SMC6)4.237ON111468970.012
Smik_12.4704.237ON111468970.013
Suva_10.5004.237ON111568970.013
NDAI0J021804.237ON110868970.013
KNAG0B060104.237ON111768960.015
KAFR0A060404.237ON1102124960.015
Kpol_1044.137.101ON1103268960.015
ZYRO0G01584g7.101ON1088430960.017
Ecym_53444.237ON110258950.020
NCAS0I005707.101ON109562950.023
NDAI0A084507.101ON111962940.027
TDEL0H034907.101ON110385940.027
KLLA0E05303g4.237ON109870940.028
Suva_15.1337.101ON1092358940.030
Smik_15.1317.101ON109362940.031
YOL034W (SMC5)7.101ON109362940.032
TPHA0L006007.101ON111742940.032
Kpol_483.104.237ON1118132930.038
Kwal_26.93804.237ON110285920.050
TBLA0I028904.237ON109871910.069
AER044W4.237ON110356900.082
SAKL0H03322g4.237ON111152870.18
TBLA0A053001.67ON70763860.23
KAFR0J017702.215ON16191810.27
NCAS0D036106.179ON931164850.31
TDEL0G028102.351ON109471840.50
AER045C4.238ON1292234830.54
KLTH0D14080g4.237ON110258820.73
KLLA0F00770g8.604ON628144810.93
Suva_7.5305.88ON894215801.2
Skud_9.195.702ON1680179801.4
TPHA0B008304.238ON2536403791.7
CAGL0L08338g2.215ON16162732.8
Ecym_40245.696ON662127772.8
KAFR0A019902.542ON560157763.1
NCAS0B087001.67ON71572754.7
CAGL0D03938g5.312ON623112745.8
SAKL0G11110g5.267ON1871263755.9
KLTH0B01100g1.527ON129890746.6
ZYRO0A07524g2.351ON109063746.9
CAGL0A02596g5.414ON872120747.2
KNAG0L020105.689ON702141737.9
ZYRO0D09988g3.492ON99476738.8
TPHA0C042502.542ON556164729.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19085g
         (1372 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  2625   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1362   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1338   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1301   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1288   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1288   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1285   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1269   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1268   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1265   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1255   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1254   0.0  
Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  1253   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1252   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1243   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1235   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1213   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1160   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1157   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1112   0.0  
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             259   6e-70
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...   258   2e-69
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   250   6e-67
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   249   1e-66
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   247   6e-66
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...   245   2e-65
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....   244   5e-65
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   232   2e-61
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   173   7e-43
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   162   2e-39
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   161   3e-39
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   157   4e-38
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   137   1e-31
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   134   5e-31
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   134   9e-31
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   126   2e-28
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...   125   5e-28
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   125   5e-28
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...   124   1e-27
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   124   1e-27
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   119   4e-26
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...   114   1e-24
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...   112   4e-24
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...   111   6e-24
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...   110   1e-23
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...   105   5e-22
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...   105   5e-22
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...   105   5e-22
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...   104   8e-22
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...   104   1e-21
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...   102   5e-21
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    99   6e-20
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    95   8e-19
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....    95   9e-19
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    93   3e-18
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    92   7e-18
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    90   3e-17
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...    88   1e-16
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    87   4e-16
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    86   5e-16
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    84   2e-15
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    82   8e-15
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    81   2e-14
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    81   2e-14
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    81   2e-14
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    81   2e-14
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    81   2e-14
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    80   3e-14
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    80   3e-14
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    80   4e-14
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    80   4e-14
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    78   1e-13
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    77   3e-13
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    77   4e-13
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    76   6e-13
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    75   2e-12
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    74   2e-12
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    74   3e-12
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    72   7e-12
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    70   3e-11
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    54   2e-06
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    54   4e-06
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    53   5e-06
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    49   9e-05
KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {...    47   3e-04
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    47   4e-04
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    47   5e-04
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    46   9e-04
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    45   0.002
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    44   0.004
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    44   0.004
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    44   0.004
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    44   0.004
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    44   0.004
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    43   0.006
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    43   0.007
CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} simil...    42   0.010
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.011
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.012
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    42   0.012
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    42   0.013
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    42   0.013
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    42   0.013
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    42   0.015
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    42   0.015
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    42   0.015
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    42   0.017
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    41   0.020
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    41   0.023
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    41   0.027
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    41   0.027
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    41   0.028
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    41   0.030
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    41   0.031
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    41   0.032
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    41   0.032
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    40   0.038
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    40   0.050
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    40   0.069
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    39   0.082
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.18 
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    38   0.23 
KAFR0J01770 Chr10 (339037..339522) [486 bp, 161 aa] {ON} Anc_2.2...    36   0.27 
NCAS0D03610 Chr4 (671837..674632) [2796 bp, 931 aa] {ON} Anc_6.1...    37   0.31 
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    37   0.50 
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    37   0.54 
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    36   0.73 
KLLA0F00770g Chr6 (65967..67853) [1887 bp, 628 aa] {ON} some sim...    36   0.93 
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    35   1.2  
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...    35   1.4  
TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4....    35   1.7  
CAGL0L08338g Chr12 complement(920067..920552) [486 bp, 161 aa] {...    33   2.8  
Ecym_4024 Chr4 (57388..59376) [1989 bp, 662 aa] {ON} similar to ...    34   2.8  
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    34   3.1  
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    33   4.7  
CAGL0D03938g Chr4 (392433..394304) [1872 bp, 623 aa] {ON} weakly...    33   5.8  
SAKL0G11110g Chr7 complement(942330..947945) [5616 bp, 1871 aa] ...    33   5.9  
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...    33   6.6  
ZYRO0A07524g Chr1 (615902..619174) [3273 bp, 1090 aa] {ON} highl...    33   6.9  
CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} simila...    33   7.2  
KNAG0L02010 Chr12 (357972..360080) [2109 bp, 702 aa] {ON} Anc_5....    33   7.9  
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...    33   8.8  
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    32   9.5  

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 2625 bits (6803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1312/1372 (95%), Positives = 1312/1372 (95%)

Query: 1    MTADSSVPHLGDSPEIKRQRVSQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPS 60
            MTADSSVPHLGDSPEIKRQRVSQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPS
Sbjct: 1    MTADSSVPHLGDSPEIKRQRVSQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPS 60

Query: 61   LQPPTAHAVRGREYSQXXXXXXXXXXXXXXXXKLELIRLSPKKSTRLELQKMHEANTQTS 120
            LQPPTAHAVRGREYSQ                KLELIRLSPKKSTRLELQKMHEANTQTS
Sbjct: 61   LQPPTAHAVRGREYSQSPPRSPTRSPTRSPTRKLELIRLSPKKSTRLELQKMHEANTQTS 120

Query: 121  QRLCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 180
            QRLCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ
Sbjct: 121  QRLCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ 180

Query: 181  GKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYY 240
            GKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYY
Sbjct: 181  GKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYY 240

Query: 241  VNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDII 300
            VNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDII
Sbjct: 241  VNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDII 300

Query: 301  GTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTIL 360
            GTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTIL
Sbjct: 301  GTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTIL 360

Query: 361  KAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTA 420
            KAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTA
Sbjct: 361  KAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTA 420

Query: 421  LETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKN 480
            LETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKN
Sbjct: 421  LETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKN 480

Query: 481  HDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSE 540
            HDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSE
Sbjct: 481  HDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSE 540

Query: 541  IKLSETKITMLKSSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTA 600
            IKLSETKITMLKSSHSNLLKEKATIESKIED               RNEKSKVEARISTA
Sbjct: 541  IKLSETKITMLKSSHSNLLKEKATIESKIEDLQLEELKQKETETSLRNEKSKVEARISTA 600

Query: 601  QKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGR 660
            QKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGR
Sbjct: 601  QKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGR 660

Query: 661  LGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCN 720
            LGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCN
Sbjct: 661  LGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCN 720

Query: 721  LDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLD 780
            LDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLD
Sbjct: 721  LDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLD 780

Query: 781  GKLIDISGTMSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHE 840
            GKLIDISGTMSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHE
Sbjct: 781  GKLIDISGTMSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHE 840

Query: 841  MESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDE 900
            MESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDE
Sbjct: 841  MESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDE 900

Query: 901  EKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEX 960
            EKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHE 
Sbjct: 901  EKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEK 960

Query: 961  XXXXXXXXXXLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIEN 1020
                      LDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIEN
Sbjct: 961  QKKEKTRSKKLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIEN 1020

Query: 1021 NERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSL 1080
            NERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSL
Sbjct: 1021 NERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSL 1080

Query: 1081 QSLKIRDVSKLLSQLNDGIIESCTDVTAKVMNGDIVQTQSITDVGNNDAMEDSGEAATHS 1140
            QSLKIRDVSKLLSQLNDGIIESCTDVTAKVMNGDIVQTQSITDVGNNDAMEDSGEAATHS
Sbjct: 1081 QSLKIRDVSKLLSQLNDGIIESCTDVTAKVMNGDIVQTQSITDVGNNDAMEDSGEAATHS 1140

Query: 1141 GLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAV 1200
            GLPS                  HQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAV
Sbjct: 1141 GLPSLTETELENLDLETLELELHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAV 1200

Query: 1201 AKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 1260
            AKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV
Sbjct: 1201 AKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 1260

Query: 1261 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1320
            LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA
Sbjct: 1261 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1320

Query: 1321 NYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILHSS 1372
            NYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILHSS
Sbjct: 1321 NYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILHSS 1372

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1362 bits (3524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 730/1386 (52%), Positives = 952/1386 (68%), Gaps = 39/1386 (2%)

Query: 21   VSQSPTR-------TPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAHAVRGRE 73
            V  SPTR       TPRKLVLGSPEKKYA S    +++ S     P+LQPP     RGR 
Sbjct: 40   VKSSPTRQDRLPSPTPRKLVLGSPEKKYAYSQPSTSSSLS----VPNLQPPNVDGSRGRR 95

Query: 74   -YSQXXXXXXXXXXXXXXXXKLELIRLSPKKSTRLELQKMHEA----NTQTSQRLCIDKL 128
             YSQ                +LELI+LSP K+ R ELQK+++       Q   RLCIDKL
Sbjct: 96   FYSQSPPRSPHRSPNRSPTRRLELIQLSPVKNNRAELQKIYDEKNKDGNQCVHRLCIDKL 155

Query: 129  VLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIH 188
             L+NFKSYAG Q IGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLS+LIH
Sbjct: 156  SLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSDLIH 215

Query: 189  KSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNY 248
            KSE +P+L SCSV IHF YV D  +G T+       MV+ R+AF+NNSSKYY++GKESNY
Sbjct: 216  KSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYIDGKESNY 275

Query: 249  TEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQ 308
            TEVT+LL+++GIDLDHKRFLILQGEVESI+QMK KAE+++DDGLLEYLEDIIGTAK+K  
Sbjct: 276  TEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIGTAKYKAG 335

Query: 309  IEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQ 368
            IE  L EI+TLN+VC+EKENRFELV+KEK +LESGK+EALEFL+KE+  T+LK++L Q  
Sbjct: 336  IEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEALEFLEKEKSLTLLKSKLAQYH 395

Query: 369  IYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNV 428
            I+   RKL+ +  KIS LN    +EK++Y+  Q+E   L    N+ KK+   L+ E K++
Sbjct: 396  IWQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKLDKEHKDL 455

Query: 429  NSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIEL 488
             SK+R ++++  + +EK +++ +K   AEK    +E++   + +++E L  +    + +L
Sbjct: 456  TSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQKQYKEKL 515

Query: 489  HNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKI 548
              LN S+  E+ KL+EIK+ L +KT ++S E+ + ER LEP+  Q+QEK+S++KL+E++I
Sbjct: 516  LQLNESLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQMKLTESQI 575

Query: 549  TMLKSSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQ 608
             +LK S    ++    ++++IE                + E++ +  RI   +KEC  A 
Sbjct: 576  AILKESKEKKVQNIIQLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGEKECGSAS 635

Query: 609  KQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTID 668
             +  EM++VLI  RQ   EA++ L+  +NKN+VL AL +LQ SGRI GFHGRLGDLGTID
Sbjct: 636  SKLGEMKNVLISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRLGDLGTID 695

Query: 669  DQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPE 728
            D YD+AISTACPRLDDIVV+ VECGQQCI+HLRKNKLGY RFI+LDKLRK NL  I TPE
Sbjct: 696  DMYDVAISTACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNLSPIQTPE 755

Query: 729  NVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISG 788
             VPRLFDL+      F PAFYSVLRDTLV  DL+QANRVAYGKRRFRVVTLDGKLID SG
Sbjct: 756  TVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDGKLIDTSG 815

Query: 789  TMSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKL 848
            T+SGGG+    GLM+SK    + Y+ +EV+ +E +L+ +E N+  A+   H+ME AL+K 
Sbjct: 816  TLSGGGTHVMKGLMKSKQQPGAGYTPEEVQNIEKELNEREKNFHIAIETFHDMEEALKKF 875

Query: 849  TDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILR 908
             DR PEI+++I+K +L+  S   E++   ++L +L  +        + L D E KL +L 
Sbjct: 876  KDREPEIEVEIAKRRLDIESSSTELKLKQEQLKELETDRDGGSVEDRELADAESKLQVLS 935

Query: 909  QHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXX 968
            +   +  + +K  Q  I+ LK++IM+ GG +L++Q +KV S+ + I I+           
Sbjct: 936  EEYDEIENETKNKQQLINSLKEKIMKIGGTKLQLQNSKVNSINEQINIISSKQKKDRTAT 995

Query: 969  XXLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAELN 1028
               + DL R   +  + S ++  CN +IS +S     +  +  +++  + E    K E+ 
Sbjct: 996  KKAENDLKRLENQCREASNDIESCNLEISKISVLNTELEAKIYKLDTSLNETESLKEEVE 1055

Query: 1029 SSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDV 1088
               E++K  L     ++++FK+ E+E ++RLEKL+GL  ++KK+++  +  L SLKIRD+
Sbjct: 1056 EEFERVKTNLEEKTNNTSDFKSVEIEINNRLEKLNGLTSHIKKEIKYNKDELNSLKIRDI 1115

Query: 1089 SKLLSQLNDGIIESCTDVTAKVMNGDIVQTQ-------SITDV---------------GN 1126
            ++ L  LN+G +    +   +V + ++ + Q       +  D+               G 
Sbjct: 1116 TQTLQALNEGKLPEENEDDFEVQDEEVQREQREMSSDPNAMDIDEEQAAEQFQVQQTDGE 1175

Query: 1127 NDAME-DSGEAATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARR 1185
             D+M+ D  E  T +GLP                    +L  Y+DN + DI+VLEEYARR
Sbjct: 1176 IDSMDIDEYENETSNGLPKFSEAQLQSIQIEDVELQIDELNHYVDNAHVDIDVLEEYARR 1235

Query: 1186 LAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNA 1245
            LAEY++RKLDLNQAV KR+EVR  CE  K +RL+KFMEGF IISMTLKEMYQMITMGGNA
Sbjct: 1236 LAEYKKRKLDLNQAVLKRDEVRKNCEELKKKRLDKFMEGFSIISMTLKEMYQMITMGGNA 1295

Query: 1246 ELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1305
            ELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKY+PTPLYVMD
Sbjct: 1296 ELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYRPTPLYVMD 1355

Query: 1306 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQN 1365
            EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ LVGIYKNNNMT+STTLQN
Sbjct: 1356 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNNNMTRSTTLQN 1415

Query: 1366 IDILHS 1371
            IDIL+ 
Sbjct: 1416 IDILNG 1421

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1338 bits (3464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 720/1381 (52%), Positives = 945/1381 (68%), Gaps = 41/1381 (2%)

Query: 20   RVSQSPTR--TPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPT-AHAVRGRE-YS 75
            R S+ P    TP KL+ GSP +K+  S  QA++ ++  +  PSLQPPT +   RGR  YS
Sbjct: 5    RTSKKPKHLDTPSKLMFGSPGRKHVAS--QASSNSTTALRGPSLQPPTYSQLSRGRSVYS 62

Query: 76   QXXXXXXXXXXXXXXXXKLELIRLSPKKSTRLELQKMHEANTQTSQRLCIDKLVLNNFKS 135
            Q                ++ELI+LSP K++RLELQK+++    T++RL I  L+LNNFKS
Sbjct: 63   QSPPRSPNRSPAR----RIELIQLSPIKNSRLELQKIYDGKQTTTKRLSIKNLILNNFKS 118

Query: 136  YAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPS 195
            YAG+Q +GPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLS LIHKSE   +
Sbjct: 119  YAGVQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHEN 178

Query: 196  LASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLL 255
            L+ CSV+I F YV D  +G TK+LP    + V R+ FKNN+SKYY+NGKES+YTEVT+ L
Sbjct: 179  LSFCSVEITFQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFL 238

Query: 256  KEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEE 315
            + EGIDLDHKRFLILQGEVESIAQMK KA+ + DDGLLEYLEDIIGTAK+K QI   L E
Sbjct: 239  RNEGIDLDHKRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVE 298

Query: 316  IETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRK 375
            ++TLN++CMEKE RFELV+KEK++LE+GKE+ALEF+ KE++ T+LK++ LQ  I    +K
Sbjct: 299  MDTLNDICMEKEIRFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKK 358

Query: 376  LATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSL 435
            LA + DKISA   + + E+++Y  LQKE   L    +N +++ T +  E   +   K  L
Sbjct: 359  LAVTLDKISAFTEKLENERNKYGELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQL 418

Query: 436  EKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSI 495
            +++ ++++EKLKS+ +K   AEK    +E N +   N I  L +   + E  L  LN S+
Sbjct: 419  QRELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESL 478

Query: 496  SIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSH 555
              E+ +L+ IK+ L +KT  +S+E+ SLE++LEP+  +++ K S+IKL+E++I ++K S 
Sbjct: 479  HSERSELDAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESK 538

Query: 556  SNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNEMR 615
              L +E + +   IE                  E + + + ISTAQ EC+ A+K+  +M+
Sbjct: 539  LKLEQEISQLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMK 598

Query: 616  DVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAI 675
             VL   RQ + +A+  L+  +NKN+VL AL +LQ SGRI GFHGRLGDLGTIDD+YDIAI
Sbjct: 599  QVLTNHRQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAI 658

Query: 676  STACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFD 735
            S ACPRLDDIVVETVEC QQCI+HLRKNKLGY RFILLDKL+K N+ ++ TPENVPRLFD
Sbjct: 659  SVACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFD 718

Query: 736  LITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGS 795
            L TP  ++F PA YSVLRDTLVA+DL QANRVAYG RRFRVVTLDGKLIDISGTMSGGG 
Sbjct: 719  LTTPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGD 778

Query: 796  SPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEI 855
                GLM+SK  +   Y+ +EV++ME +L+ +ETN++ A     EME+ALQK  DR P I
Sbjct: 779  RVVKGLMKSKQRSNDMYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPNI 838

Query: 856  DIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTI 915
            D++ISK +++  +  +E++S    L +L      N+++  PL D E +L  L   L    
Sbjct: 839  DVEISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVALK 898

Query: 916  DASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXXXXLDIDL 975
            D SK   ++I +L+ +IM+ GG++L+ Q +KV SL Q ++I+              ++++
Sbjct: 899  DESKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELEM 958

Query: 976  ARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNE-RKAELNSSVEKL 1034
             RA+++K     ++  C  ++S  +   E+++ E  R  E +IE  E +K +LN   E  
Sbjct: 959  NRASKQKLGAENDINHCEIELSKTNNSHEALQ-EGLRETEHLIEVIEDKKEQLNQEHETA 1017

Query: 1035 KQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQ 1094
            K+ L        +FK++E+E    LEKL  L+ ++K ++   +  L +LK+RDV +LL +
Sbjct: 1018 KKNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQK 1077

Query: 1095 LNDG--IIESCTDVTAKVMNGDIVQTQSITDVGNNDAMEDSGEAATHS------------ 1140
            L++    +ES TD      N  I +      V ++DA  + GEA   S            
Sbjct: 1078 LDEHNLPLESLTDRAVTPSNQCIPEMT----VEDHDADMNDGEAKLISEDPNSFNDQESM 1133

Query: 1141 -----------GLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRLAEY 1189
                       GLP                    QL++Y+D    DI++LEEYA RLAEY
Sbjct: 1134 DVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLAEY 1193

Query: 1190 QRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELEL 1249
            +RRKLDLN++V KREE+RN+ E  K  RLE+FM+GFGIISMT+KE+YQMITMGGNAELEL
Sbjct: 1194 KRRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAELEL 1253

Query: 1250 VDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1309
            VDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA
Sbjct: 1254 VDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1313

Query: 1310 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDIL 1369
            ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ L+GIYK++NMTKSTTLQNIDIL
Sbjct: 1314 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNIDIL 1373

Query: 1370 H 1370
            +
Sbjct: 1374 N 1374

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1301 bits (3367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 705/1389 (50%), Positives = 932/1389 (67%), Gaps = 52/1389 (3%)

Query: 12   DSPEIKRQRVSQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMD--PPSLQPPTAHAV 69
            D P  K+ R+      TP KL+  SP++K  VS     ++ S TM    PSLQPP AH +
Sbjct: 2    DIPTPKKPRI----LDTPVKLLATSPDRKNVVSRG---SSVSTTMGLRGPSLQPPVAHQI 54

Query: 70   -RGR-EYSQXXXXXXXXXXXXXXXXKLELIRLSPKKSTRLELQKMHEANTQTSQRLCIDK 127
             RGR +YSQ                 +ELI+LSP K++RLELQ++++   +  +RLCI  
Sbjct: 55   SRGRSQYSQSPPRSPNRSPGRA----VELIQLSPIKNSRLELQRLYDTKQKKVERLCIRT 110

Query: 128  LVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELI 187
            LVL NFKSYAG Q +GPFH+SFSAVVGPNGSGKSNVIDSMLF FGFRANKMRQGKLS LI
Sbjct: 111  LVLENFKSYAGRQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLI 170

Query: 188  HKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESN 247
            HKSE++P L  CSV+I F YV D  +G T++L     + V R+AFKNN+SKYY+NGKES 
Sbjct: 171  HKSEKYPDLDFCSVEIQFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKEST 230

Query: 248  YTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKP 307
            YTEVTRLL++EGIDLDHKRFLILQGEVESIAQMK KAE + DDGLLEYLEDIIGT K+K 
Sbjct: 231  YTEVTRLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKA 290

Query: 308  QIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQR 367
            QIE+ L E+++LN++CMEKENRF+LV+KEK +LE GK+EAL FL KE+  T+L ++  Q 
Sbjct: 291  QIEQALVEVDSLNDICMEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQY 350

Query: 368  QIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTH----------EINNTKKE 417
             ++ +  KLA +   +S    + ++EK++    QKE   LT            +NNT KE
Sbjct: 351  HLFHNGSKLAKTLSNVSNTMNKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKE 410

Query: 418  STALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESL 477
            S A          K R LE++ ++ +EK KS+ +K   AEK  +  E + K   N+IE  
Sbjct: 411  SLA----------KMRQLERELVSNEEKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEY 460

Query: 478  KKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEK 537
               + + E  L  LNH+I   + +L ++K+ L +KT D+++E+  LE++LEP+ ++++EK
Sbjct: 461  ISQNQEYETSLTTLNHTIVDAQAELEKMKLALSDKTGDITKEVAVLEKELEPWTNKVEEK 520

Query: 538  QSEIKLSETKITMLKSSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARI 597
            +SEIKL E++I+++K +   L  E A +  +IE                  E S +   I
Sbjct: 521  KSEIKLVESEISIIKEADLKLESEIANLSQEIEQLRGNISHREESIETLNVESSSIRDYI 580

Query: 598  STAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGF 657
               ++EC  A+ +  EM+ VL+  RQ V +A++ ++  +NKN+VL AL++LQ SGRI G+
Sbjct: 581  LVGERECTSARSKLEEMKKVLVTHRQRVNDARSAVSSAENKNKVLTALSRLQKSGRIDGY 640

Query: 658  HGRLGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLR 717
            HGRLGDLGTIDD+YDIAISTACPRLDDIVV+TVECGQQCI+HLRKNKLGY RFILLDKLR
Sbjct: 641  HGRLGDLGTIDDKYDIAISTACPRLDDIVVDTVECGQQCIEHLRKNKLGYARFILLDKLR 700

Query: 718  KCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVV 777
            K NL    TPENVPRLFDL+ P    F PAFYSVLRDTLV  DL QANRVAYGK+R+RVV
Sbjct: 701  KFNLQPAHTPENVPRLFDLVKPKEPKFAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVV 760

Query: 778  TLDGKLIDISGTMSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSM 837
            TLDGKLIDISGTM+GGG    SGLM+S    +S Y+ +EV++ME +L+ +E N++ A   
Sbjct: 761  TLDGKLIDISGTMTGGGDRAASGLMKS-TQQSSLYTPEEVQRMEEELNEREKNFKVAFET 819

Query: 838  VHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPL 897
              EMESALQ   DR PEI++++SK +++  +  AE+ES  +R  +L R    + ++   L
Sbjct: 820  FQEMESALQNYLDRQPEIEVELSKQKMDIETISAELESKIERKLELERSNKTSIEDSSEL 879

Query: 898  LDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEIL 957
               E+KL  L   L   + AS+    +I +L+ +IM+ GG+EL+   +KV SL Q I+I+
Sbjct: 880  RTAEEKLAALNADLNSFMSASESKNQRIKELRAKIMEIGGLELQTLNSKVDSLNQQIKIV 939

Query: 958  HEXXXXXXXXXXXLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQV 1017
                          +++L RA +++    +++  C+ +I  +    ++I    + +++Q+
Sbjct: 940  AAKQKKDKTAQKKAELELKRARKQQITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQL 999

Query: 1018 IENNERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYE 1077
             +  E    L       K EL       + + + E+E +++L+KL  L  Y+KK++  Y+
Sbjct: 1000 SDLQEEIGTLTDEHAVTKHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYD 1059

Query: 1078 TSLQSLKIRDVSKLLSQLND-----GIIESCT-DVTAKVMNGDIVQT---------QSIT 1122
            + L  LK+RD+ +++  L +         S T D   + +   +++T         + I+
Sbjct: 1060 SKLSHLKLRDLGQVMLDLEENKSLQSFSHSPTPDTKRENIQSSMLETHLASPSPNERKIS 1119

Query: 1123 DVGNNDAME-DSGEAATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEE 1181
               NN +ME D   +   +GLP                    QLQDY+DN   DIE+L+E
Sbjct: 1120 IAENNLSMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDE 1179

Query: 1182 YARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITM 1241
            YA+RLAEY+RR++DLN+A+ KR+E R  CE  K  RL++FMEGFGIIS+TLKEMYQMITM
Sbjct: 1180 YAKRLAEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITM 1239

Query: 1242 GGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL 1301
            GGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL
Sbjct: 1240 GGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPL 1299

Query: 1302 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKST 1361
            YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ LVGIYKN+NMT+ST
Sbjct: 1300 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRST 1359

Query: 1362 TLQNIDILH 1370
            TLQN DI++
Sbjct: 1360 TLQNRDIIN 1368

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1288 bits (3332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 701/1415 (49%), Positives = 950/1415 (67%), Gaps = 72/1415 (5%)

Query: 10   LGDSPEIKRQRVSQSPTR-----------------------TPRKLVLGSPEKKYAVSNS 46
            + D+P  KRQRV+ + +R                       TP+KLV+G+ +     S S
Sbjct: 1    MPDTPLTKRQRVNDNESREFEAVNGSTKSPLTSNSNSTISHTPKKLVIGTNDD--TTSQS 58

Query: 47   QATTAASNTMDPPSLQPPTAHAVRGRE---YSQXXXXXXXXXXXXXXXXKLELIRLSPKK 103
            Q   ++S ++  PSLQ P + + RGRE   YSQ                KLELI++SP K
Sbjct: 59   QPIVSSS-SLQAPSLQHPNSSS-RGREQRTYSQSPPRSPGRSPTR----KLELIKISPVK 112

Query: 104  STRLELQKMHEA--NTQTSQRLCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKS 161
              RLELQ++++A  + + + RLCI+KLVL +FKSYAG Q +GPFH+SFSAVVGPNGSGKS
Sbjct: 113  KNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFHSSFSAVVGPNGSGKS 172

Query: 162  NVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPS 221
            NVIDSMLFVFGFRANKMRQ +LS+LIH SE  P+L SCSV++HF YV D  +G T+I   
Sbjct: 173  NVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQYVVDEPDGTTRIDEE 232

Query: 222  AGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMK 281
              T+VV R+AFKNNSSKYYVN KESNYTEVT+LLK+EGIDLDHKRFLILQGEVE+IAQM+
Sbjct: 233  KPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKRFLILQGEVENIAQMR 292

Query: 282  AKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLE 341
             KAEK+ +DGLLEYLEDI GTAK+KPQIE  L+EIE LNE C+EKENRF +VD+EK +LE
Sbjct: 293  PKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEKENRFHIVDQEKSSLE 352

Query: 342  SGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQ 401
            +GK+EALEFL+KE+  T+L+++++Q +I+ ++ KL ++ DK S L  +  +E  +Y    
Sbjct: 353  TGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKLKGQLDQENEKYSETL 412

Query: 402  KEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFS 461
            KE ++L  E     K    L  E K + ++KR L++  +A +EK+KS+ +K   AEK   
Sbjct: 413  KEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKIKSVNQKTNKAEKLLK 472

Query: 462  QSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEME 521
             ++ +  A    +  L+++  D E EL +LN  +  E+ KL ++KI L EKT ++S  + 
Sbjct: 473  SNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVKISLKEKTVNISAGIA 532

Query: 522  SLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDXXXXXXXXXX 581
              E+ LEP+  Q+Q+K++EI+L+E+++++LK +++ + K+   ++++I            
Sbjct: 533  QYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLKNEIARGGEEKLAKEK 592

Query: 582  XXXXXRNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRV 641
                 + E+S V A + TA  EC  A  +  +M ++LI QRQ   +A+A  +  QNK+ V
Sbjct: 593  VIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTLDARAAFSSAQNKSTV 652

Query: 642  LLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLR 701
            L ALTKLQ SGRI+GFHGRLGDLG ID++YD+AISTACPRL+DIVVE+VECGQQCI++LR
Sbjct: 653  LTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIVVESVECGQQCIEYLR 712

Query: 702  KNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDL 761
            KNKLGY RFILLDKLRK +  +I TPENVPRLFDL+ P  D F PAFYSVLRDTL A+ L
Sbjct: 713  KNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIPAFYSVLRDTLAAQSL 772

Query: 762  QQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLMR---SKATTASQYSRDEVE 818
             QANRVAYGK+RFRVV+LDGKLIDISGTMSGGGS    GLMR   + + +   +S +EV 
Sbjct: 773  AQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQNNSYSPDIFSPEEVA 832

Query: 819  KMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESY-- 876
            ++E +L+ KE +++ A     EME  L+KL DR+PEI +++SK+ +E  S ++E++    
Sbjct: 833  QLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLVMETESWMSELKLKEK 892

Query: 877  --------HQRLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDL 928
                     ++ +    E  + E   + L DE++ L           D +  ++ KI  L
Sbjct: 893  LLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALS----------DQTTTTRQKIAVL 942

Query: 929  KDRIMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXXXXLDIDLARATREKNKYSEE 988
            KD+IM+ GG EL++Q +KV S  Q +EIL              + +L ++ +      ++
Sbjct: 943  KDKIMEIGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVGNTQKD 1002

Query: 989  VLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAELNSSVEKLKQELLSIERDSNEF 1048
            + + +++I+ L E  ++++   E +E+ V E  +   E+N  +++LKQ L  +E    EF
Sbjct: 1003 LDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEF 1062

Query: 1049 KAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQLNDG---------- 1098
            K+ ++E +D+LEKL+ L  ++ K++R  E+ L +LKIRDV++ L  L++G          
Sbjct: 1063 KSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGESTNNSKMPN 1122

Query: 1099 -IIESCTD-VTAKVMNGDIVQTQSITDVGNNDAME-DSGEAATHSGLPSXXXXXXXXXXX 1155
             + E  T+   A    G+        +  N++ ME D       +GLP            
Sbjct: 1123 ELQEKRTEGADATRQEGEESDVSMEEEKSNDEVMEVDEKPHELENGLPRVSEAELKSLDV 1182

Query: 1156 XXXXXXXHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAVAKREEVRNKCESFKN 1215
                     LQ+Y+D+ N D+E+LEEYA+RLAE++RRK+DLN+AV +R+ +R K    K 
Sbjct: 1183 EDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRKVDLNEAVGERDAMREKLGELKK 1242

Query: 1216 ERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNIS 1275
             R ++FM+GFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+
Sbjct: 1243 RRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNIT 1302

Query: 1276 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1335
            NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI
Sbjct: 1303 NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVI 1362

Query: 1336 SLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILH 1370
            SLRNNMFELAQ LVGIYK  NMTKS +L+N DIL+
Sbjct: 1363 SLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILN 1397

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1288 bits (3332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/1372 (50%), Positives = 928/1372 (67%), Gaps = 36/1372 (2%)

Query: 21   VSQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAHAVRGREYSQXXXX 80
            ++ S + TPRKL+LG  + +YA S    ++++       +LQPP + + RGR+  +    
Sbjct: 48   INNSKSHTPRKLILGQNDNRYAFSQPSVSSSSFQVP---TLQPPDSSSSRGRKDIKSYSQ 104

Query: 81   XXXXXXXXXXXXKLELIRLSPKKSTRLELQKMHEANTQTS--QRLCIDKLVLNNFKSYAG 138
                        +LELI+LSP K+ R++L+++++A+   S  +RL I+KL LNNFKSYAG
Sbjct: 105  SPPRSPGRSPKRRLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAG 164

Query: 139  IQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLAS 198
             Q +GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE+FP L S
Sbjct: 165  QQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTS 224

Query: 199  CSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEE 258
            CSV + F Y  D  +G+TKI  +   +V+ R+AFKNNSSKYY+NGKESNYT+VT+LLKEE
Sbjct: 225  CSVDVEFLYAIDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEE 284

Query: 259  GIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIET 318
            GIDLDHKRFLILQGEVE+IAQMK KAEK++DDGLLEYLEDIIGT+K+K  IEK L EIE+
Sbjct: 285  GIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIES 344

Query: 319  LNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLAT 378
            LNE+C+EKENRFE+VD+EK +LESGK  ALEFL+KE++ T+ K++LLQ  ++ +N KL  
Sbjct: 345  LNEICIEKENRFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTN 404

Query: 379  SCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKD 438
            +  KISALN E+  EKS+ + LQ E       +N ++ +   LE E K     KR LE +
Sbjct: 405  TLQKISALNEEYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGE 464

Query: 439  FIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIE 498
             ++ DEKLK++ +K    EK  + +E    +  +EI+ L+K+  +   EL  LN  +  E
Sbjct: 465  HVSLDEKLKNLTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSE 524

Query: 499  KEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNL 558
            +E L  +K+ L EKT  +S+E+   E  LEP+  ++QEK++EI+L E++I++L+     L
Sbjct: 525  RESLEAMKLKLKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKL 584

Query: 559  LKEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNEMRDVL 618
              +   +  ++ +               + ++S +   IS  + EC + + +  EM++VL
Sbjct: 585  KNDIKVLSQEVSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVL 644

Query: 619  IQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAISTA 678
              QRQ   EA+  L   QN+ +VL AL KLQ SGRI GFHGRLGDLGTID+ YD+A+STA
Sbjct: 645  NMQRQRASEARLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTA 704

Query: 679  CPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLIT 738
            CPRLDDIVVETVECGQQCI++LRKNKLGY RFILLDKLR  N + I TP+NVPRLFDLI 
Sbjct: 705  CPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIK 764

Query: 739  PVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQ 798
            P    F PAFYSVLRDTLVA+DL+QANRVAYG+RR+RVVTLDGKLID+SGTMSGGG+   
Sbjct: 765  PKDSKFVPAFYSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVS 824

Query: 799  SGLM---RSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEI 855
             GLM   R        Y+ ++VE++E  LS KE N+  A +  +EME+ LQKL +R PEI
Sbjct: 825  KGLMMLQRKGQNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEI 884

Query: 856  DIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDI-----LRQH 910
            +++ISKI +E  +  AE++S  ++L +       N  N +   +EE K+ I     L++ 
Sbjct: 885  ELEISKIIMEIDTYSAEIKSKERQLQE-----KTNIDNSELQDNEELKVAIENLQKLKEE 939

Query: 911  LQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXXXX 970
                 D +K  + KI  LK++IM+ GGIEL++Q +KV S+ Q I+IL             
Sbjct: 940  HLALQDKTKAKKKKIASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKK 999

Query: 971  LDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAELNSS 1030
             D +L +A +       ++ +   DI  +SE+++ I      I++ + E    K  L   
Sbjct: 1000 SDTELEKAKKTLLTSKNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDE 1059

Query: 1031 VEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSK 1090
             ++LK +++ +E + NEFK+ E+E +++LEKL+GL  ++K Q+++ E SL  L +R + +
Sbjct: 1060 CDELKDKVVDLEENINEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQ 1119

Query: 1091 LLSQLNDGIIESCTDVTAKVMNGDIVQTQSITD----------VGNNDAME-DSGEAATH 1139
            +L  L++       +  AK  N   +  + I D          V ++D+M+ D+G     
Sbjct: 1120 VLMALDE-------ESEAKAPNNGTLSDEQIHDQTGHELTNTAVQDDDSMDIDNGAEVIS 1172

Query: 1140 SGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQA 1199
            +GLP                     L+ Y+++ + +IEVLEEY +RL E++ RKLDLN A
Sbjct: 1173 NGLPILSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDA 1232

Query: 1200 VAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEG 1259
            V KRE VR + E  K  R E+FM GFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEG
Sbjct: 1233 VDKRETVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEG 1292

Query: 1260 VLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1319
            V FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV
Sbjct: 1293 VTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1352

Query: 1320 ANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILHS 1371
            ANYIKERTKNAQFIVISLRNNMFELAQ LVGIYK  N T S T++N +IL+S
Sbjct: 1353 ANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNS 1404

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1285 bits (3324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/1390 (50%), Positives = 939/1390 (67%), Gaps = 63/1390 (4%)

Query: 24   SPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAH--AVRGREYSQXXXXX 81
            S +RTPRKLVLGSP+K++A S    T+++SN    P LQP  +   + RGR YSQ     
Sbjct: 32   SRSRTPRKLVLGSPDKRFAFSQP-VTSSSSNV---PYLQPLKSELSSSRGRVYSQSPPRS 87

Query: 82   XXXXXXXXXXXKLELIRLSPKKSTRLELQKMHEAN--TQTSQRLCIDKLVLNNFKSYAGI 139
                       KLELI+LSP K TRLE QK  +     Q  +RLCI++L L+NFKSYAG 
Sbjct: 88   PTRSPTR----KLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAGT 143

Query: 140  QEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLASC 199
            Q +GPFH+SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKLS+LIHKSE  P+L SC
Sbjct: 144  QVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDSC 203

Query: 200  SVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEG 259
             V++ F YV D  +G T +      +VV R+AFKNN+SKYYVNGKES+YT+VT LL++EG
Sbjct: 204  HVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKEG 263

Query: 260  IDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETL 319
            IDLDHKRFLILQGEVESIAQMK KAEK+ DDGLLEYLEDIIGTAK+KP IE+ L +I+ L
Sbjct: 264  IDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQL 323

Query: 320  NEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLATS 379
            N+VC EKENR+E+V++EK +LESGK+EALEFL+KE+K T L+++LLQ +++ ++ K   +
Sbjct: 324  NDVCQEKENRYEIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWKNSFKSTNT 383

Query: 380  CDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDF 439
             +KI  L  +   E+++Y   ++E + L  E  +       ++    ++ S+KR+ ++D 
Sbjct: 384  QEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDSESSLTSEKRTCDRDR 443

Query: 440  IATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEK 499
            ++ +EKLK+I++K   AEK    + ++  A   ++E L K+    E EL  LN S+ +EK
Sbjct: 444  VSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSLLVEK 503

Query: 500  EKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLL 559
             KL+EIKI L  KT  +S ++  +E++LEP+  ++QEK+S+IKL ETKI++LK S + + 
Sbjct: 504  TKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESLAKIA 563

Query: 560  KEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNEMRDVLI 619
            +E +  E+ I +                 E + ++ +I   Q EC+ A  +  EM+ VL 
Sbjct: 564  EEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMKAVLT 623

Query: 620  QQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAISTAC 679
              RQ   +AK++L+ F+NKN+VL AL +LQ SGRI+GFHGRLGDLGTIDD+YD+AISTAC
Sbjct: 624  THRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAISTAC 683

Query: 680  PRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLITP 739
            PRLDD+VVETVECGQQCI+HLRKNKLGY RFILLDKLR  N++ I TP NV RLFDL+ P
Sbjct: 684  PRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFDLVHP 743

Query: 740  VRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQS 799
            + + FR AFYSVLRDTLVA+DL++ANRVAYGK+RFRVVTLDGKLID+SGTMSGGG+   S
Sbjct: 744  IDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGNHRAS 803

Query: 800  GLMRS-KATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQ 858
            G+M+S +  T + ++ +EV +++ +L+ +E N++ A   +HEME ALQ L DR PEI+  
Sbjct: 804  GMMKSERLNTGASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDREPEIETD 863

Query: 859  ISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTIDAS 918
            ISK ++E  S ++E++    R + L +E  +NE +   L++   +LD L+   +      
Sbjct: 864  ISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNESSDDTLIEANSRLDSLKAECKLLEGEM 923

Query: 919  KFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXXXXLDIDLARA 978
            K  ++KI +L+++IM+ GG +L++Q + V S+ Q I I               + DL R 
Sbjct: 924  KSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKKAENDLKRY 983

Query: 979  TREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAELNSSVEKLKQE- 1037
             ++  + S ++  C       + +LESI+       E +  ++ +  EL +S++KL++E 
Sbjct: 984  EKQAGQLSVDIDQC-------TNELESIK-------ELISSSDNKILELEASIDKLQKEG 1029

Query: 1038 ------LLSIER-------DSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLK 1084
                  +  IER       +  +F   E++ +++LEKL+ L  ++ K        L+SLK
Sbjct: 1030 EEIEEKVREIERLIEEKSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLK 1089

Query: 1085 IRDVSKLLSQLNDGII-----------ESCTDVTAKVMNGDIVQTQSITDVGNNDAMEDS 1133
            IRDV+  L  LN  ++           +S    + +  NGD+++  ++     N+     
Sbjct: 1090 IRDVTATLQTLNKLLLSESRSGDELHGQSSEARSQEPSNGDLMEVDTVEGCMGNEPTASQ 1149

Query: 1134 GE-----------AATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEY 1182
             E             + S LP                    QL D+++N   DIEVLEEY
Sbjct: 1150 PEDQMDVDEPEEMETSPSDLPKLTEAQLKELNVEEVELEIGQLNDFVENAYADIEVLEEY 1209

Query: 1183 ARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMG 1242
             +RL ++Q RKL+LN+AV +R+ VR  C++ + +RL++FM GF  ISMTLKEMYQMITMG
Sbjct: 1210 TKRLVDFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMG 1269

Query: 1243 GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1302
            GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY
Sbjct: 1270 GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1329

Query: 1303 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTT 1362
            VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ LVGIYKN NMTKS  
Sbjct: 1330 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVA 1389

Query: 1363 LQNIDILHSS 1372
            L+N D+++ S
Sbjct: 1390 LENKDLINRS 1399

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1269 bits (3284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 696/1379 (50%), Positives = 945/1379 (68%), Gaps = 48/1379 (3%)

Query: 22   SQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAHAVRGREYSQXXXXX 81
            S + + TPRKLVL S E +YA S  Q T +A++++  P+LQPP A + RGR+Y +     
Sbjct: 54   SYAKSHTPRKLVLSSGENRYAFS--QPTNSATSSLHVPNLQPPEAPS-RGRDY-KAYSQS 109

Query: 82   XXXXXXXXXXXKLELIRLSPKKSTRLELQKM---HEANTQTSQRLCIDKLVLNNFKSYAG 138
                       +LEL++LSP K++R+ELQK+   H+ + +   RL IDKLVL NFKSYAG
Sbjct: 110  PPRSPGRSPTRRLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAG 169

Query: 139  IQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLAS 198
             Q +GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE+FP+L S
Sbjct: 170  KQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQS 229

Query: 199  CSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEE 258
            CSV +HF YV D  +G ++I      +V+ R+AF+NNSSKYY+NGKESNYT+VT+LLK E
Sbjct: 230  CSVAVHFEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNE 289

Query: 259  GIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIET 318
            GIDLDHKRFLILQGEVE+IAQMK+KAEK++DDGLLEYLEDIIGTA +KP IE  L +IET
Sbjct: 290  GIDLDHKRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIET 349

Query: 319  LNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLAT 378
            LNE+C+EKENRFE+V++EK +LESGKE ALEFL+KE++ T+LK++L Q ++  SN KLA+
Sbjct: 350  LNEICLEKENRFEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLAS 409

Query: 379  SCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKD 438
            + +K S+LN +F+ EK +++   KE + +  +    K   ++  ++ K +  +KR LE  
Sbjct: 410  TLEKTSSLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELEST 469

Query: 439  FIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIE 498
             ++ +E+ K++  K+  AEK    +  +   A + +E L     + E E+ +LN S+  E
Sbjct: 470  RVSLEERTKNLVNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEE 529

Query: 499  KEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNL 558
            +  L++IK+ L +KTKD+S E+   E+ LEP+  Q+QEK+S+I+L+E+++++L+ +   L
Sbjct: 530  RRILDDIKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKL 589

Query: 559  LKEKATIESKIEDXXXXXXXXXX-XXXXXRNEKSKVEARISTAQKECEEAQKQTNEMRDV 617
             K    +E  I                  +N KS ++ R S  +K+   A  +  EM+ +
Sbjct: 590  KKNAEALEENIAAKKARKQELQGFILDLKKNLKSLIDGR-SQGEKDFSTAHLKLKEMQTI 648

Query: 618  LIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAIST 677
            L   RQ   EA+++L+  +NK++VL AL++LQ SGRI GFHGRLGDLG IDD +D+AIST
Sbjct: 649  LNAHRQRAMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAIST 708

Query: 678  ACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLI 737
            ACPRLDD+VV+TVEC Q CID+LRKNKLGY RFILLD+LR+ NL  + TPENVPRLFDL+
Sbjct: 709  ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLV 768

Query: 738  TPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSP 797
             P    F  AFYSVLRDTLVARDL+QAN VAYGKRRFRVVT+DGKLIDISGTMSGGG+  
Sbjct: 769  KPKDPKFSNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHV 828

Query: 798  QSGLMR---SKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPE 854
              GLMR   +++     Y+ +EV K+E +LS +E N+R A   VHEME  L+K+ D+ P+
Sbjct: 829  VKGLMRIGKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPD 888

Query: 855  IDIQISKIQLEKGSRVAEVESYHQRL--SQLARELSMNEKNQQPLLDEEKKLDILRQHLQ 912
            ++ QI + ++E  S  +E+    +++  +++A + S+N+  Q       K + IL +HL+
Sbjct: 889  MESQILRAEMEADSLASELALAEEQVKEAKMAYDKSVNDTAQL-----NKIMKIL-EHLR 942

Query: 913  QTID----ASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXX 968
               D     +K  +++I  L+D+IM+ GG  L++Q +KV SL Q I+IL           
Sbjct: 943  GEYDDLQAETKTKKERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDIL-------VAKL 995

Query: 969  XXLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNER----- 1023
              +   + ++  +  K+ +++    +DI + S +L+ I  + E+I+  +I+N+       
Sbjct: 996  KKVKSGIKKSVGDVTKFQKQLKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGIL 1055

Query: 1024 --KAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQ 1081
              K++L    E+LK+++  +E   +EFK+ E+E  ++LEKL+ L  Y+K  ++  E  L 
Sbjct: 1056 NLKSDLEEQSEQLKEKVAEMEGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELN 1115

Query: 1082 SLKIRDVSKLLSQLNDG---IIESCTDVTAKVMNGDI---VQTQSITDVGNNDAME---- 1131
             L IRDV+  L  L++    I++   +   +    DI    + ++  + G+ND       
Sbjct: 1116 ELSIRDVTHTLLILDNNQMDILDKEGEDRQETNQEDISGEAKGETQGEEGDNDDRHCMNI 1175

Query: 1132 DSGEAATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRLAEYQR 1191
            D        G+P                    +L  Y+D  N DI VLEEYARRLAE++R
Sbjct: 1176 DETSDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKR 1235

Query: 1192 RKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVD 1251
            RKLDLNQAV KR+EV+ + E  K +R ++FM GF IISMTLKEMYQMITMGGNAELELVD
Sbjct: 1236 RKLDLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVD 1295

Query: 1252 SLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1311
            SLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL
Sbjct: 1296 SLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1355

Query: 1312 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILH 1370
            DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ LVG+YK +N TKSTT++NIDIL+
Sbjct: 1356 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILN 1414

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1268 bits (3280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 690/1383 (49%), Positives = 930/1383 (67%), Gaps = 48/1383 (3%)

Query: 26   TRTPRKLVLGSPEKKYAVSNS--QATTAASNTMDPPSLQPPTAHAVRGRE---YSQXXXX 80
            + TPRKL+LGS + KY +S     +++  S+++  P+LQPP +   RGR+   YSQ    
Sbjct: 43   SHTPRKLLLGSADNKYVLSQPIISSSSHGSSSLQVPNLQPPLSQPSRGRDKKAYSQSPPR 102

Query: 81   XXXXXXXXXXXXKLELIRLSPKKSTRLELQKMHEANTQTSQRLCIDKLVLNNFKSYAGIQ 140
                        KLELI+LSP K+ R+ELQK++ +  Q   RL IDKLVL +FKSYAG Q
Sbjct: 103  SPGRSPVR----KLELIQLSPIKNNRIELQKLYNSKNQNKVRLYIDKLVLQDFKSYAGTQ 158

Query: 141  EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLASCS 200
             +GPF+TSFSA+VGPNGSGKSNVIDSMLFVFGFRANKMRQ +L +LIHKSE FP++ SCS
Sbjct: 159  IVGPFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCS 218

Query: 201  VQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGI 260
            V++HF YV D ++G +KI+     +VV R+AFKNNSSKYY+NGKESNYTEVTRLLKEEGI
Sbjct: 219  VEVHFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGI 278

Query: 261  DLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLN 320
            DLDHKRFLILQGEVE+IAQMKAKAEK+ DDGLLEYLEDIIGT+K+K  IE  + EIE LN
Sbjct: 279  DLDHKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALN 338

Query: 321  EVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLATSC 380
            E+C+EKE RFE+V+ EK +LES K+ ALEF+ KE++ T+L+++L Q ++Y +N KLAT+ 
Sbjct: 339  EICVEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTL 398

Query: 381  DKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFI 440
            DKIS      QEE+S+YE +Q E +  T E+    ++  A   + + +  KKR  +   +
Sbjct: 399  DKISNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCV 458

Query: 441  ATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEI----ELHNLNHSIS 496
            + +E++K++ +K   AEK       + +  + + ES+ K+  D ++    E  NL   + 
Sbjct: 459  SMEERIKNLTQKKTKAEKTL----HDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELD 514

Query: 497  IEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHS 556
             E+ KL++IK+ L +KTKD+S ++   E+ +EP+  +IQEKQ +I+L+E++I++LK S +
Sbjct: 515  KERSKLDDIKLSLKDKTKDISSQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQA 574

Query: 557  NLLKEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNEMRD 616
             L +   +++ +I+D               + E+  ++  +S  + EC  A+++  EMR 
Sbjct: 575  KLKEGLGSLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRV 634

Query: 617  VLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAIS 676
            +L   RQ   +A++ L+  +NK+ VL ALT+LQ SGRI GFHGRLGDLG I D+YDIAIS
Sbjct: 635  ILNSHRQRAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAIS 694

Query: 677  TACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDL 736
            TAC RLDDIVV++VECGQQCI++LRKNKLGY RFILLDKLR   L ++ TPENV RLFDL
Sbjct: 695  TACSRLDDIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDL 754

Query: 737  ITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSS 796
            + P+   F  AFYSVLRDTLVA D++QANRVAYGKRR+RVVTLDGKLIDISGTM+GGGS 
Sbjct: 755  VQPIDLKFSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSH 814

Query: 797  PQSGLMRSKATTASQ---YSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLP 853
               GLM+ K +       Y   +VEK+E  L+ +E N++ A   + EM + L++L D+ P
Sbjct: 815  VSKGLMKLKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEP 874

Query: 854  EIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQ 913
            EI+++I+K+ ++  S   ++    Q+L +L +  +     + PL   E  L  LR   + 
Sbjct: 875  EIELEIAKLLMDVDSLNDQLNLKEQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRA 934

Query: 914  TIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXXXXLDI 973
              D S+  ++KI+ LK+ IM+ GG EL++Q +KV+SL + I I++             + 
Sbjct: 935  LEDQSQSKKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEK 994

Query: 974  DLARATREKNKYSEEVLVCNKDISILSEQLESI--RLEKERIEEQVIENNERKAELNSSV 1031
            +L +  R   +   +   C  D+  L   + +I  RL++   E  +I N   K +L    
Sbjct: 995  ELQKVQRLFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILN--EKDDLTGQC 1052

Query: 1032 EKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKL 1091
            E LK+++  +E   NE+K+ E+E  ++LEKL+ L +Y KK +RS    LQS  +RDV++ 
Sbjct: 1053 ESLKEKIKDMEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQS 1112

Query: 1092 LSQLNDGIIESCTDVTAKVMNGDIVQTQ-----------SITDVGNN------------D 1128
            L ++ +    +   V     N D+  +            S+ D  N+            D
Sbjct: 1113 LEKIQNENANNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDAD 1172

Query: 1129 AME-DSGEAATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRLA 1187
             M+ D+       G+P                   +QLQDY++N N DIE+LEEY RRL 
Sbjct: 1173 IMDLDNVTEEVSKGIPKLTDDDLKSIDLDSLESEINQLQDYVENSNADIELLEEYIRRLE 1232

Query: 1188 EYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAEL 1247
            E+++RKLDLN  VA+R+EVR++ E  K  R ++FMEGF IIS+TLKEMYQMITMGGNAEL
Sbjct: 1233 EFKKRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAEL 1292

Query: 1248 ELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1307
            ELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEI
Sbjct: 1293 ELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1352

Query: 1308 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNID 1367
            DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ LVGIYK +NMT+S TL+N D
Sbjct: 1353 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNKD 1412

Query: 1368 ILH 1370
            IL+
Sbjct: 1413 ILN 1415

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1265 bits (3273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/1389 (49%), Positives = 938/1389 (67%), Gaps = 48/1389 (3%)

Query: 14   PEIKRQRVSQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQP--PTAHAVRG 71
            P++ R     S +RTPRKLVLGSP+K++A S       +S++ + P LQP      + RG
Sbjct: 26   PDVTRA----SRSRTPRKLVLGSPDKRFAFSQP----VSSSSSNVPHLQPLKNELSSSRG 77

Query: 72   REYSQXXXXXXXXXXXXXXXXKLELIRLSPKKSTRLELQKMHEANTQTS--QRLCIDKLV 129
            R YSQ                KLELI+LSP K +RLE QK  E+       QRLCID+LV
Sbjct: 78   RVYSQSPPRSPNRSPTR----KLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLV 133

Query: 130  LNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHK 189
            L+NFKSYAG Q +GPFH SFSAVVGPNGSGKSNVIDS+LFVFGFRANKMRQGKLSELIHK
Sbjct: 134  LHNFKSYAGTQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHK 193

Query: 190  SEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYT 249
            SE  P L SC V I F YV D  +G T I+    +MV+ R+AF+NN+SKYY+NGKES+YT
Sbjct: 194  SELHPDLDSCHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYT 253

Query: 250  EVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQI 309
             +T+LL++EGIDLDHKRFLILQGEVESIAQMK KAEK++DDGLLEYLEDIIGTA++KP I
Sbjct: 254  IITQLLRDEGIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLI 313

Query: 310  EKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQI 369
            E  L EI  LN++C EKENRFE+V++EK +LE GK EALE+L+KE+  TIL+++LLQ  +
Sbjct: 314  ENTLSEIAKLNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHL 373

Query: 370  YDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVN 429
            + + +KL ++ +KI+    +   EK++     +E   +  ++ + K     L    K + 
Sbjct: 374  WKNEQKLNSTKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLT 433

Query: 430  SKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELH 489
             +KR+ ++D ++ +EKLK++ +K   + ++     S+      ++E L  + +  E +L 
Sbjct: 434  LEKRACDRDRVSLEEKLKNLTQKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLL 493

Query: 490  NLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKIT 549
             LN ++  EKEKL+EIK  L +K   +S+++  +E++LEP+  ++QEK++++KL ET I+
Sbjct: 494  ELNGTMKEEKEKLDEIKSSLKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTIS 553

Query: 550  MLKSSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQK 609
            + K SH+ + ++   +   I++                 E+  +  +++  Q EC+ A K
Sbjct: 554  VFKESHAKIEQDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVK 613

Query: 610  QTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDD 669
            +  EM+ +L   RQ   +A+++L+ F+NKN+VL AL +LQ SGRI+GFHGRLGDLGTIDD
Sbjct: 614  KIKEMKGILTAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDD 673

Query: 670  QYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPEN 729
            +YD+AISTACPRLDDIVVETVECGQQCI++LRKNKLGY RFILLDKLR  NL  I TPEN
Sbjct: 674  KYDVAISTACPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPEN 733

Query: 730  VPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGT 789
            VPRL+DL+ P    FR AFYSVLRDTLVA+DL++AN+VAYGK+R+RVVTLDGKLID+SGT
Sbjct: 734  VPRLYDLVRPNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGT 793

Query: 790  MSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLT 849
            MSGGG+    G+M+S+  + S ++ +EV++++ +LS +E N++ A   +HEME ALQKL 
Sbjct: 794  MSGGGNFKARGMMKSEQQSNSAFTAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLK 853

Query: 850  DRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQ 909
            DR PEI++ ISK +L+  S  +E+++   RL  L +E +  E + + L   E KL  L+ 
Sbjct: 854  DREPEIELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKS 913

Query: 910  HLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXXX 969
              ++  +  +  + ++  L+++IM+ GG +L+MQ + V S+ Q I I+            
Sbjct: 914  EYRELENEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVLAKSKKTKTDLK 973

Query: 970  XLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAELNS 1029
                D+ R  ++  + +EE+  C+++ S++   L+S   + + + E +   N+ K EL  
Sbjct: 974  KAQNDIKRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESI---NKLKDELEL 1030

Query: 1030 SVEKLKQELLSIERDSNE---FKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIR 1086
            + E++++   SI+  + E   F+A E++   +L+KL  L   + K+   +  SL SLKIR
Sbjct: 1031 TEERVRKAEESIDEKTVEGRDFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIR 1090

Query: 1087 DVSKLLSQLNDGI-IESCTDVTAKV---------------MNGDIVQTQSITDVGNNDAM 1130
            DV+  L  L++ +  ES  +V A+                M+ D  Q +S +     +A 
Sbjct: 1091 DVTATLQALDESLENESKNEVAAETPGEEDGEHSSSLHDPMDVDENQGESTS---TTEAQ 1147

Query: 1131 EDSGEA-------ATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYA 1183
              +GEA       +  +GLP                   HQLQDY++N   DIE+LEEYA
Sbjct: 1148 LQAGEAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYA 1207

Query: 1184 RRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGG 1243
            RRL EY+ RK+DLN AV +R++VR   E+ K +RL++FMEGF  I M LKEMYQMITMGG
Sbjct: 1208 RRLIEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGG 1267

Query: 1244 NAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYV 1303
            NAELELVDSLDPFSEGVLFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYV
Sbjct: 1268 NAELELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYV 1327

Query: 1304 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTL 1363
            MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+ LVG+YKN NMTKS  L
Sbjct: 1328 MDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVAL 1387

Query: 1364 QNIDILHSS 1372
            QN D++  S
Sbjct: 1388 QNTDLIDRS 1396

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1255 bits (3247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 681/1368 (49%), Positives = 941/1368 (68%), Gaps = 27/1368 (1%)

Query: 22   SQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAHAVRGREYSQXXXXX 81
            S + + TPRKLVL S E +YA S  Q T +A+ ++  P+LQPP   + RGR+Y +     
Sbjct: 54   SYARSHTPRKLVLSSGENRYAFS--QPTNSATTSLHVPNLQPPKVSS-RGRDY-KAYSQS 109

Query: 82   XXXXXXXXXXXKLELIRLSPKKSTRLELQKM---HEANTQTSQRLCIDKLVLNNFKSYAG 138
                       +LEL++LSP K++R+ELQK+   H+++ +   RL I+KLVL+NFKSYAG
Sbjct: 110  PPRSPGRSPARRLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSYAG 169

Query: 139  IQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLAS 198
             Q +GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE FP L +
Sbjct: 170  RQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDLQA 229

Query: 199  CSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEE 258
            CSV +HF Y+ D  +G ++I      +V+ RRAFKNNSSKYY+N KES+YTEVT+LLK+E
Sbjct: 230  CSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLKKE 289

Query: 259  GIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIET 318
            GIDLDHKRFLILQGEVE+IAQMK KAEK++DDGLLEYLEDIIGTA +KP IE+ L +IE+
Sbjct: 290  GIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQIES 349

Query: 319  LNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLAT 378
            LNE+C+EK NRFE+VD+EK +LESGKE ALEFL KE++ T+LK++LLQ ++  SN KLA+
Sbjct: 350  LNEICLEKANRFEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKLAS 409

Query: 379  SCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKD 438
            + +KIS+LN EF+ EK +++   +E + +  +  + K   ++  +  K ++ +KR LE  
Sbjct: 410  TLEKISSLNREFESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELEGS 469

Query: 439  FIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIE 498
             ++ +E+ K++  K+  AEKA   ++ +   + +  + L++   + E E+ +LN S+  E
Sbjct: 470  RVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLEEE 529

Query: 499  KEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNL 558
            +  L++IK+ L +KTKD+S ++   E++ EP+  Q+QEK+S+I+L+E+++++L+ + + L
Sbjct: 530  RIILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRAKL 589

Query: 559  LKEKATIESK-IEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNEMRDV 617
             K    +E K I                 +  KS ++ R S  +++   A  +  EM+ +
Sbjct: 590  KKNAEALEEKIISKKQRKQELQGLVLDLSQRLKSLIDGR-SQGERDFRSAHLKLKEMQRI 648

Query: 618  LIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAIST 677
            L   RQ   EA+++L+  QNKN VL AL+KLQ SGRI GFHGRLGDLG ID+ +D+AIST
Sbjct: 649  LNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAIST 708

Query: 678  ACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLI 737
            ACPRLDD+VV+TVEC Q CID+LRKNKLGY RFILLD+LRK NL  I+TPENVPRLFD++
Sbjct: 709  ACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDVV 768

Query: 738  TPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSP 797
             P    F  AFYSVL+DTLVARDL+QAN+VAYGKRRFRVVT+DGKLIDISGTMSGGG+  
Sbjct: 769  KPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNHV 828

Query: 798  QSGLMR---SKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPE 854
              GLMR   +++     Y+ +EV K+E +L+ +E N+R A   VHEME  L+K+ D+ P+
Sbjct: 829  MKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEPD 888

Query: 855  IDIQISKIQLEKGSRVAEVESYHQRL--SQLARELSMNEKNQQPLLDEEKKLDILRQHLQ 912
            ++ QIS+ ++E  S  +E+    Q+   +++A + ++NEK Q  + +  K L+ LR   +
Sbjct: 889  LESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQ--VNEVMKNLEHLRGEYE 946

Query: 913  QTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXXXXLD 972
                 ++  +++I  L+D+IM+ GG +L  Q +KV SL Q I+IL              +
Sbjct: 947  DLQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSE 1006

Query: 973  IDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAELNSSVE 1032
             D+ +  ++   + ++  + + ++ ++ E+L+  +L     +  + E +  K+EL    E
Sbjct: 1007 GDVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGE 1066

Query: 1033 KLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLL 1092
            +LK+ L  +E + +EFK+ E+E  ++LEKL+ L  ++K +++  +  L  L IRDV+  L
Sbjct: 1067 QLKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTL 1126

Query: 1093 SQLN--------DGII---ESCTDVTAKVMNGDIVQTQSITDVGNNDAMEDSGEAATHSG 1141
              L+        DGI    ++  D  + + + + +Q +   D  ++    D   +    G
Sbjct: 1127 QMLDNNQMDVVEDGIKDEQDADQDKPSGIPDDEKIQEKDDADNNHHSMNIDEMSSEISRG 1186

Query: 1142 LPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAVA 1201
            +P                     L  Y++  + DI VLEEY RRL E++RRKLDLNQAV 
Sbjct: 1187 IPKLCEEELKDLDIELLESDISGLTCYINETSVDIGVLEEYVRRLIEFKRRKLDLNQAVQ 1246

Query: 1202 KREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVL 1261
            KR+EV+ + E  K  R ++FM GF IISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 
Sbjct: 1247 KRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVT 1306

Query: 1262 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1321
            FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVAN
Sbjct: 1307 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVAN 1366

Query: 1322 YIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDIL 1369
            YIKERTKNAQFIVISLRNNMFELAQ L+GIYK +N TKSTT++NIDIL
Sbjct: 1367 YIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDIL 1414

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1254 bits (3246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/1388 (50%), Positives = 942/1388 (67%), Gaps = 62/1388 (4%)

Query: 21   VSQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAHAVRGREYSQXXXX 80
             S + + TPRKLVL S E +YA S  Q T +A+ ++  P+LQPP   + RGR+Y +    
Sbjct: 53   TSYAKSHTPRKLVLSSGENRYAFS--QPTNSATTSLHVPNLQPPGTSS-RGRDY-KAYSQ 108

Query: 81   XXXXXXXXXXXXKLELIRLSPKKSTRLELQKM---HEANTQTSQRLCIDKLVLNNFKSYA 137
                        +LEL++LSP K++R+ELQK+   H+++T+   RL I++LVL NFKSYA
Sbjct: 109  SPPRSPGRSPTRRLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYA 168

Query: 138  GIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLA 197
            G Q +GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE FP+L 
Sbjct: 169  GRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQ 228

Query: 198  SCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKE 257
            SCSV +HF YV D  +G ++I      +V+ R+AFKNNSSKYY+NGKES+YTEVT+LLK 
Sbjct: 229  SCSVAVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKN 288

Query: 258  EGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIE 317
            EGIDLDHKRFLILQGEVE+IAQMK KAEK++DDGLLEYLEDIIGTA +KP IE+ + +IE
Sbjct: 289  EGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIE 348

Query: 318  TLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLA 377
             LNEVC+EKENRFE+VD+EK +LESGKE ALEFL KE++ T+LK++L Q ++  SN KLA
Sbjct: 349  ALNEVCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLA 408

Query: 378  TSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEK 437
            ++ +KIS+LN +F+ EK +++   K+ E +  +    K   ++ ++  K++  ++R LE 
Sbjct: 409  STLEKISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEG 468

Query: 438  DFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISI 497
              ++ +E+ K++A K++ +E+    ++ +   A + ++ L     + E E+ +LN  +  
Sbjct: 469  TRVSLEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEE 528

Query: 498  EKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSN 557
            E+  L+EIK+ L +KTKD+S E+   E++LEP+  Q+QEK+S+I+L+E+++++L+ + S 
Sbjct: 529  ERSVLDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSK 588

Query: 558  LLKEKATIESKI-------EDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQ 610
            L K   T+E KI       ++               R+E+S+ E   S+A  + EE QK 
Sbjct: 589  LKKNVETMEEKILARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQK- 647

Query: 611  TNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQ 670
                  VL   RQ   EA+++L+  QNK++VL AL+KLQ SGRI GFHGRLGDLG ID+ 
Sbjct: 648  ------VLNTHRQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNS 701

Query: 671  YDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENV 730
            +D+AISTACPRLDD+VV+TVEC QQCID+LRKNKLGY RFILLD+LR+ NL  I+TPENV
Sbjct: 702  FDVAISTACPRLDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENV 761

Query: 731  PRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTM 790
            PRLFDL+ P    F  AFYSVLRDTLVAR L+QAN VAYG++RFRVVT+DGKLIDISGT+
Sbjct: 762  PRLFDLVKPKDPKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTI 821

Query: 791  SGGGSSPQSGLMR---SKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQK 847
            SGGG+    GLMR   +++     Y+ +EV K+E +LS +E N+R A   VHEME+ L+ 
Sbjct: 822  SGGGNHVSKGLMRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKN 881

Query: 848  LTDRLPEIDIQISKIQLEKGSRVAEVE-----------SYHQRLSQLARELSMNEKNQQP 896
            L D+ P I+ +ISK ++E  S  +E+            +YH  LS  A +++M  KN + 
Sbjct: 882  LRDQEPAIESKISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKA-QVNMIMKNLER 940

Query: 897  LLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEI 956
            L  E   L        Q+   +K  + K+  L+  IM+ GG +L+MQ +KV SL Q ++I
Sbjct: 941  LKGEHDDL--------QSETKTKKEKIKV--LQGEIMKIGGTKLQMQNSKVGSLCQRLDI 990

Query: 957  LHEXXXXXXXXXXXLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQ 1016
            L              + D+ +  ++      +V + + ++  + E+L+  +L+    + +
Sbjct: 991  LVAKLKKVKSGIKKSEGDVLKFQKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIK 1050

Query: 1017 VIENNERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSY 1076
            + E    ++EL    E+LK+ +   E + +EFK+ E+E  ++LEKL+ L  ++KK++   
Sbjct: 1051 MTETFNLRSELKEESEQLKEMVAETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQ 1110

Query: 1077 ETSLQSLKIRDVSKLLSQLNDG---IIESCTDV-TAKVMNGDIVQTQ----------SIT 1122
            E  L  L IRDV+  L  L++    I+++   +  A V      +TQ          +  
Sbjct: 1111 EKGLSELSIRDVTHTLEILDNNTMDIVKTDNKIEQAVVKEKRSSETQDEKNIQEEERTCD 1170

Query: 1123 DVGNNDAMEDSGEAATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEY 1182
            D  + D  E S E     G+P                    +L  Y+D  N DI VLEEY
Sbjct: 1171 DHHSMDIDETSNEVI--RGIPRFSEEELKELDIELLEKEISELSYYIDETNVDIGVLEEY 1228

Query: 1183 ARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMG 1242
            ARRLAE++RRKLDLNQAV KR+EV+ + E  K +R ++FM GF IISMTLKEMYQMITMG
Sbjct: 1229 ARRLAEFKRRKLDLNQAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMG 1288

Query: 1243 GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1302
            GNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLY
Sbjct: 1289 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLY 1348

Query: 1303 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTT 1362
            VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ LVGIYK +N T+STT
Sbjct: 1349 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTT 1408

Query: 1363 LQNIDILH 1370
            ++NIDIL+
Sbjct: 1409 VKNIDILN 1416

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 1253 bits (3241), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 697/1413 (49%), Positives = 932/1413 (65%), Gaps = 62/1413 (4%)

Query: 9    HLGDSPEIKRQRVSQSPT--------------RTPRKLVLGSPEKKYAVSNSQATTAASN 54
            H  D     RQ +  SPT              +TP+KL+L   +   A++ + A    S+
Sbjct: 24   HNDDDQRYNRQEIKVSPTTQDAAAVSHLNFKSQTPKKLILRDYDS-IAITPT-AAMPPSS 81

Query: 55   TMDPPSLQPPTAHAVRGRE---YSQXXXXXXXXXXXXXXXXKLELIRLSPKKSTRLELQK 111
            ++  PSL PPT  + RGR    YSQ                KLELI+LSP K++R+ LQK
Sbjct: 82   SLQAPSLHPPTESSSRGRTARTYSQSPPRSPARSPARSPTRKLELIQLSPVKNSRIALQK 141

Query: 112  MHEA-NTQTSQRLCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFV 170
            ++E+ N +  +RLCIDKLVL++FKSYAG Q +GPFH+SFSAVVGPNGSGKSNVIDSMLFV
Sbjct: 142  IYESKNEKQIERLCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFV 201

Query: 171  FGFRANKMRQGKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERR 230
            FGFRA+KMRQ +LS+LIHKSE FP L SCSV++HF YV D  +G T I      +V+ R+
Sbjct: 202  FGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRK 261

Query: 231  AFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDD 290
            AFKNN+SKYY+NGKESNYT VT+LLK+EGIDLDH RFLILQGEVE+IAQMK KAE D DD
Sbjct: 262  AFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENDGDD 321

Query: 291  GLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEF 350
            GLLEYLEDIIGTAK+KP IEK  EEIE LNE+C+EKENRFE+VD+EK +LESGK+EALEF
Sbjct: 322  GLLEYLEDIIGTAKYKPLIEKKFEEIEALNEICIEKENRFEIVDREKASLESGKDEALEF 381

Query: 351  LDKERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHE 410
            L+KE++ T++K++L Q +++  N+KL+T+ +K+S +  EF+E K ++   + +   ++  
Sbjct: 382  LEKEKELTLVKSKLYQYKLWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEIQMNEISKS 441

Query: 411  INNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAA 470
             +   K   A + + K +N +KR+ + + ++ +E+ K+I +K K  EK            
Sbjct: 442  YHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEEQRKNIMKKKKKMEKELEDCNKTISNT 501

Query: 471  VNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPF 530
              +IE L KN  + E +L  LN  + IE+  L EIKI L +KT + S E+   E++LEP+
Sbjct: 502  KIKIEDLGKNESEYESQLDELNAQLQIERGLLEEIKISLKDKTIEFSDEISQHEKELEPW 561

Query: 531  RDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNEK 590
              Q+Q K+S+I++ E++I+++K     L  +   + S I                 RNE 
Sbjct: 562  NLQLQGKKSQIQVKESEISLIKEGRVKLENDIENLNSLISVKIEEKISREKEIGSLRNEL 621

Query: 591  SKVEARISTAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQN 650
            +++   +S    E   A+++  EM+ VL Q RQ   +A+ +L+  +NKN+VL +L +LQ 
Sbjct: 622  NRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQK 681

Query: 651  SGRITGFHGRLGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRF 710
            SGRI+GF+GRLGDLG IDD+YDIAISTACPRL+D+VVETVECGQQCI++LRKNKLGY RF
Sbjct: 682  SGRISGFYGRLGDLGAIDDRYDIAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARF 741

Query: 711  ILLDKLRKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYG 770
            ILL+KLR  ++++I+TP NVPRLFDL+      F PAFYSVLRDTLV  +L+ ANRVAYG
Sbjct: 742  ILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYG 801

Query: 771  KRRFRVVTLDGKLIDISGTMSGGGSSPQSGLMR---SKATTASQYSRDEVEKMEVQLSTK 827
             +RFRVVTL G+LID+SGTMSGGG+    GLM+   S  +    Y+ ++VEK+E +L+ +
Sbjct: 802  NKRFRVVTLSGELIDVSGTMSGGGTQTSRGLMKLTKSGNSGFKSYTIEDVEKIEKELAAR 861

Query: 828  ETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLAREL 887
            E N+  A     EME+ L++L DR P+++++ISK +LE  S V E E   Q+L++  + L
Sbjct: 862  EKNFEIANETFTEMETELRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQSL 921

Query: 888  SMNEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKV 947
                 N + L   E +L  L+   +     +K  +D+I  LKD IM+ GGI+L++Q +KV
Sbjct: 922  DECMSNNEELSTMEHELGTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKV 981

Query: 948  ASLEQHIEILHEXXXXXXXXXXXLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIR 1007
             S+ Q  +IL+               DL +A  E  + S++   C+ D+   +++LE+  
Sbjct: 982  DSIIQKKDILNGKHKKDKN-------DLKKAETELKRLSKKQSECSTDLLTSTDKLENTD 1034

Query: 1008 LEKERIEEQVIENNERKAELNSS-------VEKLKQELLSIERDSNEFKAKELEYSDRLE 1060
             +  +I + + E      EL  S        E LK +L   E + N FK  +LE+ ++ E
Sbjct: 1035 GQLSKISKSLSETETLLHELEFSREESLQNSENLKDQLKEFEENLNSFKVFQLEHQNKEE 1094

Query: 1061 KLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQLNDGIIESCTDVTAKVMNGDIVQTQS 1120
            KL+ L  ++KK +RS ++ LQSLKIRD++  L +L++G I+   D     M  + V   +
Sbjct: 1095 KLNNLLNFIKKDIRSTDSELQSLKIRDITHTLQELDNGNIDQ--DEEDVSMKDNAVSVSA 1152

Query: 1121 ITDVGNNDAME-----------------------DSGEAATHSGLPSXXXXXXXXXXXXX 1157
               +GN++ ME                       D        G+P              
Sbjct: 1153 NNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDEDNNEISKGIPRISEDEFKNVDVEE 1212

Query: 1158 XXXXXHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNER 1217
                  QLQDY+D  N +I+VLEEYARR+AEY+RRKLDLN AV +RE+VR   +  K  R
Sbjct: 1213 LEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTR 1272

Query: 1218 LEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNL 1277
             E+FM+GFG+IS+TLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NL
Sbjct: 1273 FEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNL 1332

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISL 1337
            SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISL
Sbjct: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISL 1392

Query: 1338 RNNMFELAQNLVGIYKNNNMTKSTTLQNIDILH 1370
            RNNMFELA+ LVGIYK+NN TKS TLQN DI++
Sbjct: 1393 RNNMFELAEQLVGIYKSNNQTKSATLQNNDIIN 1425

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1252 bits (3239), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/1380 (49%), Positives = 935/1380 (67%), Gaps = 32/1380 (2%)

Query: 14   PEIKRQRVSQSPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAHAVRGRE 73
            P++     S S + TPRKLVL S E +YA S  Q T + + ++  P+LQPP   + RGR+
Sbjct: 46   PDLPALEASYSKSYTPRKLVLSSGENRYAFS--QPTNSTTTSLHVPNLQPPKTSS-RGRD 102

Query: 74   ---YSQXXXXXXXXXXXXXXXXKLELIRLSPKKSTRLELQKM---HEANTQTSQRLCIDK 127
               YSQ                +LEL++LSP K++R+ELQK+   H+++++   RL I++
Sbjct: 103  HKSYSQSPPRSPGRSPTR----RLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINE 158

Query: 128  LVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELI 187
            LVL NFKSYAG Q +GPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LI
Sbjct: 159  LVLENFKSYAGKQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLI 218

Query: 188  HKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESN 247
            HKSE FPSL SCSV +HF YV D  +G ++I      +++ R+AFKNNSSKYY+N KES+
Sbjct: 219  HKSEAFPSLQSCSVAVHFQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESS 278

Query: 248  YTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKP 307
            YTEVT+LLK EGIDLDHKRFLILQGEVE+IAQMK KAEK++DDGLLEYLEDIIGTA +KP
Sbjct: 279  YTEVTKLLKNEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKP 338

Query: 308  QIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQR 367
             IE+ + +IE LNEVC+EKENRFE+VD+EK +LESGKE ALEFL+KE++ T+L+++L Q 
Sbjct: 339  LIEERMGQIENLNEVCLEKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQF 398

Query: 368  QIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKN 427
            ++  SN KLA++ +KIS+ N + ++EK +++   K+ + +  +    K   ++  ++ K 
Sbjct: 399  KLLQSNSKLASTLEKISSSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKT 458

Query: 428  VNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIE 487
            +  ++R LE   ++ +E+ K++  K++ AEK    ++ +   A N +E L+    + E E
Sbjct: 459  LVLERRELEGTRVSLEERTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETE 518

Query: 488  LHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETK 547
            + +L   +  E+  L++IK+ L +KTK++S E+   E++LEP+  Q+QEK+S+I+L+E++
Sbjct: 519  IKDLTQLLEKERSILDDIKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESE 578

Query: 548  ITMLKSSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEA 607
            +++L+ + + L K   T+E KI                 + + + ++   S  +K    A
Sbjct: 579  LSLLEETQAKLKKNVETLEEKILAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSA 638

Query: 608  QKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTI 667
              +  EM+ VL   RQ   EA+++L+  QNK++VL AL++LQ SGRI GFHGRLGDLG I
Sbjct: 639  HLKLKEMQKVLNAHRQRAMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVI 698

Query: 668  DDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATP 727
            DD +D+AISTACPRLDD+VV+TVEC Q CID+LRKNKLGY RFILLD+LR+ NL  I+TP
Sbjct: 699  DDSFDVAISTACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTP 758

Query: 728  ENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDIS 787
            ENVPRLFDL+ P    F  AFYSVLRDTLVA++L+QAN VAYGK+RFRVVT+DGKLIDIS
Sbjct: 759  ENVPRLFDLVKPKNPKFSNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDIS 818

Query: 788  GTMSGGGSSPQSGLMR---SKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESA 844
            GTMSGGG+    GLM+   +++     Y+ +EV+K+E +LS +E N+R A   VHEME  
Sbjct: 819  GTMSGGGNHVAKGLMKLGTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEE 878

Query: 845  LQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRL--SQLARELSMNEKNQQPLLDEEK 902
            L+KL D  P+++ QISK ++E  S  +E+    Q++  +++A   ++++K Q  ++   K
Sbjct: 879  LKKLRDHEPDLESQISKAEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVV--MK 936

Query: 903  KLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEXXX 962
             L+ LR         +K  ++KI  L+D IM+ GGI+L+MQ +KV S+ Q ++IL     
Sbjct: 937  NLERLRGEYNDLQSETKTKKEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLK 996

Query: 963  XXXXXXXXLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNE 1022
                       D+ +  +       +V + + ++ ++ EQL+  +L     +  + E   
Sbjct: 997  KVKSASKKSGGDVVKFQKLLQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLN 1056

Query: 1023 RKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQS 1082
             K EL    E+LK+++  +E   NEFK+ E+E  ++LEKL+ L  Y+K ++   E  L  
Sbjct: 1057 LKVELKEQSEQLKEQMEDMEESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNE 1116

Query: 1083 LKIRDVSKLLSQLNDGIIESCTDVTAKVMNGD----IVQTQ-------SITDVGNNDAME 1131
            L IRDV+  L  L+D  ++S  +        D      +TQ       + T   N   M 
Sbjct: 1117 LSIRDVTHTLGMLDDNKMDSVKEDVKNNQELDQEYRSCETQDESEIKDAETSCDNYHPMN 1176

Query: 1132 -DSGEAATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRLAEYQ 1190
             D        G+P                   ++L  Y++  N DI VLEEYARRLAE++
Sbjct: 1177 IDETSDEVSRGIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFK 1236

Query: 1191 RRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELV 1250
            RRKLDLN AV KR+EV+ +    K +R ++FM GF IISMTLKEMYQMITMGGNAELELV
Sbjct: 1237 RRKLDLNNAVQKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELV 1296

Query: 1251 DSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1310
            DSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA
Sbjct: 1297 DSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1356

Query: 1311 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILH 1370
            LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQ LVG+YK +N TKSTT++NIDIL+
Sbjct: 1357 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILN 1416

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1243 bits (3217), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 680/1372 (49%), Positives = 928/1372 (67%), Gaps = 30/1372 (2%)

Query: 21   VSQSP-----TRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPP--TAHAVRGRE 73
            VS SP     + TPRKL+L   + +YA S  Q T +AS ++  PSLQPP  ++ + RGR 
Sbjct: 45   VSLSPPAISKSHTPRKLILHQSDNRYAFS--QPTVSAS-SLQVPSLQPPETSSSSSRGRR 101

Query: 74   YSQXXXXXXXXXXXXXXXXKLELIRLSPKKSTRL-ELQKMHEANTQTSQRLCIDKLVLNN 132
              +                KLELI+LSP K+ R+ +LQ+++ +  +  +RL I+KLVLNN
Sbjct: 102  DIKVYSQSPPRSPGRSPTRKLELIQLSPVKNNRIRKLQELYNSQIK-KERLFINKLVLNN 160

Query: 133  FKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQ 192
            FKSYAG Q IGPF+T+FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE 
Sbjct: 161  FKSYAGEQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSES 220

Query: 193  FPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVT 252
            FP+L SCSV + F YV D  NG +KI  +   +++ R+AFKNNSSKY++NGKES+YTEVT
Sbjct: 221  FPNLPSCSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVT 280

Query: 253  RLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKC 312
            +LLKEEGIDLDHKRFLILQGEVE+IAQMK KAE++ DDGLLEYLEDIIGTA +K  IEK 
Sbjct: 281  KLLKEEGIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKN 340

Query: 313  LEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDS 372
              E++TLNE+C+EKENRFE+V++EK +LES K  ALEF+ KER+ T+ K++LLQ  I   
Sbjct: 341  TIEVDTLNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKE 400

Query: 373  NRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKK 432
            + KLA++  K+S L  E+Q E +++E+ Q+E   L        K+  +++ + KN  SKK
Sbjct: 401  HEKLASTLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKK 460

Query: 433  RSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLN 492
            R L+    + +EK+KS  RK + A K+ +QS+   K   NEIE+L  +  + E  L +L 
Sbjct: 461  RELQNKKASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLL 520

Query: 493  HSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLK 552
              +  EK  L EIK+ L +KT D+S E+   ER+LEP++ Q+QEK+ EI+++E++I++L+
Sbjct: 521  SELKKEKNVLEEIKLSLKDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQ 580

Query: 553  SSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTN 612
             + S L  E   +++ ++                + + S +       + EC  A+ +  
Sbjct: 581  ENQSKLKDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIK 640

Query: 613  EMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYD 672
            +M+ VL  QRQ V +A++ L   +NK++VL AL KLQ SGRI+GF+GRLGDLG ID++YD
Sbjct: 641  DMQHVLQTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYD 700

Query: 673  IAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPR 732
            IAISTA  RLDDIVV++VECGQ CI++LRKNKLGY RFILL+KLR   L RI TPENV R
Sbjct: 701  IAISTASARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKR 760

Query: 733  LFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSG 792
            LFDL+ P +D+F PAFYSVLR+TLVA+DL+QANRVAYG  RFRVVT+DGKLIDISGT++G
Sbjct: 761  LFDLVKPDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITG 820

Query: 793  GGSSPQSGLMRSKATTASQ---YSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLT 849
            GG     GLM+ +         YS D++EK+E +L  +E N++ A     EME ALQ+L 
Sbjct: 821  GGKQTAQGLMKLRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLK 880

Query: 850  DRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQ 909
            DR PE++++ISK  ++      E+ES   +L Q       + +N+  +++ E +L++L++
Sbjct: 881  DRKPELELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQK 940

Query: 910  HLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXXX 969
              Q  +D++K   +KID LK RIM+ GGI+L+MQ +KV S+ Q+I+I+            
Sbjct: 941  EYQLLLDSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMK 1000

Query: 970  XLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAELNS 1029
             ++ ++ R+ +  +    +   C+K++   S+++ES+      I+E  ++     +EL  
Sbjct: 1001 KIENEIRRSEKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEI 1060

Query: 1030 SVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVS 1089
                LK+++   E +  +FK+ E++  DRLEKL+ L +++K+ ++ Y+  L++L++R+ +
Sbjct: 1061 ECCNLKEKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTT 1120

Query: 1090 KLLSQLNDGIIESCTDVTAKVMNGDIVQTQSITDVGNNDAM---EDSGEAATH------- 1139
             +     D    +  D T+   +G  V  Q    V   + M   ++S EA          
Sbjct: 1121 TIFGDEGDNNSINGVDRTS---HGGGVPLQDQNKVVRENNMRNEKNSTEAEMEIDDVADE 1177

Query: 1140 --SGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLN 1197
               G+P                    QL++Y+   N +I+VLEEYARRLA+Y  RKLDLN
Sbjct: 1178 FSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRKLDLN 1237

Query: 1198 QAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFS 1257
            QAV +RE ++   +  K +R ++FM+GFGIISMTLKEMYQMITMGGNAELEL+DSLDPFS
Sbjct: 1238 QAVERREALKKLLDELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSLDPFS 1297

Query: 1258 EGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1317
            EGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS
Sbjct: 1298 EGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1357

Query: 1318 IVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDIL 1369
            IVANYIKERTKNAQFIVISLRNNMFELAQ L+GIYK +N TKS  ++N D L
Sbjct: 1358 IVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1235 bits (3195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 684/1371 (49%), Positives = 925/1371 (67%), Gaps = 30/1371 (2%)

Query: 26   TRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQPPTAHAVRGREYSQXXXXXXXXX 85
             +TPRKLV+G+ + +YA     + + +S+++  P LQPP A + RGR  S+         
Sbjct: 49   AKTPRKLVVGNGDNRYA---HSSQSISSSSLQVPPLQPP-ATSSRGR-GSKTYSQSPPRS 103

Query: 86   XXXXXXXKLELIRLSPKKSTRLELQKMHEA--NTQTSQRLCIDKLVLNNFKSYAGIQEIG 143
                   KLELI++SP K++RLELQK+++A  N     RLCID+L+L +FKSYAG Q +G
Sbjct: 104  PGRSPTRKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCIDQLILQDFKSYAGRQVVG 163

Query: 144  PFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLASCSVQI 203
            PF+TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE++PSL SCSV++
Sbjct: 164  PFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEYPSLPSCSVEV 223

Query: 204  HFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLD 263
            HF YV D  +GET+I      +VV R+AF+NN+SKYYVN +E+NY EVT+LLK+EG+DLD
Sbjct: 224  HFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQETNYGEVTKLLKKEGVDLD 283

Query: 264  HKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVC 323
            HKRFLILQGEVE+IAQMK+KAE++ +DGLLEYLEDIIGTAK+KP IEK L ++E+LN++C
Sbjct: 284  HKRFLILQGEVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYKPLIEKNLADMESLNDIC 343

Query: 324  MEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLATSCDKI 383
            +EKENRF++VD+EK +LE+GKEEAL FL+ ERK T+ K++L Q  I +SN KL  + DKI
Sbjct: 344  IEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQYHILNSNMKLKNTLDKI 403

Query: 384  SALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATD 443
            + LN + ++E  +   ++KE + L    +  + +      E K +  KKR L+   +  +
Sbjct: 404  TNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEKQLLGKKRELDGKNVLNE 463

Query: 444  EKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLN 503
            EK+K+  +K   AEK  S  + +  ++   +  LK+   D E  L  LN    +EK KL 
Sbjct: 464  EKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYENSLKELNEQTEVEKMKLE 523

Query: 504  EIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKA 563
            +IK  L +KT  +S E+  LE++LEP+  Q+QEK+++I+L+E++I+++K + + L +E  
Sbjct: 524  KIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAESQISLIKEAEAKLAQEID 583

Query: 564  TIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQ 623
              + +IE                 ++   V+  IST +KEC  A+ +  EM+++L  QRQ
Sbjct: 584  QFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLNARIRLKEMQNILNTQRQ 643

Query: 624  IVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAISTACPRLD 683
               +A++ L+  +NK++VL AL++LQ SGRI+GFHGRLGDLG ID++YD+AISTACPRL+
Sbjct: 644  KALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLE 703

Query: 684  DIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLITPVRDL 743
            DIVVETVECGQQCI++LRKNKLGY RFILLDKLRK NLD I TPE+VPRLFDLI P    
Sbjct: 704  DIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINTPESVPRLFDLIHPKDPK 763

Query: 744  FRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLM- 802
            F  AF+SVL +TLVA DL+QANRVAYGK+RFRVVTLDG LIDISGTMSGGGS    GLM 
Sbjct: 764  FSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDISGTMSGGGSRVSRGLMQ 823

Query: 803  --RSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQIS 860
              R+K      YS +EV ++EV L  +E N++ A   +++ME  L+ L ++ P I+  IS
Sbjct: 824  INRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEEQLKDLKEKEPAIENNIS 883

Query: 861  KIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTIDASKF 920
            ++ +E  S  +E++    ++ +  R  S  + N   L +  + +  L+   +   + +K 
Sbjct: 884  QLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQHVQSLKDEFKSIQNQTKS 943

Query: 921  SQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXXXXLDIDLARATR 980
             + +I+ LK+ IM+ GG ELK+Q +KV S+ Q I+I+              + ++ ++ +
Sbjct: 944  KKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKKERSVIKKTENEINKSHK 1003

Query: 981  EKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIENNERKAELNSSVEKLKQELLS 1040
             K + S ++   N++I  L   +E ++    ++ E V      K  L      L+ +L  
Sbjct: 1004 MKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHTKEGLIEESRTLEDKLND 1063

Query: 1041 IERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQLND--- 1097
            I  D   FK+ E+E  + LEKL+ L  ++KK+++ YE  L  LKIRDV+++L  L D   
Sbjct: 1064 INEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDLKIRDVTQILHDLKDESN 1123

Query: 1098 -----------GIIESCTDVT-AKVMNGDIVQTQSITDV---GNNDA-MEDSGEAATHSG 1141
                        + ES + V   K  N D+     + D    G+N   +ED GE +   G
Sbjct: 1124 NASDPSENPVSDVEESESSVGEGKDENKDLDAQDQVQDAEKQGDNQMDVEDGGEYSDR-G 1182

Query: 1142 LPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAVA 1201
            L                      LQ++LD  N DI+VLEEYARRL E++ R+LDLNQAV 
Sbjct: 1183 LTQFSEDELHEIEIEELEKEIEDLQNFLDASNADIDVLEEYARRLIEFKSRRLDLNQAVE 1242

Query: 1202 KREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVL 1261
            +R +V+ K +  K +R ++FM+GFGIISMTLKEMYQMITMGGNAELELVD+LDPFSEGV 
Sbjct: 1243 ERNKVKEKLDELKKKRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDTLDPFSEGVT 1302

Query: 1262 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1321
            FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN
Sbjct: 1303 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1362

Query: 1322 YIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILHSS 1372
            YIKERTKNAQFIVISLRNNMFELAQ LVGIYK +N TKS T++NID +  S
Sbjct: 1363 YIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKSATIKNIDFVSVS 1413

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1213 bits (3139), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/1393 (48%), Positives = 925/1393 (66%), Gaps = 72/1393 (5%)

Query: 26   TRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPSLQP---PTAHAVRGRE---YSQXXX 79
            T TPRKL++G  E KYA+S  Q TT+AS+++  P+LQ    P +   RGR    YSQ   
Sbjct: 65   TVTPRKLIIGPSENKYALS--QPTTSASSSLQVPALQQKLVPLSQDSRGRRIKMYSQSPP 122

Query: 80   XXXXXXXXXXXXXKLELIRLSPKKSTRLELQKM---HEANTQTSQRLCIDKLVLNNFKSY 136
                         KLELI+LSP K++RLELQK+   H A      RL I KLVL+NFKSY
Sbjct: 123  RSPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKLVLHNFKSY 182

Query: 137  AGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSL 196
            AG Q IGPF  SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQ +LS+LIHKSE+F +L
Sbjct: 183  AGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSERFTNL 242

Query: 197  ASCSVQIHFHYVHD----TDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVT 252
              CSV++HF YV D      +G+T  + +  T+V+ R+AFKNNSSKY++NGKESN+TEVT
Sbjct: 243  NFCSVEVHFRYVKDEYTAPTDGDT--MEAENTLVITRKAFKNNSSKYFINGKESNFTEVT 300

Query: 253  RLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKC 312
            +LLKE+GIDLDHKRFLILQGEVE+IAQMKAKAEKDN+DGLLEYLEDIIGT  +KP IE+ 
Sbjct: 301  KLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYKPLIEQK 360

Query: 313  LEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDS 372
              EIE +NE+C+EKENRF +VD EK +LE  K+ ALEFL+KE++ T+LK++L Q  +Y +
Sbjct: 361  TVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLTQYHLYVN 420

Query: 373  NRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKK 432
            N K+ T+  +I +L  +F++EK ++    KE ETL + I+ +K   T+L TE K++  +K
Sbjct: 421  NDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEKSLIQRK 480

Query: 433  RSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLN 492
            R +    ++ +E  K++ +KLK A+     S+S      +E++   +  ++ E E+++L+
Sbjct: 481  REINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYEAEVNDLS 540

Query: 493  HSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLK 552
                +E++ L +IK+ L +KT   S E+ S+E++LEP   +IQEK+S+IKL E +I +++
Sbjct: 541  KQREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEMEIDLIR 600

Query: 553  SSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTN 612
             S   +  E  +++ ++                    K  +        KEC++A  + N
Sbjct: 601  DSKRKVGAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDKECKDAGVKLN 660

Query: 613  EMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYD 672
            EM+ +L   RQ   EA++ ++  QNKN+VL +L ++Q SGRI GFHGRLGDLG I DQYD
Sbjct: 661  EMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGIIADQYD 720

Query: 673  IAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPR 732
            +AISTACPRLDD+VVE+VECGQ CI+ LRKNKLGY RF++LDKL++ ++  I TPENVPR
Sbjct: 721  VAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQTPENVPR 780

Query: 733  LFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSG 792
            LFDL+ P    F PA YSVLRDTLVA+DL+QANRVAYGKRRFRVVTLDG+LIDISGTMSG
Sbjct: 781  LFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDISGTMSG 840

Query: 793  GGSSPQSGLMR--SKATTASQ-YSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLT 849
            GGS    GLM   +K +  S+ +S ++++K+E++L+ +E  +  A    H ME  L+KL 
Sbjct: 841  GGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQELRKLC 900

Query: 850  DRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQ 909
            DR P+++++ISK  ++  +   +++    +L++ + +   + K+   L      L+ L Q
Sbjct: 901  DREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDLLLGNLEALNQ 960

Query: 910  HLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXXX 969
             L+   D SK S +++  LKD IM+ GG EL++Q +KV+SL Q I+IL            
Sbjct: 961  ELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLKKSKTVVK 1020

Query: 970  XLDIDLARA-------TREKNKYSEEVL-------VCNKDISILSEQLESIRLEKERIEE 1015
             L+ +L +A       T E    +EE+        V    +  +++ LESI+ EK  +E+
Sbjct: 1021 KLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLESIQDEKINLEQ 1080

Query: 1016 QVIENNERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRS 1075
            ++   +++  E N +V              NEFK  +LE  +++E+ + +  Y+KK+   
Sbjct: 1081 ELENFSDKLHESNENV--------------NEFKTIQLELENKIERANSILSYLKKENGQ 1126

Query: 1076 YETSLQSLKIRDVSKLLSQLND------------GIIESCTDVTAKVMNG-----DIVQT 1118
                L + ++RDV+  L  L +            G  E+ ++V  +++       + + T
Sbjct: 1127 LLEELNNFRLRDVTHTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAADAGVENMNT 1186

Query: 1119 QSITD---VGNNDA---MEDSGEAATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNF 1172
             S+++   V +++    ++D G+  +  G+P                   +QLQ +++N 
Sbjct: 1187 SSLSNSVKVASDEISMDVDDCGDLVSQ-GIPRLSDKELSTIDTDNLNEEINQLQSFINNV 1245

Query: 1173 NGDIEVLEEYARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTL 1232
            + +IE+LEEYA+RL E+++RK+DLN +V +R ++ +  E  K +R  +FMEGF IISMTL
Sbjct: 1246 SINIEILEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTL 1305

Query: 1233 KEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFA 1292
            KEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFA
Sbjct: 1306 KEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFA 1365

Query: 1293 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIY 1352
            LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+ LVGIY
Sbjct: 1366 LHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIY 1425

Query: 1353 KNNNMTKSTTLQN 1365
            K+ NMTK+ T++N
Sbjct: 1426 KHENMTKNATIRN 1438

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1160 bits (3002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/1411 (47%), Positives = 905/1411 (64%), Gaps = 77/1411 (5%)

Query: 3    ADSSV-PHLGDSPEIKRQRVSQ-SPTRTPRKLVLGSPEKKYAVSNSQATTAASNTMDPPS 60
            AD ++ P+ G    I+ Q   +   +RTPRKL++ S + ++ +S     +A S T   PS
Sbjct: 43   ADITIGPYQGQEKHIQPQSQDRHGRSRTPRKLIVSSADHRFTMSQPNLLSADSQT---PS 99

Query: 61   LQPPTAHAVRGRE---YSQXXXXXXXXXXXXXXXXKLELIRLSPKKSTRLELQKMHEANT 117
            LQ P+     GRE   YSQ                 LELI+LSP K+ R ELQKM+E   
Sbjct: 100  LQHPSVST--GREHKFYSQSPPRSPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQ- 156

Query: 118  QTSQR---LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFR 174
            QT +R   L I++LVL NFKSYAG Q +GPFHT+FSAVVGPNGSGKSNVIDSMLFVFGFR
Sbjct: 157  QTQKRTIRLVIERLVLTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFR 216

Query: 175  ANKMRQGKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNG-ETKILPSAGTMVVERRAFK 233
            ANKMRQGKL +LIHKSE++P L+SCSV+IHF YV D  NG  +KI  S   +VV R+AFK
Sbjct: 217  ANKMRQGKLKDLIHKSEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFK 276

Query: 234  NNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLL 293
            NNSSKYY+N KES++T+VT LLK EGIDLDHKRFLILQGEVE+IAQMK K+EK+ DDGLL
Sbjct: 277  NNSSKYYINDKESSFTQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLL 336

Query: 294  EYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDK 353
            EYLEDIIGT+ +K QIE  L ++E LNE+C+EKENRF +V+KEK +L  GK EAL++L  
Sbjct: 337  EYLEDIIGTSHYKVQIEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLAN 396

Query: 354  ERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQY-------EHLQKEAET 406
            E+   + K++  Q Q+Y  N+KL ++  KI+     + +E  +Y       ++LQ E  T
Sbjct: 397  EKNLVLAKSKKYQHQLYIDNKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEIT 456

Query: 407  LTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESN 466
            L   +N TKK    L +  +  NS       + I+T E +K+I +K   AEK  + +E +
Sbjct: 457  LNKRLNETKKYEEKLLSNQRKNNS-------ELISTQEMIKNIEKKKDNAEKLVNTTEKS 509

Query: 467  GKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQ 526
                 N++E+L    +D   ++  LN  + IEK KL EIKI L  KT+  S E+   E++
Sbjct: 510  ITQTNNKLETLNNQQEDYTKQIEELNEKLKIEKSKLEEIKISLKGKTEQFSNEILKNEKE 569

Query: 527  LEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXX 586
            LEP++ Q+QEK S+I+L +++I++L  +  NL  E  +I+  IE+               
Sbjct: 570  LEPYQIQLQEKMSQIQLLQSEISLLNENKDNLSNEIISIKKLIEEKKLSVVRMSEKITGW 629

Query: 587  RNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALT 646
            + +  +    + +   E  +  K+  EMRD L   RQ   +++ +L+  QNKN VL AL 
Sbjct: 630  KQQLLEQRKEVESGDIEFNKFTKKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALF 689

Query: 647  KLQNSGRITGFHGRLGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLG 706
            KLQ SGRI+GF+GRLGDLG ID++YD+AISTACPRL+D+VV++V+CGQQCID+LRKN+LG
Sbjct: 690  KLQKSGRISGFYGRLGDLGVIDEKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLG 749

Query: 707  YGRFILLDKLRKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANR 766
            Y RFILLDKLRK NL+RI TP+N PRLFDLI    D F PAFYSVLRDTLVA +L  AN+
Sbjct: 750  YARFILLDKLRKFNLNRIETPDNAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANK 809

Query: 767  VAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLMR----SKATTASQYSRDEVEKMEV 822
            VAYGKRRFRVVTLDGKLIDISGTMSGGG+    GLM+           Q S +EV+K+E 
Sbjct: 810  VAYGKRRFRVVTLDGKLIDISGTMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLER 869

Query: 823  QLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQ 882
            +L   E N++ A + + EM   +  + +++P  ++ ISK  +       E+E     + Q
Sbjct: 870  ELEILEKNFKVAYNSLKEMNQEILHMKEQIPATELNISKTTI-------EIEYCENEIKQ 922

Query: 883  LARELSMNEKNQQPLLDEEK-----------KLDILRQHLQQTIDASKFSQDKIDDLKDR 931
            L  +L    K +Q + D+E            KL  L++      D +K ++ +I+ L+ +
Sbjct: 923  LISQL----KEKQEIHDQESNNNDEIKVADDKLQALKKEYYSLNDQTKVTKQEIEKLRQQ 978

Query: 932  IMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXXXXLDIDLARATREKNKYSEEVLV 991
            IM  GGIELKMQ +KV SL   ++I++             +  L +   E N   +  L 
Sbjct: 979  IMDAGGIELKMQNSKVTSLVNQLKIVNSKQKNDKSAIKKNNNILKKLQNELNTTKDNSLE 1038

Query: 992  -------CNKDISILSEQLESIRLEKERIEEQVIENNERKAELNSSVEKLKQELLSIERD 1044
                     K +++LSE+L        ++E  + +    K E+  +++  K++   +E D
Sbjct: 1039 FKTNLENSKKKVTLLSEEL-------AKLESDINDTQNAKEEILLNIDGNKEKAQELEED 1091

Query: 1045 SNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQLNDGIIESCT 1104
            S  FK+ ELE  ++L+KL  L  +++KQ+   +T L +L IR++S+ L   ++ +     
Sbjct: 1092 SRNFKSFELEIKNKLDKLKDLSHHLEKQIGKLDTELNALTIREISQNLESFDERL--EKY 1149

Query: 1105 DVTAKVMNGDIVQT----QSITDVGNNDAME-DSGEAATHSGLPSXXXXXXXXXXXXXXX 1159
            D++      D   T     S++++ N D M+ DS +   + G+                 
Sbjct: 1150 DISKNGATEDTQHTSSALNSVSNI-NTDTMDIDSTDNEINPGIKRLSELEINELDIESLD 1208

Query: 1160 XXXHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLE 1219
                 L++ L++   +IE+LEEY RRL+EY++RK DL+++++++E  + + E  K +RLE
Sbjct: 1209 AEIENLEEQLEHSTANIEILEEYVRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLE 1268

Query: 1220 KFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSG 1279
            +F  GF IIS+TLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSG
Sbjct: 1269 EFTTGFDIISLTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSG 1328

Query: 1280 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1339
            GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRN
Sbjct: 1329 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRN 1388

Query: 1340 NMFELAQNLVGIYKNNNMTKSTTLQNIDILH 1370
            NMFEL++ LVGIYK+ NMT+S TL N D+L+
Sbjct: 1389 NMFELSKQLVGIYKSENMTQSATLVNNDMLN 1419

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1157 bits (2994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/1394 (48%), Positives = 918/1394 (65%), Gaps = 47/1394 (3%)

Query: 4    DSSVPHLGDSPEIKRQRVSQSPTRTPRKLVLGSPEKKYAVSNSQATTAA-------SNTM 56
            +S+ P   D P+I + R + SP +     +      K  +SN+ + + +       S++ 
Sbjct: 16   ESNSPLNNDIPKIAQSR-NDSPLQVANDPLKSYTPMKVIISNNHSNSISPLPSQLMSSST 74

Query: 57   DPPSLQPPTAHAVRGRE---YSQXXXXXXXXXXXXXXXXKLELIRLSPKKSTRLELQKMH 113
             PPSLQ P++ + RGR    YSQ                KLELI+LSP K++R ELQK++
Sbjct: 75   QPPSLQHPSSSS-RGRAVKAYSQSPPRSPDRSPVRSPTRKLELIQLSPIKNSRSELQKIY 133

Query: 114  EANTQTS-QRLCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFG 172
             +  +   +R+C++KLVL+NFKSYAG Q IGPFH+SFSAVVGPNGSGKSNVIDSMLFVFG
Sbjct: 134  SSKQEEKIERICLNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFG 193

Query: 173  FRANKMRQGKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAF 232
            FRANKMRQGKL++LIHKSE++P L SC+V +HF Y+ D  +  TKI PS   +++ RRAF
Sbjct: 194  FRANKMRQGKLADLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAF 253

Query: 233  KNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGL 292
            KN++SKYY+NGKESNY  +T LLKEEGIDLDH RFLILQGEVE+IAQMK KAEK+ DDGL
Sbjct: 254  KNSTSKYYLNGKESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGL 313

Query: 293  LEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLD 352
            LEYLEDIIGT K+K  I+K   EIE LN++C+E+ENRF+++D+EK++LES KE ALE+L 
Sbjct: 314  LEYLEDIIGTTKYKELIDKKFIEIEALNDICIERENRFDIIDREKESLESEKESALEYLS 373

Query: 353  KERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEIN 412
            KE++  I+K++L+Q +I+ +N KL+ + +KI+ L  E+ +EK++   L+ + + L     
Sbjct: 374  KEKEQVIVKSKLIQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLYT 433

Query: 413  NTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVN 472
              + E  AL  + K + + KRSL+ D ++  E+LK+I +KLK   K     E + K   +
Sbjct: 434  KNQDELQALLKDEKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEI---EEDLKTISS 490

Query: 473  EIESLKKNHDD---CEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEP 529
                LK  HD+    E +L  L++++  E + L  IK+ L +KT  LS+E+   E+ LEP
Sbjct: 491  SNVRLKNFHDNKKLFETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEEILKTEKDLEP 550

Query: 530  FRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNE 589
            +  ++ E +SEI++ E++  + + S + L   KA IE+  +D               +N 
Sbjct: 551  WNIKLDELKSEIQIKESEKALFEESKNKL---KANIEALEKDVNEKSKLTEDRRKEVKNL 607

Query: 590  KSKVE---ARISTAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALT 646
             +K+E     +     E ++A ++  EM+ +LIQ RQ   +A+ +L+  +N+++VL AL 
Sbjct: 608  MTKLENVSKEVIFGTNELKKANEKLCEMQKILIQDRQKANDARTSLSNVENRSKVLRALL 667

Query: 647  KLQNSGRITGFHGRLGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLG 706
            KLQ SGRI GFHGRLG+LG ID++YD+AISTACPRL+DIVV++VECGQQCI++LRKN LG
Sbjct: 668  KLQKSGRINGFHGRLGNLGVIDEKYDVAISTACPRLNDIVVDSVECGQQCIEYLRKNNLG 727

Query: 707  YGRFILLDKLRKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANR 766
            + RFILLDKL K ++++I+TP NVPRLFDLI    + F PAFYSVLR+TLVA DL++AN 
Sbjct: 728  HARFILLDKLNKFSMEKISTPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANA 787

Query: 767  VAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLMRSKATTA---SQYSRDEVEKMEVQ 823
            VAYGK R+RVVTL G LIDISGTMSGGG+    G M+   +T+   S YS +EV ++E +
Sbjct: 788  VAYGKTRYRVVTLKGNLIDISGTMSGGGNQASKGAMQLSNSTSKEKSTYSSEEVMEIEKE 847

Query: 824  LSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQL 883
            LS +E NY++A + V EME  L+ L +  P+I+++ISK+  E  S   E     ++L++ 
Sbjct: 848  LSIREKNYQNAYNTVQEMEIELRNLKESEPKIELEISKLNFEIDSLENECSLKRKQLNEP 907

Query: 884  ARELSMNEKNQQPLLDEEKKLDILRQHLQQTIDAS-KFSQDKIDDLKDRIMQKGGIELKM 942
                S+ +     + + +  L  L +  Q+ I++  K  +D+I +L+D+IM+ GGI+L+M
Sbjct: 908  NASFSIEDNMSADITEMDNALYTLNEK-QKLIESQMKSKKDRIKELQDKIMKIGGIKLQM 966

Query: 943  QIAKVASLEQHIEILHEXXXXXXXXXXXLDIDLARATREKNKYSEEVLVCNKDISILSEQ 1002
            Q +KV SL++  +IL +           ++ D+ R   +K K SE       D + L+E+
Sbjct: 967  QNSKVDSLQEQKKILIKKQKSEKAGIMKIESDV-RKLSKKLKESES------DNTKLNEK 1019

Query: 1003 LESIRLEKERIEEQVIEN-------NERKAELNSSVEKLKQELLSIERDSNEFKAKELEY 1055
              ++  E + IEE + +N        ++K  L    E    EL  +E   +EFK  E+EY
Sbjct: 1020 KIALENELKNIEELLAQNENNMNCIQDKKFTLREKSEITMNELTEMEGLLSEFKTLEVEY 1079

Query: 1056 SDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQLNDGIIESCTDVTAKVMNGDI 1115
              + EKL  L   +KK L++ E    SL IR+V+  L  LN  I E         +  D 
Sbjct: 1080 KIKSEKLASLLNQIKKILKALEEDHSSLSIREVAYDLDLLN--IKEQEAQKIKTELYADF 1137

Query: 1116 VQTQSITDVGNNDAMEDSGEAATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGD 1175
             Q QS  DV N++ + +        G+PS                   QLQDY +    D
Sbjct: 1138 EQNQS-NDVINDEMIIEDNNNEIAKGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVD 1196

Query: 1176 IEVLEEYARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEM 1235
            +++LEEY RR+ EY++RK DLNQ+V +R++VR + E  K  R  +FME F IISMTLKEM
Sbjct: 1197 LDILEEYTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEM 1256

Query: 1236 YQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHK 1295
            YQ+ITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHK
Sbjct: 1257 YQIITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHK 1316

Query: 1296 YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNN 1355
            YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+ LVGIYKN 
Sbjct: 1317 YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNV 1376

Query: 1356 NMTKSTTLQNIDIL 1369
            N TKS TL+N DIL
Sbjct: 1377 NQTKSATLKNNDIL 1390

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1112 bits (2877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/1410 (45%), Positives = 891/1410 (63%), Gaps = 65/1410 (4%)

Query: 10   LGDSPEIKRQRVS------------------QSPTR-TPRKLVLGSPEKKYAVSNSQATT 50
            + D P  KRQ+V+                  QSP   TPR L LGS  +          T
Sbjct: 1    MSDRPVSKRQKVTEEDEEEDVIHTPKAVTFEQSPRAITPRNL-LGSENRNVL------PT 53

Query: 51   AASNTMDPPSLQPP-TAHAVRGREYSQXXXXXXXXXXXXXXXXKLELIRLSPKKSTRLEL 109
              S  +  PSL PP +  + RGR++ +                +L+LI LSP K++R EL
Sbjct: 54   GGSQNLQIPSLLPPESLGSARGRDF-KSYSQSPPRSPGRSPTRRLKLIELSPIKNSRAEL 112

Query: 110  QKMHEANT--QTSQRLCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSM 167
            QK++E+       +RL I +LVLN+FKSYAG Q IGPFHTSFSA+VGPNGSGKSNVIDSM
Sbjct: 113  QKLYESKKLDVKKERLFIHQLVLNDFKSYAGRQVIGPFHTSFSAIVGPNGSGKSNVIDSM 172

Query: 168  LFVFGFRANKMRQGKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVV 227
            LFVFGFRANKMRQ +LS+LIHKSE FP L SCSV++HF YV D D+G T I  + G +VV
Sbjct: 173  LFVFGFRANKMRQDRLSDLIHKSETFPDLKSCSVEVHFKYVIDKDDGSTTIDETKGNLVV 232

Query: 228  ERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKD 287
             R+AFKNN+SKY+VNGKESNYTEVT LLK+EGIDLDHKRFLILQGEVE+IAQMKAKAEK+
Sbjct: 233  TRKAFKNNASKYFVNGKESNYTEVTTLLKKEGIDLDHKRFLILQGEVENIAQMKAKAEKE 292

Query: 288  NDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEA 347
            NDDGLLEYLEDIIGT+K+K  IEK   EIE+LNE+C+EKENRF +V++EK +LESGKEEA
Sbjct: 293  NDDGLLEYLEDIIGTSKYKESIEKLSMEIESLNEICVEKENRFSIVEREKNSLESGKEEA 352

Query: 348  LEFLDKERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETL 407
            L+FL+KE++  + K++L Q  +   N+KL    +K + +  E  +++ ++         +
Sbjct: 353  LQFLNKEKELVLEKSKLYQYNLMQDNKKLDDVLNKKTNVQQEQTKQEDEFRKANSHISDI 412

Query: 408  THEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNG 467
            T  +N  K +   + TE  N++  KR+LE   +  ++ + ++  K K  E+     +   
Sbjct: 413  TASLNVLKADLEKVHTEEVNLSKTKRTLENKKVENEQIVNNLDSKRKEFEEQSKILQDKI 472

Query: 468  KAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQL 527
             +   EI+++ +           L+ ++ IEKEKL  IK+ L EKT+ L+ ++   E++L
Sbjct: 473  NSTDQEIQTIIEEQSSLAEGTTVLSTNLDIEKEKLENIKLKLREKTEHLTIQIAEYEKEL 532

Query: 528  EPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXR 587
             P+ +Q Q+ + EIK++E+++++++ +   L  + A +E+ I                  
Sbjct: 533  SPWNEQSQQLKKEIKITESELSIIEENRKGLENDIAGLENAILSQKRDLEVQEQEIKSLL 592

Query: 588  NEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTK 647
             +K+KV       ++EC+ AQ     +R+ +   RQ   E ++  +  +N N+VL AL +
Sbjct: 593  EQKTKVIQERELGERECKNAQATLANVREKVEALRQKAIEIRSTYSATENNNKVLSALLR 652

Query: 648  LQNSGRITGFHGRLGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGY 707
            LQ SGR+ GFHGRLGDL  ID +YD+AISTACPRL+D+VV+TVE GQQCI++LRKNKLGY
Sbjct: 653  LQKSGRLNGFHGRLGDLAVIDPKYDVAISTACPRLNDLVVDTVESGQQCIEYLRKNKLGY 712

Query: 708  GRFILLDKLRKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRV 767
             RFILLDKL   N +RI TP+   RLFDLIT     F  AFYSVLRDTLV ++++QANRV
Sbjct: 713  ARFILLDKLNTFNTNRIDTPDQSQRLFDLITVKEKRFNNAFYSVLRDTLVCQNMEQANRV 772

Query: 768  AYGKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLMRSKATTASQ---YSRDEVEKMEVQL 824
            AYGK+R+RVVTLDG LID+SGTM+GGG +   GLM+   +++     +S +EV+ +E +L
Sbjct: 773  AYGKKRYRVVTLDGNLIDLSGTMTGGGRNVSKGLMKLSKSSSKGSAFFSPEEVQAIENEL 832

Query: 825  STKETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLA 884
            + KE  Y+SAL   HEME  L++L DR PEID  +SK +++  +   ++ S    L +  
Sbjct: 833  NQKENQYKSALDAYHEMEEELRRLRDRAPEIDNLVSKKEMDIETAHNDINSNINVLEEKR 892

Query: 885  RELSMNEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQI 944
            ++L   +    P +    KL  L+  L      +K ++DKI  +KD+I++ GG ELK Q 
Sbjct: 893  KKLESMKNQNDPSITLLAKLKELKSKLDDIDVQTKSTKDKIKTIKDKIIELGGDELKNQS 952

Query: 945  AKVASLEQHIEILHEXXXXXXXXXXXLDIDLARATREKNKYSEEVLVCNKDISILSEQLE 1004
              V  +   I                +  +  +      K+++E+   N++++  S+  E
Sbjct: 953  LLVTDITNKI-------SENSRRLKKIKSNKLKKESLLKKFNKELTEANEELTNFSKNAE 1005

Query: 1005 SIRLEKERIEEQV------IEN-NERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSD 1057
            +  +E + IE ++      IEN  E + +L   +E    EL S ++  +++K+  LEY++
Sbjct: 1006 NADIESKEIESKLLDIKESIENLKENEVKLEHEIEMKHNELESHQKVVSDYKSISLEYNN 1065

Query: 1058 RLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQL----NDGIIESCTDV--TAKVM 1111
            +LEKL   +  +KK ++ Y   L  L IRDV+++L+ +    N  + +S   +  T+ V+
Sbjct: 1066 KLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVLNTIMTEENASVDKSDPKLENTSAVI 1125

Query: 1112 NGD------IVQTQSITDVGNNDAME------DSGEAATHSGLPSXXXXXXXXXXXXXXX 1159
            N D      + + QS      ND ++      DS     + G+P                
Sbjct: 1126 NADDDGISAVSENQSFNHNDENDDIDSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVE 1185

Query: 1160 XXXHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLE 1219
                 L D++ +   +++VLEEYA R  E+ +RK DLN AV  R+ V+++ E  K +R +
Sbjct: 1186 LLITSLDDFITSSEANVDVLEEYALRFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYD 1245

Query: 1220 KFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSG 1279
            +FMEGF IISMTLKEMYQMIT+GGNAELELVDSLDPFSEGV FSVMPPKKSWRNISNLSG
Sbjct: 1246 EFMEGFKIISMTLKEMYQMITLGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSG 1305

Query: 1280 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1339
            GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN
Sbjct: 1306 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1365

Query: 1340 NMFELAQNLVGIYKNNNMTKSTTLQNIDIL 1369
            NMFEL + LVGIYK+ NMTKS  L N D++
Sbjct: 1366 NMFELTKQLVGIYKHENMTKSAALVNEDLV 1395

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  259 bits (662), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 345/1341 (25%), Positives = 603/1341 (44%), Gaps = 228/1341 (17%)

Query: 128  LVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELI 187
            L LNNFKSY GI ++G   ++F++++GPNGSGKSN++D++ FV G R++ +R   + +LI
Sbjct: 7    LELNNFKSYKGITKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNIVKDLI 66

Query: 188  HK--------SEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNS-SK 238
            ++        + +   + S  V+    Y  +T +            V   RA   N  + 
Sbjct: 67   YRGVINDNGDTNEHGKVTSAYVKAF--YEKNTADDGDNDDDDDERPVELMRAISTNGDTT 124

Query: 239  YYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLED 298
            Y +NGK   Y E +  L+ E I +  K FL+ QG+VE IA   +++  D    L +  E+
Sbjct: 125  YKINGKTVTYKEYSEFLERENILIKAKNFLVFQGDVEQIA---SQSPMD----LSKLFEE 177

Query: 299  IIGTAKFKPQIEKCLEEIETLNEVCMEK-ENRFEL------------VDKE-KQNLESGK 344
            + G+ ++K + ++  E+IE LN+   E   NR  +             D+E K N+E  K
Sbjct: 178  VSGSIQYKKEYDELKEQIEKLNQSAAESIRNRRRIHGELKTYKEGITKDEEYKNNIEKRK 237

Query: 345  E-------EALEFLDKERKHTI-----LKAQL--LQRQIYDSNRKLATSCDKISALNMEF 390
            +         L  L+ E+K ++      K+++  L+ +I +  + L  S       N++ 
Sbjct: 238  KYYMYLVLWQLYHLENEKKKSLDNLKNAKSEISQLKNKITNEEKNLQRSKSSFLKENLKV 297

Query: 391  QEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIA 450
             +++ Q  +  KE + L  ++N+ K    A      N+  +  S++KD       + +  
Sbjct: 298  NKKREQLNYQLKEKDKLLEDLNSIKIPQRAASKRINNIEKRIESIQKDIERQQGYINTFE 357

Query: 451  RKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLH 510
             +LK   KA    E   K +         + DD ++   +LN    +E     E +I L 
Sbjct: 358  NQLKVVTKAKESFEREIKESAQNSNKYSLSDDDLKL-YESLNEKYLMENGSAIEQQISLL 416

Query: 511  EKTK-DLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKI 569
               K ++ +EM+ L R+++  + +I E   E+ +S+ +I        + L EK +I S  
Sbjct: 417  NNDKQEVLEEMDRLNRKIDASKKRITE---ELLISQERIQNENIELVSSLNEKNSIFS-- 471

Query: 570  EDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQ---TN-EMRDVLIQ----- 620
                               EK+     + T Q E E +  Q   TN ++R+ L++     
Sbjct: 472  -------------------EKTH---ELKTLQAEIESSNNQEYDTNYKLRETLLKLDDLN 509

Query: 621  --QRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLG-TIDDQYDIAIST 677
              QR+ ++E K   N           +T L+      G  G + DL     D+Y +A+ST
Sbjct: 510  ANQRESIKEKKLREN-----------VTMLKRF--FPGVRGLVHDLCRPKKDKYGLAVST 556

Query: 678  ACPR-LDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPE-NVPRLFD 735
               +  D I+V+ +   Q+CI   +K + G   FI LD +          P  N+P   D
Sbjct: 557  ILGKNFDSIIVDNLNVAQECIAFFKKQRSGTASFIPLDTISS------EQPTLNLPSSQD 610

Query: 736  LITPVRDL-----FRPAFYSVLRDTLVARDLQQANRVAYGKR-RFRVVTLDGKLIDISGT 789
             I  +  +     +  A   V  D+++   L  A  + + K  R ++VT++G LI  +G 
Sbjct: 611  YILTINAIEYDPEYERAMQYVCSDSIICNSLDIARDLKWNKGVRSKLVTIEGALIHKAGL 670

Query: 790  MSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLT 849
            M+GG S            + +++ ++E + +   ++ K+      L  V E+ +  +  +
Sbjct: 671  MTGGISKD----------SNNRWDKEEYQSL---MTLKD----KLLLQVEEISTKSRLSS 713

Query: 850  DRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNE---KNQQPLLDEEKKLDI 906
             R  +++I++S +        AE+ S   +LSQ+ R L  N+    +Q  LLD++    +
Sbjct: 714  TRARDVEIELSTLN-------AEISSLRMQLSQVQRSLDENKTEINHQNTLLDQQYNPKL 766

Query: 907  LRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIA-KVASLEQHIEILHEXXXXXX 965
              + L++ +D    S +++   K+++  +   EL  ++   +   E+H   L        
Sbjct: 767  --KSLKEKVDEFDKSWNELKSNKEKLQNEIFKELTDKVGFTIEEYERHSGEL-------- 816

Query: 966  XXXXXLDIDLARATREKNKYSEEVL-VCNKDISILSEQLESIRLEKERIEEQVIENNERK 1024
                     L + ++E  +  +E+L + NK           ++ E ER+E       +R 
Sbjct: 817  ---------LRKQSKELQQLQKEILNIENK-----------LQFEIERLEN----TQKRL 852

Query: 1025 AELNSSVEKLKQELLSIERDSNEF----KAKELEYSDRLEKLHGLQEYVKKQ---LRSYE 1077
                S++EK  + L S+++D NE     K  E E +    +L  + +    Q   +   E
Sbjct: 853  TSAESNLEKAHETLKSLQKDENELAEQVKQIESEINSARNELDSVNKVFTAQQLDINRME 912

Query: 1078 TSLQSLKIRDVSKLLSQLNDGIIESCT--DV-------TAKVMNGDI--VQTQSITDVGN 1126
             SL  L   D S+ L +  D I E     D+        AKV N DI  +   +++D+  
Sbjct: 913  ESLGEL--NDNSQTLKRNRDEIKEDIAKNDLERIGILKNAKVTNIDIPVISETNLSDLPI 970

Query: 1127 NDAMEDSGEAAT-----HSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEE 1181
            +   ED+   +      ++ LP+                    ++D LD       VL+ 
Sbjct: 971  DRIDEDTISVSNEIDVDYTALPAKYKEEMGSATKNELDTKIKNVEDLLD-------VLQP 1023

Query: 1182 YAR---RLAEYQRRKLDLNQAVAK-REEVRNKCESF---KNERLEKFMEGFGIISMTLKE 1234
             AR   R  E Q R   ++    K +   R   + F   K +R E F   F  +S  L  
Sbjct: 1024 NARAADRFTEAQERFEIIDGETEKIKTTERKALQQFLKIKKKRKELFENAFDFVSEHLDN 1083

Query: 1235 MYQMIT---------MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLS 1285
            +Y+ +T          GGNA L L D  +PF+ GV +   PP K ++++  LSGGEKT++
Sbjct: 1084 IYRELTRNPNSSADLAGGNASLTLEDEDEPFNAGVRYHATPPLKRFKDMEYLSGGEKTVA 1143

Query: 1286 SLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFEL 1344
            +LAL+FA++ Y+P+P +V+DE+DAALD  NV  +A YI+     N QFIVISL+N MFE 
Sbjct: 1144 ALALLFAINAYQPSPFFVLDEVDAALDITNVERIAAYIRRHGNPNLQFIVISLKNTMFEK 1203

Query: 1345 AQNLVGIYKNN--NMTKSTTL 1363
            +  LVG+++    N +K  TL
Sbjct: 1204 SDALVGVFRQQQENSSKIVTL 1224

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (REAL)
          Length = 1264

 Score =  258 bits (658), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 327/1329 (24%), Positives = 603/1329 (45%), Gaps = 185/1329 (13%)

Query: 116  NTQTSQRLCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA 175
            N  T  RL    L L+NFKSY GI ++G   ++F++++GPNGSGKSN++D++ FV G R+
Sbjct: 33   NQSTMGRLV--GLELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRS 90

Query: 176  NKMRQGKLSELIHKS-------EQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVE 228
            N +R   L +LI++        E   S A  +         + ++   K     G  +VE
Sbjct: 91   NHLRSNILKDLIYRGVLDDGNDENIDSGADDNA-----ITSNPNSAYVKAFYQKGNKLVE 145

Query: 229  --RRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEK 286
              R   +N  + Y ++GK   Y + +  L+ E I +  K FL+ QG+VE IA   A++  
Sbjct: 146  LTRLISRNGDTTYKIDGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIA---AQSPT 202

Query: 287  DNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEE 346
            D    L    E++ G+ ++K + ++  E+IE L++   E       +  E +  + G  +
Sbjct: 203  D----LSRMFEEVSGSIQYKKEYDELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINK 258

Query: 347  ALEFLDK-ERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAE 405
              E+  + ++K+ + K Q L + +Y   +K     DK+SA N E    K   E +  E +
Sbjct: 259  NEEYRKQVDKKNELQKFQALWK-LYHLEQKKEELTDKLSASNSEIMSLK---ERINNETK 314

Query: 406  TLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATD-EKLKSIARKLK----AAEKAF 460
            +L    ++  KEST +        SK++S + D+I  D EKL S  R +K    AA +  
Sbjct: 315  SLQRSKSSFVKESTVI--------SKQKS-KLDYIVKDKEKLMSDLRLIKVPQQAAGRRI 365

Query: 461  SQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSI------------SIEKEKLNE--IK 506
            S  E    +   ++E  +   +  E +L  +  S             + +K KLNE  +K
Sbjct: 366  SHIEKRIGSLQRDLERQESYVERFETQLKVITKSKKTFEEEIKESARNYDKFKLNESDLK 425

Query: 507  IH--LHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIK-------LSETKITMLKSSHSN 557
             +  LHEK   L+Q    LE ++    +  QE   E+        +S+ +IT        
Sbjct: 426  TYDSLHEKY--LTQGGSILEEKISLSNNDKQEIVDELDRFNKRADISKRRIT------EE 477

Query: 558  LLKEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNE---- 613
            L      +++++ D                NE  K+++ I +A  +  +   +  E    
Sbjct: 478  LFITGEKLDTQLNDLRASLNEKNALHTERLNELKKLQSDIESANNQEYDLNFKLRETLVK 537

Query: 614  MRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDL-GTIDDQYD 672
            + D+   QR+ ++E K   N         +A+ K        G  G + DL     ++Y 
Sbjct: 538  IDDLSANQRETMKERKLREN---------IAMLK----RFFPGVKGLVHDLCHPKKEKYG 584

Query: 673  IAISTACPR-LDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVP 731
            +A+ST   R  D ++VE +   Q+CI  L+K + G   FI LD + +  L  ++ P++  
Sbjct: 585  LAVSTILGRNFDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTI-ETELPTLSLPDSQ- 642

Query: 732  RLFDLITPVRDL-----FRPAFYSVLRDTLVARDLQQANRVAYGKR-RFRVVTLDGKLID 785
               D I  +  +     +  A   V  D+++   L  A  + + K  R ++VT++G LI 
Sbjct: 643  ---DYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKGVRAKLVTIEGALIH 699

Query: 786  ISGTMSGGGSSPQSGLMRSKATTASQYSRDEV-------EKMEVQLSTKETNYRSALSMV 838
             +G M+GG S            T +++ ++E        +K+ +Q+     + RS+    
Sbjct: 700  KAGLMTGGIS----------GDTNNRWDKEEYQSLMSLKDKLLIQIDELSNSQRSSSIRA 749

Query: 839  HEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQ---------RLSQLARELSM 889
             E+E+++  L   +  +  Q+++ +        E++ YH          ++++L ++L  
Sbjct: 750  REVENSVSLLNSDIASLRTQVTQQKRSLDENKLEIK-YHNDLIDNEIQPKITELEKKLEH 808

Query: 890  NEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVAS 949
             EK +  L  E++K  +  +  ++  +   FS  + +     +M++   EL+    ++ +
Sbjct: 809  LEKTKNEL--EKEKEALQSEVFKEFTEKIGFSIKEYESHSGELMRQQSKELQQLQKQILT 866

Query: 950  LEQHIEILHEXXXXXXXXXXXLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLE 1009
            +E  ++   +              DLA    E     E+       I  +  +LE  ++ 
Sbjct: 867  VENKLQFETDRLNTTQRRYEKAQRDLANVQIEMKSLEEQEETTETKIKAIESKLEENKMH 926

Query: 1010 KERIEEQVIENNERKAELNSS---VEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQ 1066
             + ++++ I N   +++LNS+   +E L   L +++R+ +                 G++
Sbjct: 927  LDELQKKFIAN---QSDLNSTEDILEDLNNNLQALKRERD-----------------GIK 966

Query: 1067 EYVKKQLRSYETSLQSLKIRDVSKLLSQLNDGIIESCTDVTAKVMNGDIVQTQSITDVGN 1126
            E ++K      T+L++ KI       S +N  I+   T     + +GD   +++I+   N
Sbjct: 967  EDIEKFDLERVTALKNCKI-------SNINLPILSETTIDDLPISSGD---SEAISISNN 1016

Query: 1127 NDAMEDSGEAATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRL 1186
             D          + GLP                    +  + L+    +   +E Y    
Sbjct: 1017 IDV--------DYQGLPKKYKENSNDSARKELEQKITEADEILNELQPNARAVERYDEAE 1068

Query: 1187 AEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMIT------ 1240
              +     +  +  ++ +++ N+    K +R E F + F  +S  L  +Y+ +T      
Sbjct: 1069 ERFDVINNETEELKSEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNST 1128

Query: 1241 ---MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYK 1297
                GGNA L + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+
Sbjct: 1129 VELAGGNASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQ 1188

Query: 1298 PTPLYVMDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQNLVGIYKNN- 1355
            P+P +V+DE+DAALD  NV  +A YI + R  + QFIVISL+N MFE +  LVG+Y+   
Sbjct: 1189 PSPFFVLDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQ 1248

Query: 1356 -NMTKSTTL 1363
             N +K+ TL
Sbjct: 1249 ENSSKTVTL 1257

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  250 bits (638), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 327/1318 (24%), Positives = 586/1318 (44%), Gaps = 185/1318 (14%)

Query: 128  LVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELI 187
            L L+NFKSY GI ++G   ++F++++GPNGSGKSN++D++ FV G R+N +R   L +LI
Sbjct: 7    LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 188  HKSEQFPSLASCSVQIHFHYVHDTD--NGETKILPSAGTMVVE--RRAFKNNSSKYYVNG 243
            ++                  V  ++  +   K     G  +VE  R   +N  + Y ++ 
Sbjct: 67   YRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQKGNKMVELMRIISRNGDTSYKIDE 126

Query: 244  KESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTA 303
            K  +Y + +  L+ E I +  K FL+ QG+VE IA             L    E++ G+ 
Sbjct: 127  KTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSRMFEEVSGSI 179

Query: 304  KFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDK-ERKHTILKA 362
            ++K + ++  E+IE L++   E       +  E +  + G  +  E+  + E+K  + K 
Sbjct: 180  QYKKEYDELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQVEKKSELQKF 239

Query: 363  QLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALE 422
            Q L  Q+Y   ++     DK+SA N E    K          E + HE+ + ++  ++  
Sbjct: 240  QALW-QLYHLEQQKEELTDKLSASNSEISSLK----------EKINHEMKSLQRSKSSFV 288

Query: 423  TESKNVNSKKRSLEKDFIATD-EKLKSIARKLK----AAEKAFSQSESNGKAAVNEIESL 477
             ES  ++ +K  L  ++I  D EKL S  R +K    AA K     E   ++   +++  
Sbjct: 289  KESAVISKQKSKL--NYIIKDKEKLVSDLRLIKVPQQAAGKRVLHIEKRIESLQRDLQRQ 346

Query: 478  KKNHDDCEIELHNLNHSI------------SIEKEKLNEIKIH----LHEKTKDLSQEME 521
            K   +  E +L  +  S             + +K KLNE  +     LHEK   L++   
Sbjct: 347  KAYVERFETQLKVVTKSKKTFEEEIKESARNYDKFKLNENDLETYNCLHEKY--LTENGS 404

Query: 522  SLERQLEPFRDQIQEKQSEIK-------LSETKITMLKSSHSNLLKEKATIESKIEDXXX 574
             LE ++  + +  QE Q E+        +S+ +IT       ++  EK  +++++ D   
Sbjct: 405  ILEEKIALYNNDKQEIQEELDRFNKRADISKRRIT----EELSVTGEK--LDTQLNDLRA 458

Query: 575  XXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNE----MRDVLIQQRQIVEEAKA 630
                         +E  K+++ I +A  +  +   +  E    + D+   QR+ ++E K 
Sbjct: 459  SLNEKNAVHTERLHELKKLQSDIESANNQEYDLNFKLRETLVKIDDLSANQRETMKERKL 518

Query: 631  NLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLG-TIDDQYDIAISTACPR-LDDIVVE 688
              N         +A+ K        G  G + DL     ++Y +A+ST   +  D ++VE
Sbjct: 519  REN---------IAMLK----RFFPGVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVE 565

Query: 689  TVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDL-ITPVRDLFRPA 747
             +   Q+CI  L+K + G   FI LD + +  L  ++ P++   +  +        +  A
Sbjct: 566  NLTVAQECIAFLKKQRAGTASFIPLDTI-ETELPTLSLPDSQEYILSINAIDYEPEYEKA 624

Query: 748  FYSVLRDTLVARDLQQANRVAYGKR-RFRVVTLDGKLIDISGTMSGGGSSPQSGLMRSKA 806
               V  D+++   L+ A  + + K  R ++VT++G LI  +G M+GG S   +     + 
Sbjct: 625  MQYVCGDSIICNSLKIAKGLKWNKGVRAKLVTIEGALIHKAGLMTGGISGDANNRWDKEE 684

Query: 807  TTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEK 866
              +    +D   K+ VQ+     + RS      E+E+++  L   +  +  Q+++ +   
Sbjct: 685  YQSLMSLKD---KLLVQIDELSNSQRSNSIRAREVENSVSLLNSDIASLRTQVTQQKRSL 741

Query: 867  GSRVAEVESYHQRLSQLARELSMNEKNQQPLLDE-EKKLDIL----------RQHLQQTI 915
                 E++ YH  L          EK  QP + E EKKLD L          ++ LQ  I
Sbjct: 742  DENNLEIK-YHNDLL---------EKEIQPKITELEKKLDDLENTKNGLEKEKEILQNDI 791

Query: 916  -----DASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXXXX 970
                     FS  + ++    +M++   EL+    ++ ++E  ++   +           
Sbjct: 792  FKEFTSKIGFSIKEYENHSGELMRQQSKELQQLQKQILTVENKLQFETDRLNTTQRRYEK 851

Query: 971  LDIDLARATREKNKYSEEVLVCNKDISILSEQLES-----IRLEKERIEEQVIENNERKA 1025
               DL +A  E +   E+       I  +  +LE      + LEK+ + +Q        +
Sbjct: 852  ARKDLEKAQVEMSSLEEQEHAIEMKIESIGSKLEENKNHLVELEKKLVTKQ--------S 903

Query: 1026 ELNSSVEKLKQ-----ELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSL 1080
            +LNSS + L+      ++L  ERD                   G++E V+K      T+L
Sbjct: 904  DLNSSEDILEDMNSNLQVLKRERD-------------------GIKEDVEKNDLEKVTAL 944

Query: 1081 QSLKIRDVS-KLLSQ--LNDGIIESCTDVTAKVMNGDIVQTQSITDVGNNDAMEDSGEAA 1137
            ++ KI +++  +LSQ  L+D  I S  D  A  ++  IV                     
Sbjct: 945  KNCKISNINLPILSQTTLDDFPI-SSRDSDAITISNSIV--------------------V 983

Query: 1138 THSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLN 1197
             + GLP                    ++++ L+    +   +E Y      ++    +  
Sbjct: 984  DYKGLPKKYKENNSDSAKRELEQKIREIEEILNELQPNARAVERYDEAEGRFEVINNETE 1043

Query: 1198 QAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMIT---------MGGNAELE 1248
            Q   + +++ N+    K +R E F + F  +S  L  +Y+ +T          GGNA L 
Sbjct: 1044 QLKTEEKKILNQFLKIKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLT 1103

Query: 1249 LVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1308
            + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+D
Sbjct: 1104 IEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVD 1163

Query: 1309 AALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQNLVGIYKNN--NMTKSTTL 1363
            AALD  NV  +A YI + R  + QFIVISL+N MFE +  LVG+Y+    N +K  TL
Sbjct: 1164 AALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIITL 1221

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  249 bits (635), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 337/1346 (25%), Positives = 599/1346 (44%), Gaps = 245/1346 (18%)

Query: 130  LNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHK 189
            L NFKSY G   IG   ++F++V+GPNGSGKSN++D++ FV G ++  +R   L++LI++
Sbjct: 9    LYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLIYR 68

Query: 190  SEQFPSLASCSVQIHFHYVHDTDNGETKIL------PSA---GTMVVERRAFKNNSSKYY 240
                 +L        +   HD +N  +         PS        + R    +  S Y 
Sbjct: 69   G----TLQDGDADSGYSETHDNENNPSSAYVKAFYSPSGQENDVAELTRTITLSQESTYK 124

Query: 241  VNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDII 300
            +NG+  ++ +    L+ E I +  + FL+ QG+VE +A  K +        L    E + 
Sbjct: 125  LNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPRE-------LTTLFEQVS 177

Query: 301  GTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQ---NLESGKEEALEFLDKERKH 357
            G+ ++K + ++  EE+E       E      L+   K+    L+S KE  +   ++ RKH
Sbjct: 178  GSIQYKQEYDRLREELEKARSATSE------LIQSRKRANIGLKSFKE-GVNKDEEYRKH 230

Query: 358  ----TILKAQLLQRQIYDSNRK-------LATSCDKISALNMEFQEE-------KSQYEH 399
                  L+ QL+  Q++    K       L +S  ++ +L+ E   E       K  Y  
Sbjct: 231  LEERNKLQQQLIVWQLFHLQAKRDSLTESLKSSQRELQSLDSELNSEEQIVAKKKLSYAK 290

Query: 400  LQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKA 459
             Q  A      +++  K+   L +    + S K S++K   A   K++S+ R +   E  
Sbjct: 291  KQTLAAKQRTRLSDKTKKVDHLTSSLLPIKSSKESIDKRLSAAVTKIESLQRDIDRQESL 350

Query: 460  FSQSESN----GKAAVN---EIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEK 512
              Q E       KA  N   EI+   K+  D ++   NL     +++  L+     L +K
Sbjct: 351  VKQYEHQLKVVNKAKTNFQAEIDESAKSSGDFKLNEANLKRYEDLKETFLSSGGSELEDK 410

Query: 513  -------TKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATI 565
                   ++++S E+E   RQL+  R ++ E+    K        L++  S L KE +  
Sbjct: 411  LLLEKNESQEISDEIELYSRQLDASRLKVNEELGAEK------EALENEVSELTKELSGK 464

Query: 566  ESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQIV 625
             S++                  N + +V  ++          ++   ++ D+   QR+  
Sbjct: 465  TSQVSAAVKKLKELQSRAEYNNNREYEVSFKL----------KETLTKLDDMNATQRETA 514

Query: 626  EEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTID-DQYDIAISTACPR-LD 683
            +E K   N        +  L +L       G  G + +L     ++Y +A+ST   +  D
Sbjct: 515  KERKLREN--------VSILRRL-----FPGVRGLVHELCRPKKEKYTVAVSTILGKSFD 561

Query: 684  DIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRL-FDLITPVRD 742
             ++V+     QQC+  L+K + G   FI LD +    +  +A       L  D I   RD
Sbjct: 562  AVIVDHFSVAQQCVSFLKKQRSGILSFIPLDTIDVNKVSMMALDTKGCTLAIDAIDYERD 621

Query: 743  LFRPAFY----SVLRDTL-VARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSP 797
            L R   Y    S++ D+L +A+DL+    V     R ++V+LDG ++  +G M+GG    
Sbjct: 622  LERAMQYVCSDSIICDSLAIAKDLKWRRNV-----RAKLVSLDGSIVHKAGLMTGG---- 672

Query: 798  QSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDI 857
                     TT S  +R + E+ +  +S K+T     L  + E+ SA    ++R+   + 
Sbjct: 673  ---------TTKSSGNRWDKEEYQGLMSLKDT----LLGEISELSSANTIDSERIRSTEN 719

Query: 858  QISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKN-----QQPLLDEEKKLDILRQHLQ 912
            ++S +        ++V S   +L+Q+ R  S+NEK      QQ L+  E +  I  Q L+
Sbjct: 720  ELSFLN-------SDVMSLRTQLNQVKR--SLNEKETEIQYQQELIKGEFEPKI--QSLK 768

Query: 913  QTIDASKFSQDKIDDLKDRIMQ------KGGI-----------------------ELKMQ 943
            + + A   +  + ++ KDR++       +G I                       +L+MQ
Sbjct: 769  EAMTAHAKTTARFEEEKDRLLDSVYADFEGDIGFKVSQYEKHSGEMMRRQLEDLRKLQMQ 828

Query: 944  IAKVASLEQHIEILHEXXXXXXXXXXXLDIDLARATREKNKYSEEVLVCNKDISILSEQL 1003
            IA    +E+ +E   E           + +D+     EK K   E L  N D   +++++
Sbjct: 829  IA---GIEKKLEFETERLQSTQERQQRVQVDI-----EKAKIKLEAL--NSDEQRITDEI 878

Query: 1004 ESIRL----EKERIEEQVIENNERKAELNSSVEKLKQ--ELLSIERDSNEFKAKELEYSD 1057
            + + L    E+ R++    E N+   ELNSS E +++  E L   +  +E  A++++  +
Sbjct: 879  QGVELTINEEQTRLDNLQNEINKDLVELNSSEETIQEATEHLQSAKRMHEALAEDID-KN 937

Query: 1058 RLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQLN-DGIIESCTDVTAKVMNGDIV 1116
             LEK + L+             + ++K+ D S  L ++  DG+    +D T +  N   V
Sbjct: 938  SLEKANVLKN----------CKMLNIKLPDGSSSLERVPLDGV----SDATIEAANAVFV 983

Query: 1117 QTQSITDVGNNDAMEDSGEAATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDI 1176
                +     N  ++ SGEA T                        ++LQ  +D  N  +
Sbjct: 984  NFTRL-----NRRLKQSGEAETG-----------------------NELQRSIDELNELL 1015

Query: 1177 EVLEEYARRLAEYQRRKLDLNQAVAKREE-------VRNKCESFKNERLEKFMEGFGIIS 1229
             VL+  ++    Y+  K+       + E+       V  +    +  R + F   F  +S
Sbjct: 1016 TVLQPNSKAAGRYEEAKVKYESIFKETEKCKTKEKKVNEQFAKIRRLRKDAFESAFDHVS 1075

Query: 1230 MTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGG 1280
              + ++Y+ +T          GGNA L L D  +P+  G+ +   PP K ++++  LSGG
Sbjct: 1076 NAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPYLAGIRYHATPPTKRFKDMEFLSGG 1135

Query: 1281 EKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT-KNAQFIVISLRN 1339
            EKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  +A YI++R   N QFIVISL+N
Sbjct: 1136 EKTIAALALLFAINSFQPSPFFVLDEVDAALDILNVERIATYIRQRALSNLQFIVISLKN 1195

Query: 1340 NMFELAQNLVGIYKN--NNMTKSTTL 1363
             MFE +Q LVG+++   +N +++ TL
Sbjct: 1196 TMFEKSQALVGVFRQQRDNTSRALTL 1221

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  247 bits (630), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 314/1312 (23%), Positives = 585/1312 (44%), Gaps = 171/1312 (13%)

Query: 128  LVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELI 187
            L L+NFKSY G+ ++G   ++F++++GPNGSGKSN++D++ FV G R+N +R   L +LI
Sbjct: 7    LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNVLKDLI 66

Query: 188  HKS----EQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVE--RRAFKNNSSKYYV 241
            ++              S         +  +   K     G  +VE  R   +N  + Y +
Sbjct: 67   YRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQKGNKLVELMRIISRNGDTSYKI 126

Query: 242  NGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIG 301
            +GK  +Y + +  L+ E I +  K FL+ QG+VE IA             L +  E++ G
Sbjct: 127  DGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAAQSPIE-------LSKMFEEVSG 179

Query: 302  TAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDK-ERKHTIL 360
            + ++K + ++  E+IE L +   E       +  E +  + G  +  E++ + ++K+ + 
Sbjct: 180  SIQYKKEYDELKEKIEKLGKSATESIKNRRRIHGELKTYKEGINKNEEYIKQVDKKNELQ 239

Query: 361  KAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTA 420
            + Q L  Q+Y   ++     DK+SA N E    K          E + +E+ + ++  ++
Sbjct: 240  RFQALW-QLYHLEQQKEELMDKLSASNSEVSSLK----------EKINNEMKSLQRSKSS 288

Query: 421  LETESKNVNSKKRSLEKDFIATD-EKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKK 479
               E   ++ +K  LE  +I  D EKL S  R +K  ++A  +  S+ +     IESL++
Sbjct: 289  FVKEGTIISKQKSKLE--YIVKDKEKLVSDLRLIKVPQQAAGKRISHIEK---RIESLQR 343

Query: 480  NHDDCEIELHNLNHSISI-------------------EKEKLNE--IKIH--LHEKTKDL 516
            +    E  +      + +                   EK KLNE  +K +  LHEK   L
Sbjct: 344  DLGRQEAYVERFETQLKVVTKSKKTFEEEIKESARNYEKFKLNENDLKTYDLLHEKY--L 401

Query: 517  SQEMESLERQLEPFRDQIQEKQSEIK-------LSETKITMLKSSHSNLLKEKATIESKI 569
            +Q    LE ++    +  QE   E+        +S+ +IT        LL     +++++
Sbjct: 402  TQGGSVLEEKISLSNNHKQEILDELDRFNKRADISKRRIT------EELLITGEKLDTQL 455

Query: 570  EDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNE----MRDVLIQQRQIV 625
             D                N+  K+++ I +A  +  +   +  E    + D+   QR+ +
Sbjct: 456  NDLRASLNEKNALHTERLNQLKKLQSDIESANNKEYDLNFKLRETLVKIDDLSANQRETM 515

Query: 626  EEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDL-GTIDDQYDIAISTACPR-LD 683
            +E K   N         +A+ K        G  G + DL     ++Y +A+ST   R  D
Sbjct: 516  KERKLREN---------IAMLK----RFFPGVKGLVHDLCHPKKEKYGLAVSTILGRNFD 562

Query: 684  DIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLITPVRDL 743
             ++VE +   Q+CI  L+K + G   FI LD + + +L  ++ P++   +  +     D 
Sbjct: 563  SVIVENLTVAQECIAFLKKQRAGTASFIPLDTI-ETDLPTLSLPDSQDYILSINAIDYDS 621

Query: 744  -FRPAFYSVLRDTLVARDLQQANRVAYGKR-RFRVVTLDGKLIDISGTMSGGGSSPQSGL 801
             +  A   V  D+++   L  A  + + K  R ++VT++G LI  +G M+GG S   +  
Sbjct: 622  EYEKAMQYVCGDSIICNTLNIAKDLKWKKSVRAKLVTIEGALIHKAGLMTGGISGDANNR 681

Query: 802  MRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQISK 861
               +        +D   K+ +Q+     + RS      E+E+++  L   +  +  Q+++
Sbjct: 682  WDKEEYQGLMSLKD---KLLIQIDELSNSQRSNSIRAREVENSVSLLNSDIASLRTQVTQ 738

Query: 862  IQLEKGSRVAEVESYHQ---------RLSQLARELSMNEKNQQPLLDEEKKL--DILRQH 910
             +        E++ YH          ++++L  +L   E  +  L  E++ L  DI ++ 
Sbjct: 739  QKRSLDENNLEIK-YHNDLIEKEIQPKITELEEKLKNLENTRNDLEKEKEALQNDIFKKF 797

Query: 911  LQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXXXX 970
                 D   FS  + ++    +M++   EL+    ++ ++E  ++   +           
Sbjct: 798  ----TDKIGFSIKEYENHSGELMRQQSRELQQLQKQILTVENKLQFEKDRLNTTQRRYEK 853

Query: 971  LDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQV------IENNERK 1024
               DL  A  E     E+       I  L  +LE  ++  E ++ +       + +NE  
Sbjct: 854  AQNDLKSAQIEMKSLEEQEEAAEMKIKSLESKLEENKIHLEGLQRKFTAKQSDLNSNEDV 913

Query: 1025 AE-LNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSL 1083
             E +NS+++ LK+E   I+ D+ +F          LE++               T+L++ 
Sbjct: 914  LEDMNSNLQILKRERDGIKEDTEKFD---------LERV---------------TALKNC 949

Query: 1084 KIRDVSKLLSQLNDGIIESCTDVTAKVMNGDIVQTQSITDVGNNDAMEDSGEAATHSGLP 1143
            KI       S +N  I+   T     + +GD   +++I+     D          + GLP
Sbjct: 950  KI-------SNINLPILSETTIDDLPIASGD---SEAISISNKIDV--------DYKGLP 991

Query: 1144 SXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAVAKR 1203
                                ++++ L+    +    E Y      ++    +  +  A+ 
Sbjct: 992  KKYKESNTDSAKKGLDEKIREVEEILNELQPNARAEERYDEAEERFEVINNETEELKAEE 1051

Query: 1204 EEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMIT---------MGGNAELELVDSLD 1254
            +++ ++    K +R E F + F  +S  L  +Y+ +T          GGNA L + D  +
Sbjct: 1052 KKILSQFLKIKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDEDE 1111

Query: 1255 PFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1314
            PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  
Sbjct: 1112 PFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDIT 1171

Query: 1315 NVSIVANYI-KERTKNAQFIVISLRNNMFELAQNLVGIYKNN--NMTKSTTL 1363
            NV  +A YI + R  + QFIVISL+N MFE +  LVG+Y+    N +K+ TL
Sbjct: 1172 NVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTITL 1223

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit of
            the multiprotein cohesin complex, essential protein
            involved in chromosome segregation and in double-strand
            DNA break repair; SMC chromosomal ATPase family member,
            binds DNA with a preference for DNA with secondary
            structure
          Length = 1225

 Score =  245 bits (625), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 322/1323 (24%), Positives = 594/1323 (44%), Gaps = 198/1323 (14%)

Query: 128  LVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELI 187
            L L+NFKSY G+ ++G   ++F++++GPNGSGKSN++D++ FV G R+N +R   L +LI
Sbjct: 7    LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 188  HK-------SEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVE--RRAFKNNSSK 238
            ++       S+ + +  + S      YV        K     G  +VE  R   +N  + 
Sbjct: 67   YRGVLNDENSDDYDNEGAASSNPQSAYV--------KAFYQKGNKLVELMRIISRNGDTS 118

Query: 239  YYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLED 298
            Y ++GK  +Y + +  L+ E I +  K FL+ QG+VE IA  ++  E      L    E+
Sbjct: 119  YKIDGKTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIA-AQSPVE------LSRMFEE 171

Query: 299  IIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESG---KEEALEFLDKER 355
            + G+ ++K + E+  E+IE L++   E       +  E +  + G    EE  + LDK  
Sbjct: 172  VSGSIQYKKEYEELKEKIEKLSKSATESIKNRRRIHGELKTYKEGINKNEEYRKQLDK-- 229

Query: 356  KHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQ------------------------ 391
            K+ + K Q L  Q+Y   ++     DK+SALN E                          
Sbjct: 230  KNELQKFQALW-QLYHLEQQKEELTDKLSALNSEISSLKGKINNEMKSLQRSKSSFVKES 288

Query: 392  ----EEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLK 447
                ++KS+ +++ K+ E L  ++   K    A      ++  +  SL+KD     ++ K
Sbjct: 289  AVISKQKSKLDYIFKDKEKLVSDLRLIKVPQQAAGKRISHIEKRIESLQKDL----QRQK 344

Query: 448  SIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKI 507
            +   + +   K  ++S+   +A   EI+   +N+D  ++  ++L     + ++ L E   
Sbjct: 345  TYVERFETQLKVVTRSK---EAFEEEIKQSARNYDKFKLNENDLKTYNCLHEKYLTEGGS 401

Query: 508  HLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIES 567
             L EK   L+ +   ++ +LE F      K+++I  S+ +IT       ++  EK  +++
Sbjct: 402  ILEEKIAVLNNDKREIQEELERFN-----KRADI--SKRRIT----EELSITGEK--LDT 448

Query: 568  KIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNE----MRDVLIQQRQ 623
            ++ D                +E  K+++ I +A  +  +   +  E    + D+   QR+
Sbjct: 449  QLNDLRVSLNEKNALHTERLHELKKLQSDIESANNQEYDLNFKLRETLVKIDDLSANQRE 508

Query: 624  IVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDL-GTIDDQYDIAISTACPR- 681
             ++E K   N         +A+ K        G  G + DL     ++Y +A+ST   + 
Sbjct: 509  TMKERKLREN---------IAMLK----RFFPGVKGLVHDLCHPKKEKYGLAVSTILGKN 555

Query: 682  LDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLITPVR 741
             D ++VE +   Q+CI  L+K + G   FI LD + +  L  ++ P++     D I  + 
Sbjct: 556  FDSVIVENLTVAQECIAFLKKQRAGTASFIPLDTI-ETELPTLSLPDSQ----DYILSIN 610

Query: 742  DL-----FRPAFYSVLRDTLVARDLQQANRVAYGKR-RFRVVTLDGKLIDISGTMSGGGS 795
             +     +  A   V  D+++   L  A  + + K  R ++VT++G LI  +G M+GG S
Sbjct: 611  AIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKGIRGKLVTIEGALIHKAGLMTGGIS 670

Query: 796  SPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEI 855
               +     +   +    +D   K+ +Q+       RS      E+E+++  L   +  +
Sbjct: 671  GDANNRWDKEEYQSLMSLKD---KLLIQIDELSNGQRSNSIRAREVENSVSLLNSDIANL 727

Query: 856  DIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDE-EKKLDIL------- 907
              Q+++ +        E++ YH  L          EK  QP + E +KKLD L       
Sbjct: 728  RTQVTQQKRSLDENRLEIK-YHNDLI---------EKEIQPKITELKKKLDDLENTKDNL 777

Query: 908  ---RQHLQQTI-----DASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHE 959
               ++ LQ  I         F+  + ++    +M++   EL+    ++ ++E  ++   +
Sbjct: 778  VKEKEALQNNIFKEFTSKIGFTIKEYENHSGELMRQQSKELQQLQKQILTVENKLQFETD 837

Query: 960  XXXXXXXXXXXLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIE 1019
                          DL  A  E     E+       I  +  +LE  +   + ++++ + 
Sbjct: 838  RLSTTQRRYEKAQKDLENAQVEMKSLEEQEYAIEMKIGSIESKLEEHKNHLDELQKKFVT 897

Query: 1020 NNERKAELNSSVEKLKQ-----ELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLR 1074
               +++ELNSS + L+      ++L  ERD                   G++E ++K   
Sbjct: 898  ---KQSELNSSEDILEDMNSNLQVLKRERD-------------------GIKEDIEKFDL 935

Query: 1075 SYETSLQSLKIRDVSKLLSQLN--DGIIESCTDVTAKVMNGDIVQTQSITDVGNNDAMED 1132
               T+L++ KI +++  +S     D +  S TD  A  ++  I       D+        
Sbjct: 936  ERVTALKNCKISNINIPISSETTIDDLPISSTDNEAITISNSI-------DIN------- 981

Query: 1133 SGEAATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRLAEYQRR 1192
                  + GLP                   H++++ L+    +   LE Y      ++  
Sbjct: 982  ------YKGLPKKYKENNTDSARKELEQKIHEVEEILNELQPNARALERYDEAEGRFEVI 1035

Query: 1193 KLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMIT---------MGG 1243
              +  Q  A+ +++ N+    K +R E F + F  +S  L  +Y+ +T          GG
Sbjct: 1036 NNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGG 1095

Query: 1244 NAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYV 1303
            NA L + D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V
Sbjct: 1096 NASLTIEDEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFV 1155

Query: 1304 MDEIDAALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQNLVGIYKNN--NMTKS 1360
            +DE+DAALD  NV  +A YI + R  + QFIVISL+N MFE +  LVG+Y+    N +K 
Sbjct: 1156 LDEVDAALDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKI 1215

Query: 1361 TTL 1363
             TL
Sbjct: 1216 ITL 1218

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  244 bits (622), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 324/1324 (24%), Positives = 578/1324 (43%), Gaps = 202/1324 (15%)

Query: 128  LVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELI 187
            L L+NFKSY G+ +IG   ++F++++GPNGSGKSN++D++ FV G R++ +R   L +LI
Sbjct: 7    LELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLI 66

Query: 188  HKS--------------EQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFK 233
            ++               EQ P+ A         YV      + K++    T+ +      
Sbjct: 67   YRGVIRDFSEEDPEDGEEQHPTSA---------YVKAFYEMDGKVVELMRTINI------ 111

Query: 234  NNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLL 293
            N  + Y ++ K  +Y +    L++E I +  K FL+ QG+VE IA   A         L 
Sbjct: 112  NGDTTYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIASQSAL-------DLS 164

Query: 294  EYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEK-ENRFEL----------VDKE---KQN 339
            +  E+I G+ ++K + +   +E+E L +   E   NR  +          + K+   K N
Sbjct: 165  KLFEEISGSIQYKKEYDSLKDELEKLGKSTTESIRNRRRIHGELKTYKEGISKDEEYKNN 224

Query: 340  LESGKEEALEF-------LDKER-------KHTILKAQLLQRQIYDSNRKLATSCDKISA 385
            +E  K+  + F       LD +R       K    +   L+ +I +  + L  S      
Sbjct: 225  VEKKKKYEMYFTLWKLFHLDAQRIQFKDKLKQAKTEMSKLKEKINNEEKHLTRSKSAFLK 284

Query: 386  LNMEFQEEKSQYEHLQKEAETLTHEINNTK----KESTALETESKNVNSKKRSLE--KDF 439
             N    +++SQ ++  KE E +  + N+ K      S  +    K + S KR +E  KD+
Sbjct: 285  ENSILTKKRSQLDYTVKEKEKVISQCNSIKIPLRASSKRIMNIEKRIESFKRDIERQKDY 344

Query: 440  IATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEK 499
            ++T E       +LK   KA    E        EI+   +NHD   +   +L        
Sbjct: 345  VSTFEN------QLKVVTKAKELFEV-------EIKKSARNHDKFRLTDTDLKWY----- 386

Query: 500  EKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLL 559
            E+LNE         K LS     LE+++    +  QEK  E++L         + H ++ 
Sbjct: 387  EQLNE---------KYLSTGGSLLEQKISLLNNDKQEKTDEMELL--------NRHIDVS 429

Query: 560  KEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEA----RISTAQKECEEAQKQTNEMR 615
            K + T E  I                  NEK+   A    ++   Q + E +  Q  ++ 
Sbjct: 430  KNRVTEELNITGENLQNQVTDMTSTL--NEKNATYAEQMKKLKDYQMQVESSNNQEYDLN 487

Query: 616  DVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTID-DQYDIA 674
              L +    +++  AN      + ++   +T L+      G  G + DL     ++Y +A
Sbjct: 488  YKLRETLVKLDDLSANQRESLKEKKLRENVTMLKRF--FPGVKGLVHDLCRPKKEKYGLA 545

Query: 675  ISTACPR-LDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRL 733
            +S    +  D I+VE +   ++CI  L+K + G   FI LD +       ++ P +   +
Sbjct: 546  VSVMLGKNFDSIIVENLSVARECISFLKKQRAGTASFIPLDTI-DSEQPTLSAPPSQEYI 604

Query: 734  FDLITPVRDLF--RPAFY----SVLRDTL-VARDLQQANRVAYGKRRFRVVTLDGKLIDI 786
              +     DL   R   Y    S++ DTL +ARDL+    V     R ++V+LDG LI  
Sbjct: 605  LTINAIEYDLAYERAMQYVCGDSIICDTLDIARDLKWNRGV-----RSKLVSLDGSLIHK 659

Query: 787  SGTMSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQ 846
            +G M+GG S         +   +    +D   K+ +Q+    T  R A +   E+ES+L 
Sbjct: 660  AGLMTGGISKDSKNRWDKEEYQSLMTLKD---KLLIQIEEVSTVGRDAAAKARELESSLS 716

Query: 847  KLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRL--SQLARELSMNEKNQQPLLDEEKKL 904
             L   L  +  Q+ +++        E+ +YH +L   Q   +L   ++  Q + +    +
Sbjct: 717  LLNAELSSLRTQLVQVKRSVEENANEI-NYHNKLLTEQYTPKLESLQEEIQAIENSISSI 775

Query: 905  DILRQHLQQTI-----DASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHIEILHE 959
               +  LQ+TI     D   FS    +     +M++   EL+    ++ +++  ++   E
Sbjct: 776  TAEKVSLQETIFKELTDKVGFSIQDYERYSGDLMREQSKELQQLQKQILNIKNKLQFESE 835

Query: 960  XXXXXXXXXXXLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIEEQVIE 1019
                             R    + KY   +           E LES +   + +EE+  E
Sbjct: 836  -----------------RLKTTEGKYHASL-----------ESLESAKSNLQSLEEEENE 867

Query: 1020 NNERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETS 1079
              +++ ++   + + + EL  ++R    + A++L++++           +   L  Y   
Sbjct: 868  CQQKRKQIEQHISEDEAELNRLQR---VYDARQLDFNN-----------LDDVLAEYNNE 913

Query: 1080 LQSLK-----IRDVSKLLSQLNDGIIESC--TDVTAKVMNGDIVQTQSITDVGNNDAMED 1132
            LQSLK     IR+  + +     G++++C  T++   ++  DI  +    D  + D +  
Sbjct: 914  LQSLKHNRNQIREDMEKIDLERVGVLKNCKITNMEIPIL-SDINLSNLPIDKIDEDTIAI 972

Query: 1133 SGEA-ATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRLAEYQR 1191
            S E    ++ LP+                    ++D L+    +   +E +      ++ 
Sbjct: 973  SNEIDVDYNDLPAKYKESSATTIREELENHIRSIEDTLNVLQPNARAVERFDDAQERFEV 1032

Query: 1192 RKLDLNQAVAKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITM---------G 1242
             + +     A+ ++   +    K  R E F   F  ++  L  +Y+ +T          G
Sbjct: 1033 VEKETEDLKAREKKALTQFLKIKKRRRELFENAFDFVNEHLDPIYRELTRNPNSSALLSG 1092

Query: 1243 GNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1302
            GNA L L D  +PF+ G+ +  MPP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +
Sbjct: 1093 GNASLTLEDEDEPFNAGIKYHAMPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFF 1152

Query: 1303 VMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQNLVGIYKNN--NMTK 1359
            V+DE+DAALD  NV  +A YI+     + QFIVISL+N MFE +  LVG+Y+    N +K
Sbjct: 1153 VLDEVDAALDITNVERIAAYIRRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSK 1212

Query: 1360 STTL 1363
              TL
Sbjct: 1213 IVTL 1216

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  232 bits (592), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 326/1341 (24%), Positives = 595/1341 (44%), Gaps = 207/1341 (15%)

Query: 128  LVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELI 187
            L L+NFKSY    ++G   + F++++GPNGSGKSN++D++ FV G R+N++R   L +LI
Sbjct: 7    LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 188  HK----------------------SEQFPSLASCS------VQIHFHYVHDTDNGETKIL 219
            ++                      SE  P  A+ S        +   Y  D  +  TK  
Sbjct: 67   YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDDLDEPTKFT 126

Query: 220  PSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQ 279
             +  T         +  S Y +N +  +Y +    L+ E I +  K FL+ QG+VE IA 
Sbjct: 127  RTINT---------SGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIAS 177

Query: 280  MKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQN 339
               ++       L   LE + G+  +K   EK  EE +       +  N  + V  + ++
Sbjct: 178  QGPES-------LTLLLEQVSGSINYKNDYEKLKEEHKLALAEFTDAHNSRKKVQNDLKS 230

Query: 340  LESGKEE------ALEFLDKERKHTILKAQLL-----QRQIYDSNRKLATSCDKISALNM 388
             + G +       +LE  D + KH  +  +L      ++++ DS   L  S  + +AL  
Sbjct: 231  FKEGVQRDEQYRTSLEIRD-QLKHNFILWELFHILKRRKKLVDS---LTVSKTETTALKN 286

Query: 389  EFQEEKSQYEHLQKEAETLTHEINNTKKEST--ALETESKNVNSKKRSLEKDFIATDEKL 446
            +  +E+     ++  + T  HE+  +K + T   LE E  ++ S    +  + +AT +++
Sbjct: 287  KLSDEERILTKIK--STTAKHELQLSKLKDTLVQLENEKTSLQSSLLPVGSERLATIKRI 344

Query: 447  KSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIK 506
             ++ +++ + +K   + ++  K   N+++ + K     E EL N++ +++  K  L+E  
Sbjct: 345  HNLEKRISSFKKDMERQQAYVKQFENQLKVVSKTKKSFEKELENIHANLN--KFNLSEED 402

Query: 507  IHLHE--KTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKAT 564
            +  +E  K K LS     +E +L   ++   E   E +L   +   LK++   +  E   
Sbjct: 403  LKQYELLKEKYLSSGGSHIEEKLAILKNDEFELNEESELINKR---LKTTRERISDELQV 459

Query: 565  IESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTN-EMRDVLIQ--- 620
                +E                   KSK    I T  +  +  + + N  +RDVL++   
Sbjct: 460  DVDALEADLNEVTQRLNDKNSIAAAKSKEWKGIQTNLESLKNKEYELNFSLRDVLLKIDD 519

Query: 621  ----QRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLG-TIDDQYDIAI 675
                QR+  +E K   N        +  L +L       G  G + DL     ++Y IA+
Sbjct: 520  LNADQRETKKERKLREN--------VSMLKRL-----YPGVKGLVHDLCHPKKEKYAIAV 566

Query: 676  STACPR-LDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATP-ENVPRL 733
            ST   +  D I+V+++    +CI +L+K + G   FI LD +   +++  + P  NV   
Sbjct: 567  STILGKNFDSIIVDSIATAHECITYLKKQRAGSASFIPLDTI---DVNPPSLPVSNVQGC 623

Query: 734  FDLITPVR--DLFRPAFYSVLRDTLVARDLQQANRVAYGKR-RFRVVTLDGKLIDISGTM 790
               I  +        A   V  D+++  +L  A  + + +  + ++VTL+G LI  +G M
Sbjct: 624  LLTINAIEYEGYLEKAMQYVCSDSIICDNLDLAKELKWSRNVKAKLVTLNGALIHKAGQM 683

Query: 791  SGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTD 850
            +GG +                  +D++ +    LS K   +R+      E+E+ +  L +
Sbjct: 684  TGGTAQKNQNRWNKDEYQGLMVLKDQITEELTALSDK---FRADNMKSRELENEISLLNN 740

Query: 851  RLPEIDIQISKIQLEKGSRVAEVE---------------SYHQRLSQLARELSMNEKNQQ 895
             +  +  QI++++     +  E++               S+ QR+ +L  +L+       
Sbjct: 741  EISSLRTQITQLERTLSGKNVEIKHNEDLITTEYEPQLKSFTQRIEELKSKLTK------ 794

Query: 896  PLLDEEKKLDILRQHLQQTI-DASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLEQHI 954
              L+ EK  D+L++ + +   D   FS    +     IM+K   EL+    ++ ++E  +
Sbjct: 795  --LESEK--DVLQEQIFRPFTDKYGFSIKDYEQGTGEIMRKHSKELQQFQKQILTIENKL 850

Query: 955  EILHEXXXXXXXXXXXLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIRLEKERIE 1014
            E               L    AR T+              D+  L E L S+  +++ I 
Sbjct: 851  EF----------EKDRLGATAARHTK-----------ALSDMDKLKEALGSLEKQEDIIT 889

Query: 1015 EQVIENNERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLR 1074
            E++     + A+   S E   Q+L++I++       KEL+     EK+H L  +    + 
Sbjct: 890  EKI-----KNADSKISQE---QQLVAIQQ-------KELD-----EKVHNLISF-DSNIA 928

Query: 1075 SYETSLQSLKIR------DVSKL-LSQLNDGIIESCTDVTAKVMNGDIVQTQSITDVGNN 1127
              ++S+Q+ + +      D+  L L QL  GI+++C     KV N ++    S  +  + 
Sbjct: 929  EIQSSMQAARRKVDEIKEDIETLDLEQL--GILKNC-----KVSNIELPLLDSSLEDISI 981

Query: 1128 DAMEDSGEAATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRLA 1187
            D + DS      S L                     + +  +      +E+L+  ++ + 
Sbjct: 982  DVL-DSNNTGIISDLEYDFTSLPEKYRLNDGEEVKEEFESEIKKVEEKLEILQPNSKAVQ 1040

Query: 1188 EYQRRKLDLNQAVAKREEVRNK----CESF---KNERLEKFMEGFGIISMTLKEMYQMIT 1240
             Y   K  L+Q   + E +RNK     E F   K +R E F   F  +   + ++Y+ +T
Sbjct: 1041 RYDETKHKLDQVSNENERLRNKERKAKEKFLEVKAKRKELFEACFKHVDKHIDQIYRALT 1100

Query: 1241 ---------MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVF 1291
                      GGNA L + +  +P+  G+ +   PP K ++++  LSGGEKT+++LAL+F
Sbjct: 1101 KNPHDKSELAGGNASLTVENEDEPYLGGIKYFATPPLKRFKDMEYLSGGEKTMAALALLF 1160

Query: 1292 ALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK-NAQFIVISLRNNMFELAQNLVG 1350
             ++ Y+P+P +V+DE+DAALD  NV  +A+YIK     NAQFIVISL+N MFE +Q+LVG
Sbjct: 1161 TINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNAQFIVISLKNAMFEKSQSLVG 1220

Query: 1351 IYK----NNNMTKSTTLQNID 1367
            I++    N++   S  L+N D
Sbjct: 1221 IFREQEDNSSRMVSLNLENYD 1241

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  173 bits (438), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 205/771 (26%), Positives = 364/771 (47%), Gaps = 144/771 (18%)

Query: 656  GFHGRLGDLG-TIDDQYDIAISTACPR-LDDIVVETVECGQQCIDHLRKNKLGYGRFILL 713
            G  G + DL     +++ +A+ST   +  D ++V+     QQC+  L+K + G   FI L
Sbjct: 529  GVRGLVHDLCHPKKEKFAVAVSTVLGKNFDAVIVDNFLVAQQCVSFLKKQRSGVVSFIPL 588

Query: 714  DKLRKCNLDRIATP-ENVPRLFDLITPVRDLFRPAFY----SVLRDTL-VARDLQQANRV 767
            D +    +  IA+  +      D I    DL R   Y    S++ DTL +A+DL+  + +
Sbjct: 589  DTVDVSKVPMIASEFKGCILAIDAIDYEPDLERAMQYVCSDSIICDTLQIAKDLKWKHNI 648

Query: 768  AYGKRRFRVVTLDGKLIDISGTMSGGGSSPQS---------GLMR---------SKATTA 809
                 R ++V+++G ++  +G M+GG S   +          LM          S+ + A
Sbjct: 649  -----RSKLVSINGSIVHRAGLMTGGASKGGNNRWDKEEYQSLMSLKDVFLKELSELSAA 703

Query: 810  SQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSR 869
            S    + +  +E  LS   T+    +S+  ++  + + L ++  EI  QI    L +G  
Sbjct: 704  SISDAERIRILENDLSILNTDL---MSLKTQLAQSKRMLKEKETEIQYQID---LAEG-- 755

Query: 870  VAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLK 929
              E+E    R+  L  +L    +  Q + D EK+    +  LQ ++ A  F         
Sbjct: 756  --EIEP---RIKTLKDDL---HRYNQEIADLEKQ----KAKLQNSVYADVF--------- 794

Query: 930  DRIMQKGGIELKMQIAKVASLEQHIEILHEXXXXXXXXXXXLDIDLAR--ATREKNKYSE 987
             R +    +E +M    +  L++  E L +           L+ ++ R  AT+E+ + ++
Sbjct: 795  -RDVGFTAVEYEMHSGII--LKKQAEDLRKLQMQMVSIDKKLEFEVERLHATQERQQKAQ 851

Query: 988  EVLVCNK-DISILSEQLESIRLEKERIEEQVIENNERK------------AELNSSVEKL 1034
              L   K  +  L+   ESI L+ E +EE++I+  +++            A LN+  E++
Sbjct: 852  VDLEKAKIKLEALNNDEESINLKIE-MEERIIDEEQKQLDSLQDEASQNLAGLNALDEQI 910

Query: 1035 KQEL---LSIERDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKL 1091
             QE+   LS  +  NE  +++LE ++ LE+L+ L+             +Q++K+ + S  
Sbjct: 911  -QEINDDLSASKRKNEALSEDLE-TNTLERLNVLKN----------CKMQNIKLPEGS-- 956

Query: 1092 LSQLNDGIIESCTDVTAKVMNGDIVQTQSITDVGNNDAMEDSGEAATHSGLPSXXXXXXX 1151
             S L++  ++   + T    N D+    SI   G +  +  SGE  T +GL         
Sbjct: 957  -SSLDELPLDKVDEFTLNAAN-DV----SINYAGLSKKLRQSGEEETGAGLKKS------ 1004

Query: 1152 XXXXXXXXXXXHQLQDYLDNFNGDIEVLEEYARRLAEYQRRKL-------DLNQAVAKRE 1204
                             +D  N  + +L+  ++    Y+  KL       +  +  AK +
Sbjct: 1005 -----------------IDELNELLTILQPNSKAAGRYEDAKLRYESIYKETEKCKAKEK 1047

Query: 1205 EVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDP 1255
            +V       K  R E F + F  +S ++ E+Y+ +T          GGNA L L D  +P
Sbjct: 1048 KVNEDFTRIKRLRKEAFEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLEDEDEP 1107

Query: 1256 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1315
            +  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  N
Sbjct: 1108 YLAGIRYHATPPAKRFKDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDISN 1167

Query: 1316 VSIVANYIKERT-KNAQFIVISLRNNMFELAQNLVGIYK--NNNMTKSTTL 1363
            V  VA+YI+ +   + QFIVISL+N MFE +Q LVG+++   NN +K+ TL
Sbjct: 1168 VERVASYIRRKAGADLQFIVISLKNTMFEKSQALVGVFRQQQNNTSKALTL 1218

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  162 bits (409), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 188/748 (25%), Positives = 338/748 (45%), Gaps = 97/748 (12%)

Query: 656  GFHGRLGDLGTID-DQYDIAISTACPR-LDDIVVETVECGQQCIDHLRKNKLGYGRFILL 713
            G  G + DL     ++Y +A+ST   R  D I+V+ +   Q+CI +L+K + G   FI L
Sbjct: 525  GIRGLVSDLCQPKKERYALAVSTILGRNFDSIIVDNLAVAQECIAYLKKQRAGIASFIPL 584

Query: 714  DKLRKCNLDRIATPENVPRLFDLITPVRDL-FRPAFYSVLRDTLVARDLQQANRVAYGKR 772
            D + +     +   E+   +  +     D  +  A   V  D+++   L+ A  + + + 
Sbjct: 585  DTI-EVETSTLPASESSGCILAINAIEYDPEYERAMRYVCSDSIICNTLEIARDMKWKRN 643

Query: 773  -RFRVVTLDGKLIDISGTMSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNY 831
             R ++VTL+G LI  +G M+GG S   S     +   +    +D   K+ VQ+    ++ 
Sbjct: 644  VRSKLVTLEGTLIHRAGLMTGGISKDSSNRWDKEEYQSLMTLKD---KILVQIEEVGSHS 700

Query: 832  RSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQ---------RLSQ 882
            R+      E+E  +  +      I  QIS+++        ++E YHQ         ++ +
Sbjct: 701  RACSIRARELEGNISLIYSEASSIRTQISQLKRALEDTNTDIE-YHQNLIKQEYDPKIQE 759

Query: 883  LARELSMNEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKM 942
            L ++L++   +++ L  EE+K  +  Q  ++  D   FS  + +       ++   EL+ 
Sbjct: 760  LEQKLAIINDSRKQL--EEEKDSLQTQTFKEFTDKLGFSMKEYETHSGDAKRQQSKELQQ 817

Query: 943  QIAKVASLEQHIEILHEXXXXXXXXXXXLDIDLARATREKNKYSEEVLVCNKDISILSEQ 1002
               ++ ++E  +E   E            + D+ +   E              +  L +Q
Sbjct: 818  LQKQILNVENKLEFEKERLTSTSNRLEKTETDMKKVFIE--------------LQSLQKQ 863

Query: 1003 LESIRLEKERIEEQVIENNERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKL 1062
             E + ++ +++E+ +    + K +L    E+LK             K + +  +D     
Sbjct: 864  EEDVGVQTKKVEKAI---KDHKIKLKKVEEELKN------------KQRTMNLND----- 903

Query: 1063 HGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQLNDGIIES-CTDVTAKVMNGDI-----V 1116
                    +QL  Y +SLQSLK R+  ++   +  G +E  C     K+ N  I     V
Sbjct: 904  --------EQLIEYNSSLQSLK-RERDEVKDVIEKGDLERICVLKNCKISNMQIPIVSDV 954

Query: 1117 QTQSI-TDVGNNDAMEDSGEAAT-HSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFNG 1174
              QS+  D  + +A+  S E    +  LP+                   Q+ + L+    
Sbjct: 955  DLQSLPIDRIDAEAIRTSNEIEIDYDALPAKYKENGGEAVEKGFERELKQVDEILN---- 1010

Query: 1175 DIEVLEEYAR---RLAEYQRRKLDLNQAVA--KREEVRNKCESFKNERLEK--FMEGFGI 1227
               VL+  A+   R  E Q++   +N      K++E +   +  K +R  K  F E F  
Sbjct: 1011 ---VLQPNAKATDRFNEAQQKFGSINDETEQLKKDEKKVLAQFIKIKRKRKSLFEEAFEY 1067

Query: 1228 ISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLS 1278
            ++  +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP K ++++  LS
Sbjct: 1068 VTEHIDPIYRELTKNPNSTSELAGGSASLTLEDEDEPFNAGIRYHATPPLKRFKDMEYLS 1127

Query: 1279 GGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISL 1337
            GGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  VA YI+     + QFIVISL
Sbjct: 1128 GGEKTVAALALLFTVNSYQPSPFFVLDEVDAALDTTNVERVATYIRRHGNPDLQFIVISL 1187

Query: 1338 RNNMFELAQNLVGIYKNN--NMTKSTTL 1363
            +N MFE +  LVG+Y+    N +K  TL
Sbjct: 1188 KNTMFEKSDALVGVYRQQELNTSKIVTL 1215

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 102/200 (51%), Gaps = 13/200 (6%)

Query: 128 LVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELI 187
           L L+NFKSY G  ++G   ++F++++GPNGSGKSN++D++ FV G R+  +R   L +LI
Sbjct: 7   LELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLRSNVLKDLI 66

Query: 188 HKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVE--RRAFKNNSSKYYVNGKE 245
           ++             +    V++      K   S G   +E  R   K   + Y +NGK 
Sbjct: 67  YRGVASEEEGDGESDV----VNNPTTAYVKAFYSKGDSTIELSRSISKGGDTTYRMNGKV 122

Query: 246 SNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKF 305
            +Y      L++E I +  K FL+ QG+V  IA   A         L ++ E+  G+ ++
Sbjct: 123 VDYKRYASFLEDENILIRAKNFLVFQGDVVQIASQSAME-------LTQFFEEFSGSIQY 175

Query: 306 KPQIEKCLEEIETLNEVCME 325
           K + +   E+++TL +   E
Sbjct: 176 KKEYDMLKEKLQTLGQSTAE 195

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  161 bits (407), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 191/748 (25%), Positives = 339/748 (45%), Gaps = 118/748 (15%)

Query: 656  GFHGRLGDLG-TIDDQYDIAISTACPR-LDDIVVETVECGQQCIDHLRKNKLGYGRFILL 713
            G  G + DL     D+Y ++++T   +  D ++V+++   Q+CI +L+K + G   FI L
Sbjct: 528  GVKGIVSDLCHPKKDKYSVSVATVLGKNFDSVIVDSLSVAQECIAYLKKQRAGVISFIPL 587

Query: 714  DKLRKCNLDRIATPENVPRLFDLITP----VRDLFRPAFYSVLRDTLVARDLQQANRVAY 769
            D +       +AT  +V     L+          +  A   V  D ++   L  A ++ +
Sbjct: 588  DTVDSA----VATLPSVNIQGYLLAKNAMEYESQYERAINYVCGDAIICDTLDLAKKLKW 643

Query: 770  GKR-RFRVVTLDGKLIDISGTMSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKE 828
                + +++ LDG LI  +G M+GG S   +     +   +    +D++ +   Q+    
Sbjct: 644  DHGFKNKLIALDGSLIHRAGLMTGGISKDGNNRWDKEEYQSLMTLKDKILQ---QIEDTA 700

Query: 829  TNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELS 888
               RSA     E+ES +  L   +  I  Q++  Q+ +     +VE  HQ        + 
Sbjct: 701  AYGRSASIQARELESNISLLNAEIASIRTQLT--QINRSIEENKVEINHQ--------IH 750

Query: 889  MNEKNQQPLLD--EEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAK 946
            + +K   P++   ++KK  IL+Q  + T +  +          D++    G         
Sbjct: 751  LVDKEYSPMILSLKKKKESILKQSNELTEEKDRVQVVIFKAFTDKV----GF-------S 799

Query: 947  VASLEQHI-EILHEXXXXXXXXXXXLDIDLARATREKNKYSEEVLVCNKDISILSEQLES 1005
            V   E H  E++ +                    +E  +  +E+L     +    E+LES
Sbjct: 800  VRDYESHSGEVMRQN------------------AKELQQLQKEILTVENKLQFERERLES 841

Query: 1006 IRLEKERIEEQV-------IENNERKAELNSSVEKLKQELLS----IERDSNEFKAKELE 1054
             R    + EE +           E++ + ++ ++ L++++ S    IE    E + K+LE
Sbjct: 842  TRGRLLKAEEDIKKAQLELSLLEEQEKKYHTQIKPLEEDICSFEKQIEEKETEIEGKKLE 901

Query: 1055 YSDRLEKLHGLQ---EYVKKQLRSYETSLQSLKIRDVSKLLSQLNDGIIESCTDVTAKVM 1111
             +++ E L+ +Q   E VK+Q     T +++L +  +         GI+ +C     K+ 
Sbjct: 902  INNKEESLNEVQSSVEAVKRQHDEISTDIENLDLERI---------GILRNC-----KIS 947

Query: 1112 NGD--IVQTQSITDVG-----NNDAMEDSGEA-ATHSGLPSXXXXXXXXXXXXXXXXXXH 1163
            N D  I+   ++ DV        DA++ S E    +  LP+                   
Sbjct: 948  NRDLPILSETNLADVPITSNEQGDAIKMSNEIDIDYEELPTKYKESSSKQLE-------K 1000

Query: 1164 QLQDYLDNFNGDIEVLEEYAR---RLAEYQRR--KLDLNQAVAKREEVRNKCESF---KN 1215
            +L   ++  N  +E+L+  AR   R  E Q R   +D N+    + E R     F   K 
Sbjct: 1001 ELTRSIEEVNEMLEILQPNARAVGRFDEAQERFNAID-NETERLKSEERKIYAQFLKTKK 1059

Query: 1216 ERLEKFMEGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFSVMP 1266
            +R E F   F  +S  +  +Y+ +T          GG+A L L D  +PF+ G+ +   P
Sbjct: 1060 KRKELFDRAFDYVSTHIDGIYRELTKDPNSTAELAGGSASLTLEDEDEPFNAGIKYHATP 1119

Query: 1267 PKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KE 1325
            P K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD +NV  +A YI K 
Sbjct: 1120 PLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDIKNVERIAAYIRKH 1179

Query: 1326 RTKNAQFIVISLRNNMFELAQNLVGIYK 1353
               + QFIVISL+N+MFE +  LVG+Y+
Sbjct: 1180 GNPSLQFIVISLKNSMFEKSDALVGVYR 1207

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 107/203 (52%), Gaps = 17/203 (8%)

Query: 128 LVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELI 187
           L L NFKSY G+ ++G   ++F++++GPNGSGKSN++D++ FV G R++ +R   +++LI
Sbjct: 7   LELYNFKSYRGVVKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSYLRSSAVADLI 66

Query: 188 HKS----EQFPSLASCSVQIHFHYVHD-TDNGETKILPSAGTMVVERRAFKNNSSKYYVN 242
           ++     E+           H  YV      G     P   T+ ++R   KN  S Y ++
Sbjct: 67  YRGVVPEEEDDGEGEGDGDAHRAYVSAFYSKG-----PQESTVELKRTISKNGDSTYQID 121

Query: 243 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGT 302
            ++  Y + +  L+ + I +  K FL+ QG+VE +A             L +  E++ G+
Sbjct: 122 RRQVTYKQYSEFLESQNILIKAKNFLVFQGDVEQVASQSPLQ-------LTKLFEEVSGS 174

Query: 303 AKFKPQIEKCLEEIETLNEVCME 325
           A++K + +   +++E L+    E
Sbjct: 175 AQYKKEYDLLKDQLEQLSHSATE 197

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  157 bits (398), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 200/777 (25%), Positives = 359/777 (46%), Gaps = 142/777 (18%)

Query: 656  GFHGRLGDLG-TIDDQYDIAISTACPR-LDDIVVETVECGQQCIDHLRKNKLGYGRFILL 713
            G  G + DL     D+Y +AI T   +  + ++V+++   Q+CI +L+K + G   FI L
Sbjct: 522  GVRGLVHDLCHPKKDKYALAILTILGKNFNSVIVDSLSVAQECISYLKKQRAGIISFIPL 581

Query: 714  DKLRKCNLDRIATPENVPRLFD----LITPVRDLFRPAF---------YSVLRDTL-VAR 759
            D +           +N P+  +    ++T     + P F          S++ D L +A+
Sbjct: 582  DTIEAQIPSLPTIIQNNPKYNNDSNCILTINAIEYEPEFERAMQYICSNSIICDNLDIAK 641

Query: 760  DLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGS--SPQSGLMRSKATTASQYSRDEV 817
            DL+    V    +  + VTLDG +I  S  M+GG S  S QS     K   +S  +  + 
Sbjct: 642  DLKWNQNV----KNVKFVTLDGSIIHKSNLMTGGASKNSMQSNNRWDKDEYSSLMTLKDN 697

Query: 818  EKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVES-Y 876
              +E++  +KE    S  S   E+E+ +  L   +  +  Q++  QL +  +    E  Y
Sbjct: 698  LILEIETISKENKLASINS--RELETEISLLNSEITNLKTQLT--QLTRNLKDNNTELLY 753

Query: 877  HQRLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKG 936
            HQ L +L  +  + + N + ++D + K+ I+    +++++   F        KD      
Sbjct: 754  HQNLIKLDYDPKLKDLNHK-IIDIDSKMKIIEDE-RESLENETF--------KD------ 797

Query: 937  GIELKMQIAKVASLEQHIEILHEXXXXXXXXXXXLDIDLARATREKNKYSEEVLVCNKDI 996
              ELK+  +     +  + I+ E                   +++  K ++++L     +
Sbjct: 798  -FELKIGFSIKDYKKYSVNIITEQ------------------SKDLQKLAKDILNIENKL 838

Query: 997  SILSEQLESIRLEKERIEEQVIENN-------ERKAELNSS-------VEKLKQELLSIE 1042
                E+LES +L KE+    + + N       E++ +LN         +EK K EL  IE
Sbjct: 839  QFEKERLESTQLRKEKTLANIEKYNQELNDLTEQENQLNIQKENDSKLIEKEKTELKEIE 898

Query: 1043 RDSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKL-LSQLNDGIIE 1101
            ++    + K++E +++ E +   Q     +L S +  + +L   ++SK+ L ++  GI++
Sbjct: 899  KN---IQNKKIEINEKEEVIKQNQN----ELNSIQKKIDALN-ENISKIDLERI--GILK 948

Query: 1102 SCTDVTAKVMNGDIVQTQSIT------DVGNNDAMEDSGEAATHSGLPSXXXXXXXXXXX 1155
            +C     K+ N +I  T ++       D  ++DA+  S +        S           
Sbjct: 949  NC-----KISNIEIPITSAVNLNNLPIDKIDDDAILISNDIKVSFNELSKKYKKK----- 998

Query: 1156 XXXXXXXHQLQDY---LDNFNGDIEVLEEYARRLAEYQRRKLDLNQAVAKREEVRNKCES 1212
                      QDY   L++ + +I+  E+    L    +    L++A  K E + N+ E+
Sbjct: 999  ----------QDYEKNLEDISNEIKETEDILLELQPNAKAHDRLDEAKDKFEVIDNETET 1048

Query: 1213 FKNE--------------RLEKFMEGFGIISMTLKEMYQMITM---------GGNAELEL 1249
             K E              R E F   F  ++  ++ +Y+ +T          GG A L L
Sbjct: 1049 LKTEEKEILTKFLNIKKKRKELFESCFDFVNEHIEPIYKELTKDPNSTTELGGGQATLTL 1108

Query: 1250 VDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1309
             D  +PF+ GV +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DA
Sbjct: 1109 EDEDEPFNGGVKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDA 1168

Query: 1310 ALDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAQNLVGIYK--NNNMTKSTTL 1363
            ALD  NV  +A YI K   K+ QFI+ISL+N MFE +  LVG+++    N +K+ TL
Sbjct: 1169 ALDHTNVERIAAYIRKHGNKDLQFIIISLKNTMFEKSDALVGVFRQQTENSSKALTL 1225

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  137 bits (344), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 112/175 (64%), Gaps = 12/175 (6%)

Query: 1201 AKREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMIT---------MGGNAELELVD 1251
            AK +++R +    K  R E F + +  +S  + ++Y+ +T          GG+A L L D
Sbjct: 1047 AKEKKIREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLED 1106

Query: 1252 SLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1311
              +P+  G+ +   PP K ++++ +LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAAL
Sbjct: 1107 EDEPYLAGIKYHATPPMKRFKDMEHLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAAL 1166

Query: 1312 DFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAQNLVGIYKNN--NMTKSTTL 1363
            D  NV  +A YIK   + N QFIVISL+N+MFE +Q LVG+++    N +K  TL
Sbjct: 1167 DNTNVEKIATYIKRHASPNFQFIVISLKNSMFEKSQALVGVFRQQQENTSKVITL 1221

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  134 bits (338), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 107/164 (65%), Gaps = 12/164 (7%)

Query: 1212 SFKNERLEKFMEGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLF 1262
            + K +R E F + F  +S  ++ +Y+ +T          GGNA L L D  +PF  G+ +
Sbjct: 1049 AIKKKRREVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTLEDEDEPFDAGIKY 1108

Query: 1263 SVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1322
               PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N+  +ANY
Sbjct: 1109 HATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDAALDVTNIERIANY 1168

Query: 1323 IKERTK-NAQFIVISLRNNMFELAQNLVGIYKNN--NMTKSTTL 1363
            I++ +  + QFIVISL+N+MFE +  LVGI++    N ++  TL
Sbjct: 1169 IRKHSNSDIQFIVISLKNSMFEKSDALVGIHRQQQENSSRVVTL 1212

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  134 bits (336), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 102/163 (62%), Gaps = 12/163 (7%)

Query: 1213 FKNERLEKFMEGFGIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVLFS 1263
             K  R E F + F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ + 
Sbjct: 1054 IKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRYH 1113

Query: 1264 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1323
              PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A YI
Sbjct: 1114 ATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAYI 1173

Query: 1324 KER-TKNAQFIVISLRNNMFELAQNLVGIYKNN--NMTKSTTL 1363
            +     N QFIVISL+N MFE +  LVG+Y+    N +K  TL
Sbjct: 1174 RRHGNPNLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1216

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score =  126 bits (317), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 60/169 (35%), Positives = 104/169 (61%), Gaps = 10/169 (5%)

Query: 1205 EVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDP 1255
            E + K    K +R++ F+  F  ++  +  +Y+ +T          GG+A L L D  +P
Sbjct: 1043 ESKEKYLKIKEKRVKTFLSCFQHVTDHIDRIYRELTRNPGSTAELAGGSASLTLEDEDEP 1102

Query: 1256 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1315
            +  G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N
Sbjct: 1103 YLAGIRYHATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTN 1162

Query: 1316 VSIVANYIKER-TKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTL 1363
            V  +A YIK   +   QFIVISL++N+F  +Q++ G+++N     S  +
Sbjct: 1163 VERIAAYIKRHASPKFQFIVISLKSNLFGKSQSMAGVFRNQQANSSMVI 1211

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] {ON}
            similar to uniprot|P38989 Saccharomyces cerevisiae
            YFR031C SMC2 Component of the condensin complex essential
            SMC chromosomal ATPase family member that forms a complex
            with Smc4p to form the active ATPase Smc2p/Smc4p complex
            binds DNA possibly in the cleft formed by the coiled-coil
            of the folded dimer
          Length = 1170

 Score =  125 bits (313), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 258/1038 (24%), Positives = 437/1038 (42%), Gaps = 204/1038 (19%)

Query: 125  IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRAN-KMRQGKL 183
            +++L+++ FKSYA    I  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3    VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 184  SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKI-LPSAGTMVVERRAFKNNSSKYYVN 242
             +LI+K  Q   +   SV I F    +TD   + I   S   + V R+     +SKY +N
Sbjct: 63   QDLIYKRGQ-AGVTKASVTIVFD---NTDKSSSPIGFESYPKISVTRQIILGGTSKYLIN 118

Query: 243  GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGT 302
            G  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119  GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 303  AKFKPQIEKC----------LEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEF-- 350
              F+ + EK           L+EI TL E         E ++ + + L + K   LEF  
Sbjct: 172  RMFEDRREKAEKTMAKKETKLQEIRTLLE---------EEIEPKLEKLRNQKRAFLEFQE 222

Query: 351  --LDKERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLT 408
               D E+   IL A     + YD    +AT    I          K   ++     E L 
Sbjct: 223  TQTDLEKTLRILNA----YEYYD----MATKNSTI----------KETLQNSTARVEELN 264

Query: 409  HEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGK 468
            + I  TK E + L                     DE LK+I  K++  E    Q + +GK
Sbjct: 265  NFIQKTKNEISNL---------------------DEDLKTI--KIQKQE----QVQKDGK 297

Query: 469  AAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNE--IKIH-LHEKT----KDLSQ--- 518
                 +  L+K  +D   E+  L  ++ I  E +NE   K+  LHE      +DLS+   
Sbjct: 298  -----LSQLEKQENDLANEISRLKTALGISVENINEESYKLKKLHENVQKFERDLSEKSV 352

Query: 519  -------EMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIED 571
                   E   L   ++  + Q + K+  +    T I+    + S    + +  ++K+ D
Sbjct: 353  IYTSTESEFNDLNEGVKRLKGQFKAKEELLSTLTTGISSTGGTDSGYNSQLSAAKTKLND 412

Query: 572  XXXXXXXXXXXXXXXRNEKSKVEARISTAQKE--------------CEEAQKQTNEM--- 614
                           + E +  E +I+ A++E              CE  + Q N++   
Sbjct: 413  AQICIKRSTMKIDMLKKESAINEPKIAHAERENEQNIREIKGYEQVCENLKAQLNDLGFN 472

Query: 615  ----RDVLIQQRQIVEEAKANLNGFQNKNR--VLLALTKLQNSGRI--TGFHGRLGDLGT 666
                +D+  ++ ++  E+    N  ++  R    L  T    S         G    L T
Sbjct: 473  PMMIKDLKQKEFKLRNESYQLSNDTEHLRRKTANLEFTYSTPSANFDPKSVKGVAAQLFT 532

Query: 667  ID-DQYDIAIS---TACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKL--RKCN 720
            ++ + +D A +    A  RL ++VV+      Q ++  R  K      I L+K+  R  N
Sbjct: 533  LEKENFDSATALQVCAGGRLFNVVVDNEVTASQLLERGRLRK--RVTIIPLNKIASRTLN 590

Query: 721  -----LDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKR-RF 774
                 L +   P NV    +LI    ++ R A   +   +L+ +D + A RV +  + R 
Sbjct: 591  ENALKLAKSVAPGNVELALNLIGYEDEVSR-AMEFIFGTSLICKDAETAKRVTFHPQIRA 649

Query: 775  RVVTLDGKLIDISGTMSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRSA 834
            R +TLDG + D  GT+SGG  + ++ L+    T  +   R  + +ME++L  K+ N    
Sbjct: 650  RSITLDGDIYDPEGTLSGGSRNTKNSLLIDIQTFNAASKR--LNEMELEL--KQIN---- 701

Query: 835  LSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVES-YHQRLSQLARELS--MNE 891
             S + E E   QK      E+++   K+ L K S  A   +   +R ++++ E+S    E
Sbjct: 702  -SKIAEYEQTSQKTKSLQNELNLATHKLSLAKKSLAANSATQIIRRNNEISDEISSCTAE 760

Query: 892  KNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKVASLE 951
             N+Q LL EE + +I++  +Q+  D  +F+QDK   L+         ELK +I       
Sbjct: 761  INRQTLLSEEFEQEIIK--IQK--DMEEFNQDKGSKLR---------ELKEEIT------ 801

Query: 952  QHIEILHEXXXXXXXXXXXLDIDLARATREKNKYSEEVLVCNKDISILSEQLES-IRLEK 1010
                                  +L++   E++ + E+     +++ +  +QL S I   K
Sbjct: 802  ----------------------NLSKKIEEQDAFIEKKFDLYQNLQLEKDQLTSDISASK 839

Query: 1011 ERIE--EQVI---ENNERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGL 1065
              IE  EQ I   EN     E + S+   + EL  I+ D NE K + L+  D + +L  L
Sbjct: 840  GSIEDLEQAIKELENTRNSIEDDLSLR--QTELNQIQNDLNEEKTRLLDIDDEIRELESL 897

Query: 1066 QEYVKKQLRSYETSLQSL 1083
                 +QL + E  LQ L
Sbjct: 898  LMKKNEQLSNSELELQKL 915

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  125 bits (313), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 99/162 (61%), Gaps = 12/162 (7%)

Query: 1214 KNERLEKFMEGFGIISMTLKEMYQMITM---------GGNAELELVDSLDPFSEGVLFSV 1264
            K +R E F   F  I+  L  +Y  +T          GG+A + + D  +PF+ G+ +  
Sbjct: 1055 KQKRKELFENAFEKINEHLDAIYSELTRNVNSTSILGGGSASMTIEDEDEPFNAGIRYHA 1114

Query: 1265 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1324
             PP K ++++  LSGGEKT+++LAL+FA++ Y P+P +++DE+DAALD  NV  +A YI+
Sbjct: 1115 TPPMKRFKDMEYLSGGEKTVAALALLFAINSYNPSPFFILDEVDAALDISNVQRIAAYIR 1174

Query: 1325 ER-TKNAQFIVISLRNNMFELAQNLVGIYKNN--NMTKSTTL 1363
                 + QFIVISL+N MFE +  LVG+++    N +K  TL
Sbjct: 1175 RHGNPDLQFIVISLKNTMFEKSDALVGVFRQQQENSSKIVTL 1216

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score =  124 bits (310), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 56/161 (34%), Positives = 100/161 (62%), Gaps = 10/161 (6%)

Query: 1213 FKNERLEKFMEGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFS 1263
             K +R+  F+  F  +   +  +Y+ +T          GG+A L L D  +P+  G+ + 
Sbjct: 1051 IKEKRINTFLACFNHVRDNIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLGGIRYH 1110

Query: 1264 VMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1323
              PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YI
Sbjct: 1111 ATPPMKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYI 1170

Query: 1324 KER-TKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTL 1363
            +   +   QFIVISL++N+F  ++++ G+++N +   S  +
Sbjct: 1171 RRHASPKMQFIVISLKSNLFSKSESMAGVFRNQHENSSMVI 1211

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  124 bits (310), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 64/162 (39%), Positives = 99/162 (61%), Gaps = 12/162 (7%)

Query: 1214 KNERLEKFMEGFGIISMTLKEMYQMIT---------MGGNAELELVDSLDPFSEGVLFSV 1264
            K +R   F   F   S  +  +Y+ +T          GG+A L L D  +PF+ G+ +  
Sbjct: 1049 KKKRKALFERAFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPFNAGIRYHA 1108

Query: 1265 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI- 1323
             PP K ++++  LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV  +A YI 
Sbjct: 1109 TPPFKRFKDMEYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNVDRIAAYIS 1168

Query: 1324 KERTKNAQFIVISLRNNMFELAQNLVGIYKNN--NMTKSTTL 1363
            +   ++ QFIVISL+N MFE +  LVG+Y+    N +K  TL
Sbjct: 1169 RHGNRDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1210

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
           complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  119 bits (297), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 173/718 (24%), Positives = 332/718 (46%), Gaps = 112/718 (15%)

Query: 128 LVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELI 187
           L LNNFKSY G+  +G   ++F++++GPNGSGKSN++D++ FV G +++ +R   L +LI
Sbjct: 7   LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 188 HKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAG-----------TMVVERRAFKNNS 236
           ++               F    D DN    + P++            T  + R    +  
Sbjct: 67  YRG--------------FLSGDDEDNNNEDVNPNSAYVKAFYQKEDVTHELMRSISNSGD 112

Query: 237 SKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYL 296
           S Y +N K  +Y + T  L++E I +  K FL+ QG+VE IA             L +  
Sbjct: 113 STYKINNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIASQSTT-------DLTKLF 165

Query: 297 EDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERK 356
           E++ G+ ++K + E+  E++E L++   E       ++ E +  + G       + K+ K
Sbjct: 166 EEVSGSIQYKKEYEELKEKVEKLSQSTAESIKNRRRINNEIKVYKDG-------ITKDEK 218

Query: 357 HTILKAQLLQRQ---IYDSNRKLATSCDKISALNMEFQEEKSQY----EHLQKEAETLTH 409
           +   KAQL +R+   +Y S  +L    +K S    + +E KS+     E L  E + L  
Sbjct: 219 Y---KAQLEKRRNLLVYSSLWQLYHLDEKKSQSKNKLKEAKSKVSKLKEKLANEEKILQK 275

Query: 410 EINNTKKESTALETESKNVNSKKRSLEKDFIA------------TDEKLKSIARKLKAAE 457
             N+  K++ A+ T+ KN   + RS EK+ +A            T +K+ +I R+++  E
Sbjct: 276 AKNSIVKDTAAI-TKYKN-KLEYRSKEKEKLASQLIPIKVSQRNTTKKISNIERRIEGIE 333

Query: 458 KAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHE--KTKD 515
           +   + +S  +   ++++ + K+ +  E+E+     + + +K +L++  +  ++    K 
Sbjct: 334 RDIERQKSYVERYESQLKVVTKSKESFELEIK--ESAKNFDKYRLSDEDLVTYDALSEKY 391

Query: 516 LSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSS-HSNLLKEKATIESKIEDXXX 574
           LS     ++ ++    +  QE   E+ + + +I + KS    +L+ +   +E +I +   
Sbjct: 392 LSSGGFDIDTKISLLNNDKQETSDEVAMFKNRIELAKSKIADDLVLQGERLELEISELTS 451

Query: 575 XXXXXXXXXXXXRNEKSKVEARI-STAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLN 633
                        +E   ++  I ST+ KE +   K    +R+ L++   +    + + N
Sbjct: 452 SLNEKNSLHSQKVSELKTLQGEIESTSNKEYDLNYK----LRETLVKLDDLSASQRESTN 507

Query: 634 GFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTI-DDQYDIAISTACPR-LDDIVVETVE 691
             + +  V + L +L       G  G + DL     ++Y +A+ST   +  D I+ + + 
Sbjct: 508 ERKLRENVSM-LRRL-----FPGVRGLVSDLCQPKKEKYALAVSTILGKNFDSIITDNIS 561

Query: 692 CGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRL-FD-----LITPVRDLFR 745
             Q+CI +L+K + G   FI L+ +             VP L F      ++T     + 
Sbjct: 562 VAQECIAYLKKQRAGVASFIPLESIES----------EVPTLPFSDGQGCILTINAIEYE 611

Query: 746 PAFY---------SVLRDTL-VARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGG 793
           P +          S++ DTL +A+DL+  + V     + ++VTL+G LI  +G M+GG
Sbjct: 612 PEYERAMQYVCSDSIICDTLTIAKDLKWKHNV-----KSKLVTLEGALIHKAGLMTGG 664

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  114 bits (284), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 175/735 (23%), Positives = 316/735 (42%), Gaps = 117/735 (15%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 183
           +++L+++ FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 184 SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKI-LPSAGTMVVERRAFKNNSSKYYVN 242
            +LI+K  Q   +   SV I F    +TD   + I   ++  + V R+     +SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFD---NTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLIN 118

Query: 243 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGT 302
           G  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 303 AKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKA 362
             F+ + EK  E   +  E  ++ ENR  L ++ +  LE  + E   FL+ +   T L  
Sbjct: 172 KMFEDRREKA-ERTMSKKETKLQ-ENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDL-- 227

Query: 363 QLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALE 422
                   +   ++  SCD  +      + + +      +  E    E+N    E TA E
Sbjct: 228 --------EKTERIVASCDYYN-----IKHKHTSIRETLENGEAHMKELNEFI-EKTAQE 273

Query: 423 TESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLK---- 478
            ES N + K+  L+K             +K    +   S+ E+     +NEI  LK    
Sbjct: 274 IESLNEDVKEIKLQK-------------QKELHKDSEISKLETQESTLLNEISRLKTSLS 320

Query: 479 ---KNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQ 535
              ++ +D   +L  L   I+    +LNE KI   +  +D     E L +Q E ++    
Sbjct: 321 IKAESVNDTTEKLKALELEIANSSARLNEKKIEYTKTEEDYKTVQEELSKQRELYK---- 376

Query: 536 EKQSEIKLSETKITMLKSS----HSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNEKS 591
           +K+  +    T I+   ++    ++ L+K KA +     D               + E S
Sbjct: 377 KKEELVSTLTTGISSTGAADGGYNAQLIKAKAGLS----DVSLAIKKSTMKMDLLKRELS 432

Query: 592 KVEARISTAQKECE-------EAQKQTNEMRDVLIQQ----------RQIVEEAKANLNG 634
            +E +++ A K+ E       E Q   N+++  L +           +Q   E K+    
Sbjct: 433 VIEPKLTQATKDNELNIKHVKECQDNCNKLQAQLTEYGFDPSRIKDLKQKENELKSQYYQ 492

Query: 635 FQNKNRVL---LALTKLQNSGRITGF-----HGRLGDLGTIDD---QYDIAIST-ACPRL 682
             N +  L   +A  +   +     F     +G +G L  +DD   +Y  A+ T A  RL
Sbjct: 493 ISNDSEYLKRRVANLEFNYTTPYPDFKANLVYGVVGQLFELDDDKIRYSTALQTCAGGRL 552

Query: 683 DDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDL---ITP 739
            ++VV+  +   Q ++         GR  L  ++    L++I+T    P++ +L   I P
Sbjct: 553 FNVVVQDSQTATQLLER--------GR--LRKRVTIIPLNKISTRPISPQVLELAKKIAP 602

Query: 740 VR-----DLFR------PAFYSVLRDTLVARDLQQANRVAY-GKRRFRVVTLDGKLIDIS 787
            +     +L +       A   +  ++L+  D + A ++ +  K R R +TL G + D  
Sbjct: 603 GKVELAINLIKFDKSVTKAMEFIFGNSLICEDPETAKKITFHPKIRARSITLQGDVYDPE 662

Query: 788 GTMSGGGSSPQSGLM 802
           GT+SGG  +    L+
Sbjct: 663 GTLSGGSRNTSDSLL 677

 Score = 81.6 bits (200), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score =  112 bits (280), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 171/737 (23%), Positives = 310/737 (42%), Gaps = 121/737 (16%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 183
           +++L+++ FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 184 SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKI-LPSAGTMVVERRAFKNNSSKYYVN 242
            +LI+K  Q   +   SV I F    +TD   + I   ++  + V R+     +SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF---DNTDKSNSPIGFANSPQISVTRQVVLGGTSKYLIN 118

Query: 243 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGT 302
           G  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

Query: 303 AKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKA 362
             F+ + EK  E   +  E  ++ ENR  L ++ +  LE  + E   FL+ +   T L  
Sbjct: 172 KMFEDRKEKA-ERTMSKKETKLQ-ENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDL-- 227

Query: 363 QLLQRQIYDSNRKLATSCD------KISALNMEFQEEKSQYEHLQKEAETLTHEINNTKK 416
                   +   ++  S D      K +++    +  ++  ++L +  E    EIN    
Sbjct: 228 --------EKTERIVVSYDYYNLKHKHTSIRETLENGEAHMKNLNEFIEKTIQEIN---- 275

Query: 417 ESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIES 476
                            SL +D     E++K    K    E   S+ E    + +NEI  
Sbjct: 276 -----------------SLNEDV----EEIKHQKEKELNKEGKISKLEKKENSLLNEISR 314

Query: 477 LK-------KNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEP 529
           LK       +N +D   +L ++   I+    KLN+ KI   +  KD     + +++QL  
Sbjct: 315 LKTSLSIKVENLNDTNEKLKSVEADITTSSTKLNDKKIAYTKTEKD----YKIVQQQLSE 370

Query: 530 FRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNE 589
            RD  + K+  +    T I+   ++      +    ++++ D               + E
Sbjct: 371 KRDLYKRKEELVSTLTTGISSTGAADGGYNAQLGKAKTELNDISLAIKKSNMRMDLLKKE 430

Query: 590 KSKVEARISTAQKECEEAQKQTNEMRDVLIQ-QRQIVE--------------EAKANLNG 634
              +E ++  A K+ E + K   E +++  + Q Q+VE              E K     
Sbjct: 431 LLTIEPKLKEATKDNELSIKHVKECQEICNKLQAQLVEFGFDPSRIKDLEQKENKMKSQY 490

Query: 635 FQNKNRVLLALTKLQN-------------SGRITGFHGRLGDLGTIDDQYDIAIST-ACP 680
           +Q  N       ++ N             +  + G  GRL  L   + +Y  A+ T A  
Sbjct: 491 YQICNEAEHLKRRVANLEFNYTKPYPDFETSSVYGVVGRLFQLDNDNIRYSSALQTCAGG 550

Query: 681 RLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENVPRLFDL---I 737
           RL ++VV   +   Q ++         GR  L  ++    LD+I T    P++ +L   I
Sbjct: 551 RLFNVVVRDSQTATQLLEG--------GR--LRKRVTIIPLDKIYTRPITPQVLELAKSI 600

Query: 738 TPVR-----DLFR------PAFYSVLRDTLVARDLQQANRVAY-GKRRFRVVTLDGKLID 785
            P +     +L R       A   +  ++L+  D + A ++ +  K R R +TL G + D
Sbjct: 601 APGKVELAINLIRFDKPVTKAMEFIFGNSLICDDPETAKKITFHPKIRARSITLQGDVYD 660

Query: 786 ISGTMSGGGSSPQSGLM 802
             GT+SGG  +    L+
Sbjct: 661 PEGTLSGGSRNTSQSLL 677

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score =  111 bits (278), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 175/726 (24%), Positives = 314/726 (43%), Gaps = 99/726 (13%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 183
           +++L+++ FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 184 SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKI-LPSAGTMVVERRAFKNNSSKYYVN 242
            +LI+K  Q   +   SV I F    ++D     I   S+ T+ V R+     +SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF---DNSDKSNAPIGFESSPTISVTRQVALGGTSKYLIN 118

Query: 243 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGT 302
           G  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 303 AKFKPQIEKCLEEIETLNEVCMEKENRFEL---VDKEKQNLESGKEEALEFL----DKER 355
             F+ + EK  E      E  ++ ENR  L   ++ + + L S K   LEF     D E 
Sbjct: 172 KMFEDRREKA-ERTMGKKEAKLQ-ENRTLLNEEIEPKLEKLRSEKRIFLEFQETQKDLEE 229

Query: 356 KHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTK 415
            H ++ A       +D N  +      +  L    Q  +++   L++    +T E+ +  
Sbjct: 230 THRVVSA-------FDYNYLVQKQTSVVETL----QTSENRIIELKELITKVTDELGSLN 278

Query: 416 KESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIE 475
           ++   ++ + KN   K   L K   + + KL +   +LK + K    SE N    +++++
Sbjct: 279 EDLEQIQVQKKNELDKNGKLAK-LESNESKLMNEISRLKTSYKI---SEDNLSDTLSKLK 334

Query: 476 SLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLER---------- 525
           S  KN +  + EL N +      +E+   I I L E  +   ++ E L            
Sbjct: 335 SKGKNLEANKQELSNKSKMFEKIEEEYKGINIQLDEYKQTYKKKEELLSTLSTGISSTGG 394

Query: 526 -------QLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDXXXXXXX 578
                  QL   + ++ E    IK S  KI  L+       +E A+ E K+E        
Sbjct: 395 TDGGYSAQLNNAKTKLNEANVSIKKSNIKIEALQ-------RELASNEPKMESAKKDLEI 447

Query: 579 XXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNK 638
                     + S+++ +I     + E  ++         ++Q++I  E +  LN  + +
Sbjct: 448 SLKQIKQYEEQCSQIQLKIKEHGYDAETVKE---------LKQKKIAIEQQ--LNKIERE 496

Query: 639 NRVL------LALTKLQNSG-----RITGFHGRLGDLGTIDDQYDIAIS---TACPRLDD 684
           N  L      +  T  + +G      + G   RL  L   ++ Y  A +    A  RL +
Sbjct: 497 NEYLKRKVANIDFTYTKPTGDFQEQSVKGVAARLFHLN--ENNYSSATALQVCAGGRLYN 554

Query: 685 IVVETVECGQQCIDHLRKNKLGYGRFILLDKL-------RKCNLDRIATPENVPRLFDLI 737
           +VV+  +   Q +   R  K      I L+K+       +  N+ +  +P NV    +LI
Sbjct: 555 VVVDNEKTASQLLQRGRLRK--RVTIIPLNKIMARKLNDKTLNIAKEISPGNVELALNLI 612

Query: 738 TPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKR-RFRVVTLDGKLIDISGTMSGGGSS 796
               D+ + A   +   +L+ +D + A +V +  + R R +TL G + D  GT+SGG  +
Sbjct: 613 GYEEDVAK-AMEFIFGSSLICKDAETAKKVTFHPQVRTRSITLQGDVYDPEGTLSGGSRN 671

Query: 797 PQSGLM 802
             S L+
Sbjct: 672 MNSSLL 677

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score =  110 bits (276), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 182/731 (24%), Positives = 308/731 (42%), Gaps = 109/731 (14%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 183
           +++L+++ FKSYA    I  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 184 SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILP----SAGTMVVERRAFKNNSSKY 239
            +LI+K  Q   +   SV I F      DN +    P    +   + V R+     +SKY
Sbjct: 63  QDLIYKRGQ-AGVIKASVTIVF------DNSDPSSSPFGFETYPKISVTRQIILGGTSKY 115

Query: 240 YVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDI 299
            +NG  +    V  L +   +++++  FLI+QG++  +  MK        D +L  +E+ 
Sbjct: 116 LINGHRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP-------DEILALIEEA 168

Query: 300 IGTAKFKPQIEKC------------------LEEIET-LNEVCMEKENRFELVDKEKQNL 340
            GT  F+ + EK                   LEEIE  LN +  EK    E      Q  
Sbjct: 169 AGTRMFEDRREKAEKTMAKKETKLQEIRALLLEEIEPKLNRLRNEKRAFLEF-----QQT 223

Query: 341 ESGKEEALEFLDKERKHTIL--------KAQLLQRQIYDSNRKLATSCDKISALNMEFQE 392
           ++  E+    ++     T++        + Q  Q++I D    +    D+IS L  +F+ 
Sbjct: 224 QTDLEKTSRIVNTYDYQTLVQKRSSMQERLQSDQKRIKDLEFSVEKYRDEISTLTEDFES 283

Query: 393 EKSQYE-HLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIAR 451
            + Q E  LQK+    T E      +  +L TE   V +    + +D +A ++      R
Sbjct: 284 IRRQKEKQLQKDTTLQTLE-----AKENSLSTELSRVTA-ALGITRDDLADEQ------R 331

Query: 452 KLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHE 511
            L A   + ++SE        E+ SL K + + E E   LN  I    EKL  I  +  E
Sbjct: 332 NLSALNLSIAKSEQ-------ELTSLSKTYSETENEYVVLNAEI----EKLKTICRNKEE 380

Query: 512 KTKDLSQEME-------SLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKAT 564
               L+  +            QL   + Q+ E Q  +K  E +ITML+       KE AT
Sbjct: 381 LLSTLTTGISSTGTTEGGYTAQLNNAKLQLNEAQIAVKKVEMRITMLR-------KELAT 433

Query: 565 IESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQI 624
            E  +E                ++   +++  ++ +  + E  ++   +  ++  +   I
Sbjct: 434 NEPLLERAKKENEVKRAELSENKSHVERLQESLTASGFKPELLKQLKQKEAELKTELYAI 493

Query: 625 VEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDIAIS---TACPR 681
             +A+       N        +K  N   + G   ++  L   ++ +D A +    A  R
Sbjct: 494 STDAEYLKRKVANLEFSYSPPSKEFNPKSVKGIAAQVFTLS--EENFDSANALQVCAGGR 551

Query: 682 LDDIVVETVECGQQCID--HLRK-------NKLGYGRFILLDKLRKCNLDRIATPENVPR 732
           L +++V+  +   Q ++   LRK       NK+   R I  D L K    +   P  V  
Sbjct: 552 LFNVIVDNEKTASQLLERGRLRKRVTIIPLNKIS-ARVINTDALNKA---KSLAPGAVEL 607

Query: 733 LFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKR-RFRVVTLDGKLIDISGTMS 791
             +LI    ++ R A   +   +L+ RD   A +V +  + R R +TLDG + D  GT+S
Sbjct: 608 ALNLIGYEAEVAR-AMEFIFGGSLICRDAATAKKVTFHPQVRARSITLDGDIYDPEGTLS 666

Query: 792 GGGSSPQSGLM 802
           GG  S  S L+
Sbjct: 667 GGSRSHTSSLL 677

 Score = 67.4 bits (163), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score =  105 bits (262), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 177/759 (23%), Positives = 319/759 (42%), Gaps = 155/759 (20%)

Query: 659  GRLGDLGTIDDQYDIAISTACPR------LDDIVVETVECGQQCIDHLRKNKLGYGRFIL 712
            G LG+L  ++D+Y      AC        L  IVV+T E     ++ L + K G   FI 
Sbjct: 538  GTLGELIKVNDKY-----KACAEVIGGNSLFHIVVDTEETATLIMNELYRMKGGRVTFIP 592

Query: 713  LDKLRKCNLDR-IATPENVPRLFDLITPVRDL-----FRPAFYSVLRDTLVARDLQQANR 766
            L+KL   +LD  +  P N          ++ +     F  A   V   T+V +DL Q  +
Sbjct: 593  LNKL---SLDADVKFPSNSTTQIQFTPLIKKIKYQPRFEKAVKHVFGKTIVVKDLGQGLK 649

Query: 767  VAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLST 826
            +A  K +   +TLDG   D  G ++GG                 Q+ R  ++ ++  L+ 
Sbjct: 650  LA-KKHKLNAITLDGDRADKRGVLTGG--------------YLDQHKRTRLDSLK-NLNE 693

Query: 827  KETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARE 886
                ++S    +  + + L  +  ++ +++  I K+  ++ S +  +E +   L+     
Sbjct: 694  SRNQHKSIGDELQVVRNELNDIDAQIDQLNGNIRKVSNDRESVLTNIEIFRTSLN----- 748

Query: 887  LSMNEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIEL-KMQIA 945
                +KN++ +L+E     +L+   Q+T    KF+Q+K+D  ++ ++Q    EL K +  
Sbjct: 749  ---TKKNERLILEESSNAIVLKLEKQKT--NLKFAQEKMDTYENDLLQDFDSELSKEEKE 803

Query: 946  KVASLEQHIEILHEXXXXXXXXXXXLD--IDLARATRE----------KNKYSEEVLVCN 993
            K+ SL + I +LH            +   ID   A  E          K K +E   V +
Sbjct: 804  KLESLTKEINVLHNKLDVTSDALEGITTTIDSLNAELESKLIPQQNDLKIKMAE---VGD 860

Query: 994  KDISILSEQLESIRLEKERIEEQVIENNERKAELNSSVEKLKQELLSIERDSNEFKAKEL 1053
              I  L ++L+ + LEKE +E+Q               E    EL +I+R+     A+E 
Sbjct: 861  AFILGLQDELKELDLEKESVEKQY--------------ENATLELGTIQREIETLVAEET 906

Query: 1054 EYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQLNDGIIESCTDVTAKVMNG 1113
                 LEK +  Q  + K+L +++ S++                 +I+  T VT +    
Sbjct: 907  NNKKLLEKANNQQRLLLKKLDNFQKSVEK---------------TMIKKTTLVTRR---- 947

Query: 1114 DIVQTQSITDVGNNDAMEDSGEAATHSGLPSXXXXXXXXXXXXXXXXXXHQLQDYLDNFN 1173
            + +Q Q I ++G    + +       S + S                   QL   L++ N
Sbjct: 948  EELQ-QRIREIG---LLPEDALVNDFSDITS------------------DQLLQKLNDMN 985

Query: 1174 GDIEVLEEYARRLAE----YQRRKLDLNQAVAKREEVRNKCESF----KNERLEKFMEGF 1225
             +I  L+   +R  E    +  ++ DL+   ++ +E ++  +      K +++      F
Sbjct: 986  TEISSLKNVNKRAFENFKKFNEKRKDLSGRASELDESKDSIQDLIVKLKQQKVSAVDSTF 1045

Query: 1226 GIISMTLKEMYQMITMGGNAELEL----VDSLDPFSE----------------------- 1258
              +S   K +++ +   G A+L +     DS+D  ++                       
Sbjct: 1046 QKVSENFKTVFERLVPRGTAKLVIHRRNEDSIDQANDVDVDMDTGNNEDTINKEGETVYT 1105

Query: 1259 GVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1316
            GV  SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1317 SIVANYIKERTKNAQFIVISLRNNMFELAQNLVGI-YKN 1354
            + VA  IKE + NAQFI  + R +M ++A     + Y+N
Sbjct: 1166 TAVATMIKELSTNAQFICTTFRTDMLQVADKFFRVKYEN 1204

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score =  105 bits (262), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 174/739 (23%), Positives = 303/739 (41%), Gaps = 125/739 (16%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 183
           +++L+++ FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 184 SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKI-LPSAGTMVVERRAFKNNSSKYYVN 242
            +LI+K  Q   +   SV I F    +TD   T I       + V R+     +SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF---DNTDKSNTPIGFSEYPKISVTRQIVLGGTSKYLIN 118

Query: 243 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGT 302
           G  +    V +L +   +++++  FLI+QG++  I  MK          +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKPSE-------ILSLIEEAAGT 171

Query: 303 AKF---KPQIEKCLEEIETLNEVCMEKENRFEL---VDKEKQNLESGKEEALEF----LD 352
             F   K + E+ +++ ET       +ENR  L   +D + + L + K   LEF     D
Sbjct: 172 KMFEDRKEKAERTMQKKET-----KLQENRTLLKEEIDPQLEKLRNEKRLFLEFQTIQAD 226

Query: 353 KERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEIN 412
            E    ++ A   Q        K+  S D I  +    +   S+ + LQK+ + +  EI+
Sbjct: 227 LETTEKVVIATDYQ--------KMLNSRDSIKTV---LETSNSKMDELQKKIDLVNREIS 275

Query: 413 NTKKESTALETESKNVNSKKRSLEKD-----FIATDEKLKSIARKLKAAEKAFSQSESNG 467
           N        E   + +  KK+ LE D       + ++KL S   KLKA  K    +  +G
Sbjct: 276 NLN------EDLQQTMKQKKKELENDTNIKAMESKEDKLLSEIAKLKANLKINGDNILDG 329

Query: 468 K------------------AAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHL 509
           K                  +    +E  K    +CE +L  LN SI  +KE+L  +   L
Sbjct: 330 KQKQKRLTVKIEKSKQLLDSKSQLLEDSKSKSRNCEADLTRLN-SIFKQKEELLSV---L 385

Query: 510 HEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKS---------------- 553
                         E Q+    D+I +   EI+ ++ KI +LK                 
Sbjct: 386 STGISSTGGTEGGYEAQISSVNDKINDNSIEIEKNKMKIELLKKEFMENEEKIGKSQLQV 445

Query: 554 -SHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTN 612
            +H    K+   I  K+E+               +N + +++  I    ++CE  +++  
Sbjct: 446 ETHMKERKQLTEICKKLEEDIFSHGFRPEAFKELKNREYELDQAIYKTNRDCEGLRRR-- 503

Query: 613 EMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYD 672
            +  +  Q  +  E    N                      + G    L  +   + +Y 
Sbjct: 504 -VAGIEFQYSKPFESFDPN---------------------SVKGVTAELFSIPEQNMKYV 541

Query: 673 IAIS-TACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKL-------RKCNLDRI 724
           I +   A  RL +++V+  + G   +   R  K      I LDK+        K  L + 
Sbjct: 542 IGLQICAGGRLYNVIVDNEKTGSALLQKGRLRK--RVTIIPLDKVISRPLNQNKLKLAKQ 599

Query: 725 ATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKR-RFRVVTLDGKL 783
             P  V    +LI    ++ + A   +  ++L+  D + A ++ +    R R +TL+G +
Sbjct: 600 LAPGKVELALNLIGYSDEVVK-AMEFIFGNSLICDDAETAKKITFNPGIRTRSITLEGDI 658

Query: 784 IDISGTMSGGGSSPQSGLM 802
            D  GT+SGG  +  + L+
Sbjct: 659 YDPEGTLSGGTRNNTNTLL 677

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score =  105 bits (262), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 180/718 (25%), Positives = 300/718 (41%), Gaps = 83/718 (11%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 183
           I++L+++ FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 184 SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNG 243
            +LI+K  Q   +   SV + F    D DN       S   + V R+     +SKY +NG
Sbjct: 63  QDLIYKRGQ-AGVTKASVTVVFDN-SDRDNSPIGFTNSP-KISVTRQVVLGGTSKYLING 119

Query: 244 KESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTA 303
             +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  GT 
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGTK 172

Query: 304 KFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKAQ 363
            F+ + EK  E      E  ++ ENR  L ++ +  LE  + E   FLD +   T L+  
Sbjct: 173 MFEDRREKA-ERTMAKKETKLQ-ENRALLAEEIEPKLEKLRSEKRIFLDFQTTQTDLERT 230

Query: 364 LLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTALET 423
              R +   N        + S+     Q+ + +  HL++E E ++ EI +  ++   L+ 
Sbjct: 231 --SRVVSAFN--YYNMKHRQSSFEQTLQDSEDKCNHLKEEIEKVSEEIKSLNEDLEELKL 286

Query: 424 ESKN--------VNSKKRSLEKDFIATDEKLKSIAR----KLKAAEKAFSQSESNGKAAV 471
           + KN        VN +K   E D +    ++K+        +  AEK   +  SN +   
Sbjct: 287 QKKNEMDNEGRLVNFEKE--ESDLLKQISRIKTTLSIKNDSIDEAEKELQKLNSNNEELT 344

Query: 472 NEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFR 531
            E+E     +   E E    N  ++    +L E++    E    LS  + S     + + 
Sbjct: 345 KELEMKLAQYTSTEKEYEIANSELT----RLKELQGKKSELLSTLSTGISSNGATDDGYS 400

Query: 532 DQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNEKS 591
            Q+   + ++  +E  I  L    S L KE A+ E K+                 +NEK 
Sbjct: 401 AQLVATKKKLNDTEVLIKKLNMKRSMLQKELASNEPKL--FQAKREHEKSSKIMEQNEKY 458

Query: 592 KVEARISTA------------QKECEEAQKQ---TNEMRDVLIQQRQIVEEAKANLNGFQ 636
             E R   A            +KE  E Q+Q    NE  + L  +R++     AN+    
Sbjct: 459 CGELRSQLASFGYDPDLLKFLRKEESEVQQQLYRANEEAEAL--KRRV-----ANIE--- 508

Query: 637 NKNRVLLALTKLQNSGRITGFHGRLGDLGTID-DQYDIAIS---TACPRLDDIVVETVEC 692
                    T+   +       G    L T+D  Q+D AI+    A  RL +I+V+    
Sbjct: 509 ------FNYTRPSANFDPKSVKGVAAQLFTVDQQQFDNAIALQVCAGGRLYNIIVDNEIT 562

Query: 693 GQQCIDHLRKNKLGYGRFILLDKL--RKCNLDRIA-----TPENVPRLFDLITPVRDLFR 745
             Q ++  R  K      I L K+  R  N + +A      P  V    +LI    D   
Sbjct: 563 ASQLLERGRLKK--RVTIIPLSKIATRTLNKNTLALAKELAPGKVELALNLI-GYDDEVS 619

Query: 746 PAFYSVLRDTLVARDLQQANRVAYGKR-RFRVVTLDGKLIDISGTMSGGGSSPQSGLM 802
            A   +  + LV +D   A +V +    R R +T  G + D  GT+SGG  +    L+
Sbjct: 620 KAMEFIFGNGLVCKDADTAKKVTFHPNIRTRSITQQGDVYDPEGTLSGGSRNTTRSLL 677

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score =  104 bits (260), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 173/732 (23%), Positives = 313/732 (42%), Gaps = 111/732 (15%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 183
           +++L+++ FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 184 SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKI-LPSAGTMVVERRAFKNNSSKYYVN 242
            +LI+K  Q   +   SV I F    ++D   + I   S   + V R+     +SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFA---NSDKNNSPIGFESYPKISVTRQIVLGGTSKYLIN 118

Query: 243 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGT 302
           G  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILSLIEEAAGT 171

Query: 303 AKFKPQIEKC----------LEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFL- 351
             F+ + EK           L+EI +L +         E V+ +   L + K   L+F  
Sbjct: 172 KMFEDRREKAERTMNKKETKLQEIRSLLQ---------EEVEPKLNKLRNEKRAFLDFQE 222

Query: 352 ---DKERKHTILKA----QLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEA 404
              D E    I+ A     L+Q++    N     S  +IS L    Q+ K +  +L+++ 
Sbjct: 223 TQSDLENTSKIVNAFVFSSLVQKRKNIEN-AFQNSESRISELTASVQQTKVELTNLEEDL 281

Query: 405 ETL-THEINNTKKEST-----ALETESKN-VNSKKRSLE---KDFIATDEKLKSIARKLK 454
           +T+ T + N  +K+       ALET+  N V+  K SL    ++    + K +S+ R ++
Sbjct: 282 DTIRTQKRNEMRKDGALSKLEALETQLINEVSRLKTSLSLTIENINQENGKRESLERSIR 341

Query: 455 AAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTK 514
             + +  +  +  K A NE             ELH+L  ++S + +   E+   L     
Sbjct: 342 GIQTSLQEKSAISKNAENEYN-----------ELHDLVQNLSQQLQTKEELLSTLTTGIS 390

Query: 515 DLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDXXX 574
                      QL   + ++ + + +++  E KI +LK       KE A  E KI D   
Sbjct: 391 STGATNSGYSAQLSNTKARLNDARIQVQRFEMKINILK-------KELAANEPKIVDAKS 443

Query: 575 XXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNEMR---DVLIQQRQIVEEAKAN 631
                        +E++K +  ++  Q  C + +    ++    D+    ++     K+ 
Sbjct: 444 L------------SEEAKKQVEVTGIQ--CSDLKMHLEKLGFNPDLFKSLKEEESSLKSK 489

Query: 632 LNGFQNKNRVL--------LALTKLQNSGRITGFHGRLGDLGTIDDQYDIAISTA---CP 680
           +    N    L         A +K  +    T   G    L +++++ + + +TA   C 
Sbjct: 490 IYNLSNDMEGLRRKVANIDFAYSKPSDKFDPTSVKGVAAQLFSLNEE-NFSSATALQICA 548

Query: 681 --RLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRK-------CNLDRIATPENVP 731
             RL ++VV       Q ++  R  K      I L+K+          N  +   P++V 
Sbjct: 549 GGRLFNVVVNNESTASQLLERGRLRK--RVTIIPLNKISARRLHQDTVNFAKQLAPDSVE 606

Query: 732 RLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAY-GKRRFRVVTLDGKLIDISGTM 790
              +LI    D    A   +   +L+ RD + A +V +  K R R +TL G + D  GT+
Sbjct: 607 LALNLI-GYEDEVAKAMEFIFGTSLICRDAETAKKVTFHPKVRARSITLQGDIYDPEGTL 665

Query: 791 SGGGSSPQSGLM 802
           SGG  +  S ++
Sbjct: 666 SGGSRNNNSSIL 677

 Score = 67.0 bits (162), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score =  104 bits (259), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 196/826 (23%), Positives = 338/826 (40%), Gaps = 170/826 (20%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 183
           +++L+++ FKSYA    I  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 184 SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSA----GTMVVERRAFKNNSSKY 239
            +LI+K  Q   +   SV I F      DN + K  P        + V R+     +SKY
Sbjct: 63  QDLIYKRGQ-AGVIKASVTIVF------DNSDIKSSPIGFERYPKISVTRQIALGGTSKY 115

Query: 240 YVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDI 299
            +NG  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+ 
Sbjct: 116 LINGHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKPTE-------ILSLIEEA 168

Query: 300 IGTAKF---KPQIEKCLEEIET-LNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKER 355
            GT  F   + + EK + + ET L E+      R  L ++ +  L+  + E   FL+ + 
Sbjct: 169 AGTRMFEDRREKAEKTMAKKETKLQEI------RALLQEEIEPKLDKFRSEKRAFLEFQE 222

Query: 356 KHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTK 415
             T L+  L     +D                         Y +L  +  ++   + N++
Sbjct: 223 TQTDLEMTLRIVNTHD-------------------------YHNLVTKQNSIQETVQNSE 257

Query: 416 KESTALETESKNVNSKKRSLEKDFIATD-----EKLKSIA-RKLKAAEKAFSQSESNGKA 469
           +    LE+  K   ++  SL +DF A       E LK  +  KL+  E   S   S    
Sbjct: 258 QRVQELESSIKKYQNELSSLNEDFTAIKNQKECELLKDGSLTKLEKLENTLSTDLSRFST 317

Query: 470 AVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDL---SQEMESLERQ 526
           A      L    DD           +  EK+ L +I+  L    KDL   ++ ++++E+Q
Sbjct: 318 A------LGIAKDD-----------LKQEKKSLIDIQSSLESSEKDLFVKAKNLKTIEQQ 360

Query: 527 LEPFRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXX 586
                D I++ +S+ K  E  ++ L +  S+         S++                 
Sbjct: 361 YNELNDSIEKLKSQHKDKEELLSTLTTGISSTGATDGGYNSQLAAAKAKLGEAEISIK-- 418

Query: 587 RNEKSKVEARISTAQKECEEAQ------KQTNEMRDVLIQQR-QIVEEAKANLN--GF-- 635
                K   RI+  QKE   ++      K+ NE + + ++QR Q +E+ K +LN  GF  
Sbjct: 419 -----KANMRIAMLQKELASSEPLLQRAKKDNEEQIMQVKQRGQEIEKLKVSLNKSGFNP 473

Query: 636 -------QNKNRVLLALTKLQNSGR------------------------ITGFHGRLGDL 664
                  + +N +   L KL N                           + G   ++  L
Sbjct: 474 ELMKTLRRRENELKNNLQKLSNDTEYLRRKVANLEFNYTSPTKDFNPQSVKGVAAQVFTL 533

Query: 665 GTIDDQYDIAIS---TACPRLDDIVVETVECGQQCIDH--LRKNKLGYGRFILLDKL--- 716
           G   D +D A +    A  RL +I+V+  +   Q ++   LRK        I L+K+   
Sbjct: 534 G--KDNFDSANALQVCAGGRLFNIIVDNEKTASQLLEKGMLRKRV----TIIPLNKISTR 587

Query: 717 ----RKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKR 772
                   L +   P  V    +LI    D+ +   Y +   +L+  D + A ++ +  +
Sbjct: 588 VLSDESLALAKKIAPGKVELALNLIGYEEDVSKAMQY-IFGGSLICADAETAKKITFHPQ 646

Query: 773 -RFRVVTLDGKLIDISGTMSGGGSSPQSGLMRS--KATTASQYSRDEVEKMEVQLSTKET 829
            R R +TLDG + D  GT+SGG S+  + L++   K   AS+ S+               
Sbjct: 647 IRARSITLDGDIYDPEGTLSGGSSNNTNSLLKDIQKYNEASRRSK--------------- 691

Query: 830 NYRSALSMVH----EMESALQKLTDRLPEIDIQISKIQLEKGSRVA 871
           ++ S LS++     E E A Q       E+D+   K QL + + V+
Sbjct: 692 SFESELSLIQQQIMECERASQLTKSLQNELDLAEHKFQLSQKALVS 737

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNIGHLIKTRFKG 1136

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
           complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score =  102 bits (253), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 161/732 (21%), Positives = 302/732 (41%), Gaps = 121/732 (16%)

Query: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182
           + I ++V+  FK+Y     I  F  +++ V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSA-----GTMVVERRAFKNNSS 237
              LIH+     S+ S SV+I F      D G   ILPS         +  RR       
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVFR-----DPGHRMILPSGVVPRENDEIFIRRTVGLKKD 113

Query: 238 KYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLE 297
            Y VN +    ++V R+L+  G  + +   ++ QG + ++   K K         L+ LE
Sbjct: 114 DYQVNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAKDKER-------LQLLE 166

Query: 298 DIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKH 357
           D++G   F+ ++   L++++   +   +       ++K+  ++E  ++E  +F   E K 
Sbjct: 167 DVVGAKSFESKLRASLKKMDETEQKRKKISEEMSELNKKLGDMEEERKELEKFNALEGKR 226

Query: 358 TILKAQLLQRQIYDSNRK---LATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNT 414
            +L+  L  R+I D   +   L +  + I A + E+ ++ ++ E + +E  T+  +I+ +
Sbjct: 227 KVLQFTLYDREINDIINQIEGLDSEYNNILASSEEYLQQLNKRETVVEEMTTILQDIDAS 286

Query: 415 KKESTALETESKNVNSKKRSLEKDFIATDEKLKSIA--------------RKLKAAEKAF 460
            K     E +   +  K + L    + +  K+K I               + LK   +A 
Sbjct: 287 LKLKGTTELQQSKI--KYQELSNGLVDSQVKMKEIKSQLDSQTEQSKIDEKNLKIIAEAI 344

Query: 461 SQSESNGKAAVNEIESLKKNHDDCEIELHNL-----------------------NHSISI 497
            + +S     +   E L ++    + EL +L                       N  I  
Sbjct: 345 KEKQSELGKILPRYEQLNQDEAKYKNELFDLKQKQKELMLKRGSYARFKTKEERNEWIHS 404

Query: 498 EKEKLNE-------IKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETK--I 548
           E E L E        KI L E+  ++ +E+++ E Q++   D +Q      +L + K  I
Sbjct: 405 EIEDLQEELTNLETTKITLAERRNEIQEELKTYEEQIDELLDSVQGPGVSAELEDLKSEI 464

Query: 549 TMLKSSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQ 608
             LKSS+++   E                         R E  + E ++ T  +   ++ 
Sbjct: 465 ESLKSSYADKFDE-------------------------RKELWRTEQKLQTVLENMADSV 499

Query: 609 KQTNEMRDVLIQQRQIVEEAKANL-NGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTI 667
           K++         +R + E    +L NG  +   +   L    ++       G LG+L  +
Sbjct: 500 KRS---------ERAVNESMSRSLANGIASVKEITEKLNLPDDA-----VFGTLGELIKV 545

Query: 668 DDQYD-IAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIAT 726
            ++Y   A       L ++VV+T E     ++ L   K G   F+ L+++   N   I  
Sbjct: 546 SEKYKRCAEVIGGNSLFNVVVDTEETATIIMNELYHMKGGRVTFMPLNRIHVDN--NITY 603

Query: 727 PEN-----VPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDG 781
           P N      P +  +   VR  +  A   +   T+V +DL + +++A  K +   VTLDG
Sbjct: 604 PPNEQASCTPLIKKIKYDVR--YEKAVKHIFGRTIVVKDLLEGSKIA-KKLKLNAVTLDG 660

Query: 782 KLIDISGTMSGG 793
              D  G ++GG
Sbjct: 661 DRADKMGVLTGG 672

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 104/212 (49%), Gaps = 22/212 (10%)

Query: 1169 LDNFNGDIEVLEEYARRLAE----YQRRKLDLNQAVAKREE----VRNKCESFKNERLEK 1220
            L++ N ++  L    +R +E    +  +K++LN+  A+ ++    ++N  E  K +++  
Sbjct: 977  LNSVNEEMSSLTNVNKRASENFRKFNEKKIELNERAAELDDSKVSIQNLIEKLKQQKVTA 1036

Query: 1221 FMEGFGIISMTLKEMYQMITMGGNAELEL------------VDSLDPFSEGVLFSVM--P 1266
                F  +S     +++ +   G A+L +             +S +    G+  SV    
Sbjct: 1037 VDSTFKKVSENFSTVFEKLVPRGTAKLIIHRQEENKTRSKDKNSTESIYSGISISVSFNS 1096

Query: 1267 PKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1326
             K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA+ IK  
Sbjct: 1097 KKNEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRAAVADVIKSL 1156

Query: 1327 TKNAQFIVISLRNNMFELAQNLVGIYKNNNMT 1358
            + NAQFI  + R +M ++A     +   N ++
Sbjct: 1157 SGNAQFICTTFRTDMLQVADKFFRVKYENKIS 1188

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1223

 Score = 98.6 bits (244), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 172/719 (23%), Positives = 306/719 (42%), Gaps = 95/719 (13%)

Query: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182
           + I ++++  FK+Y     I  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNG---ETKILPSAGTMVVERRAFKNNSSKY 239
              LIH+     S+ S SV+I F   HD D+     + + P +   V+ RR        Y
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVF---HDPDHRIILPSGVAPRSNDEVLVRRTVGLKKDDY 115

Query: 240 YVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDI 299
            +N +     +V R+L+  G  +++   ++ QG +  IA   AK     D   L+ LED+
Sbjct: 116 QLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRI--IALTNAK-----DKERLQLLEDV 168

Query: 300 IGTAKFKPQIEKCLEEIETLN----EVCMEKENRFELVDKEKQNLESGKEEALEFLDKER 355
           +G   F+ ++   L+++E       ++  E E   EL DK  +  E  KE  + F + ER
Sbjct: 169 VGAKSFEVKLRASLKKMEQTEQKRAQIVKEME---ELNDKLSEMEEERKELEV-FNNLER 224

Query: 356 KHTILKAQLLQRQIYD-----------SNRKLATSCDKISALNMEFQEEKSQYEHLQKEA 404
                +  L  R++ D            N  L +S D I+    E  + +   E + K  
Sbjct: 225 NRKAFQFTLYDRELNDVINQIEKMDDVYNVTLHSSHDYIT----ELDKREDMVEQINKNL 280

Query: 405 ETL--------THEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAA 456
           + L        T E++  + +   L     N+N K R L++  ++ DE+     + L   
Sbjct: 281 QNLESSIKIKETAELSQARSKHNELSNAIANLNVKIRDLQRQVVSYDEQSDLNRKNLAII 340

Query: 457 EKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNL---NHSISIEKEKLNEIKIHLHEKT 513
            +A    ++         ESL K     ++EL  L      + + K K +  +  + E+ 
Sbjct: 341 NEAIEAKQAQLAKISPRFESLSKEEVSYKLELAGLQEKQRDLLLMKGKYSHFQT-VEERN 399

Query: 514 KDLSQEMES----------LERQLEPFRDQIQEKQSEIKLSETKITMLKSS--HSNLLKE 561
           + +  E+ S          L+ Q++  R+++ EK   +  +E +I  L+ S     ++ E
Sbjct: 400 EWIEGELRSLNETLANTTHLKSQIDNERNELHEK---LNATEEQIQELEDSVRGPGVVAE 456

Query: 562 KATIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQ 621
              IE K+ D               R E  + E ++ T  +   +  K +         +
Sbjct: 457 IEDIEKKVND----LKAEYVEKINERKELWRSEQKLQTISETLLDTVKNS---------E 503

Query: 622 RQIVEE-AKANLNGFQNKNRVLLALTKLQNSGRITGFHGRLGDLGTIDDQYDI-AISTAC 679
           R + E  AK+  NG  +   +   L   +  GR+    G LG+L  ++++Y + A     
Sbjct: 504 RSVSETMAKSLANGIASVREITEKLRLPE--GRV---FGTLGELIKVNEKYKMCAEVVGG 558

Query: 680 PRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIATPENV-PRLFDLIT 738
             L  IVV+T E     I  L + + G   F+ L+++   N   I  P N       LI 
Sbjct: 559 NSLFHIVVDTDETASLMIQELYRMRGGRVTFMPLNRI--YNDPNITYPPNAQSSCTPLIK 616

Query: 739 PVRDLFRPAFYSVLRD----TLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGG 793
            ++  F   F SV+++    T+V RDL   +++A    +   +TLDG   D SG ++GG
Sbjct: 617 KIK--FDAQFESVVKNVFGKTIVVRDLAAGSKIA-KHYKLDAITLDGDRADKSGLLTGG 672

 Score = 76.3 bits (186), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (56%), Gaps = 2/102 (1%)

Query: 1259 GVLFSVMPPKKSWR--NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1316
            GV  SV    K  R  ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  
Sbjct: 1099 GVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVDPAPFYLFDEIDAALDKQYR 1158

Query: 1317 SIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMT 1358
            + VA  IK  + NAQFI  + R +M ++A     +   N ++
Sbjct: 1159 TAVAGIIKALSANAQFICTTFRTDMLQVADKFFRVKYENKIS 1200

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 95.1 bits (235), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 86/308 (27%), Positives = 148/308 (48%), Gaps = 32/308 (10%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 183
           + +L+++ FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 184 SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKI-LPSAGTMVVERRAFKNNSSKYYVN 242
            +LI+K  Q   +   SV I F    ++D  +  I   ++ T+ V R+     +SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF---DNSDKSKAPIGFETSLTISVTRQIVLGGTSKYLIN 118

Query: 243 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGT 302
           G  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPTE-------ILALIEEAAGT 171

Query: 303 AKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKA 362
             F+ + EK +  +    E  ++ ENR  L ++ +  LE  + E   FLD +   T L+ 
Sbjct: 172 KMFEDRREKAIRTMAK-KETKLQ-ENRTLLKEEIEPKLEKLRLEKRTFLDFQETQTDLEE 229

Query: 363 QLLQRQIYDSNR----------KLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEIN 412
                  YD +R           L++  +KI  LN       SQ   L +E E+L  +  
Sbjct: 230 TDRVVNAYDYHRLKSQKELFKETLSSKENKIKDLN-------SQISKLAEELESLNEDFE 282

Query: 413 NTKKESTA 420
             +K+  A
Sbjct: 283 EIRKKKNA 290

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 55/75 (73%), Gaps = 1/75 (1%)

Query: 1269 KSWR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1327
            K W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R 
Sbjct: 1075 KLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRF 1134

Query: 1328 KNAQFIVISLRNNMF 1342
            K +QFIV+SL+  MF
Sbjct: 1135 KGSQFIVVSLKEGMF 1149

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score = 94.7 bits (234), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 58/190 (30%), Positives = 101/190 (53%), Gaps = 13/190 (6%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 183
           +++L+++ FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRASNL 62

Query: 184 SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKI-LPSAGTMVVERRAFKNNSSKYYVN 242
            +LI+K  Q   +   SV I F    +TD   + I   ++  + V R+     +SKY +N
Sbjct: 63  QDLIYKRGQ-AGITKASVTIVF---DNTDKTNSPIGFNNSAKISVTRQVVLGGTSKYLIN 118

Query: 243 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGT 302
           G  +    V +L +   +++++  FLI+QG++  +  MK K        +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPKE-------ILSLIEEAAGT 171

Query: 303 AKFKPQIEKC 312
             F+ + EK 
Sbjct: 172 KMFEDRREKA 181

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1078 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1137

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1138 SQFIVVSLKEGMF 1150

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 123/238 (51%), Gaps = 15/238 (6%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 183
           +++L+++ FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 184 SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKI-LPSAGTMVVERRAFKNNSSKYYVN 242
            +LI+K  Q   +   SV I F    +TD   + I   ++  + V R+     +SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF---DNTDKSNSPIGFTNSPQISVTRQVVLGGTSKYLIN 118

Query: 243 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGT 302
           G  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

Query: 303 AKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTIL 360
             F+ + EK  E   +  E  ++ ENR  L ++ +  LE  + E   FL+ +   T L
Sbjct: 172 KMFEDRREKA-ERTMSKKETKLQ-ENRTLLTEEIEPKLEKLRNEKRMFLEFQSTQTDL 227

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 77/162 (47%), Gaps = 25/162 (15%)

Query: 658 HGRLGDLGTIDD---QYDIAIST-ACPRLDDIVVETVECGQQCIDH--LRK-------NK 704
           HG +G L  ID+   +Y  A+ T A  RL ++VV+  +   Q ++   LRK       +K
Sbjct: 524 HGVVGQLFQIDNDNIRYATALQTCAGGRLFNVVVQDSQTATQLLERGRLRKRVTIIPLDK 583

Query: 705 LGYGRFI---LLDKLRKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDL 761
           + Y R I   +LD  +K    ++    N+ R  + IT        A   +  ++L+  D 
Sbjct: 584 I-YTRPISSQVLDLAKKIAPGKVELAINLIRFDESITK-------AMEFIFGNSLICEDP 635

Query: 762 QQANRVAY-GKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLM 802
           + A ++ +  K R R +TL G + D  GT+SGG  +    L+
Sbjct: 636 ETAKKITFHPKIRARSITLQGDVYDPEGTLSGGSRNTSESLL 677

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score = 92.0 bits (227), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 168/718 (23%), Positives = 299/718 (41%), Gaps = 107/718 (14%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 183
           +++L+++ FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 184 SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKI-LPSAGTMVVERRAFKNNSSKYYVN 242
            +LI+K  Q   +   SV I F    + D   + I   S   + V R+     +SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFT---NDDKANSPIGFESYPKISVTRQIVLGGTSKYLIN 118

Query: 243 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGT 302
           G  +    V  L +   +++++  FLI+QG++  +  MK          +L  +E+  GT
Sbjct: 119 GHRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEAAGT 171

Query: 303 AKFKPQIEKC----------LEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLD 352
             F+ + EK           L+EI TL  +  E E +   +  EK+     +E   +F  
Sbjct: 172 KMFEDRREKAERTMNKKETKLQEIRTL--LIEEIEPKLNKLRNEKRAFLEFQETQSDF-- 227

Query: 353 KERKHTILKAQLLQRQIYDSNRKLATSCDKISALNME--FQEEKSQYEHLQKEAETLTHE 410
            E+   I+ A                S    S  N E  F+  +S+ E L++  +     
Sbjct: 228 -EKTSRIVNA-------------FTYSTLAQSRKNFEETFKSNESRIEQLEEAIQKTRQG 273

Query: 411 INNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAA 470
           + N +++     T+ +N   K   L +   A + +L +   +LKA+    + +  N    
Sbjct: 274 MTNLEEDLDVARTQKRNEMGKNGKLGQ-LEALENQLNNDLSRLKAS---LTITTDNLNEE 329

Query: 471 VNEIESLKKNHDDCEIELH-NLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEP 529
               ESL+++  D E  L  N  HS + E E L+            L+  + +LE+QL  
Sbjct: 330 NVRRESLERSICDYESSLEKNTTHSKNTEDEYLS------------LNNLVSNLEKQL-- 375

Query: 530 FRDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNE 589
                Q K+  +    T I+   ++ S    + ++ +++  D               R E
Sbjct: 376 -----QTKEELLSTLTTGISSTGATTSGYNLQLSSAKARFNDAQVQVQRFGMKIDLLRKE 430

Query: 590 KSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQN------------ 637
            S  E +++ A+  CEEA+K+    R    +    +E+   N + F+             
Sbjct: 431 LSANEPKLAKAKSICEEAKKEIEAHRMQCSKLNAHLEKLGFNPDLFKQLKEEESTLRQSI 490

Query: 638 ----------KNRVL---LALTKLQNSGRITGFHGRLGDLGTIDDQ-YDIAIS---TACP 680
                     K RV       +K   +   +   G    L ++D++ Y  A +    A  
Sbjct: 491 YKLSSEMESLKRRVANIEFTYSKPSENFNPSSVKGVAAQLFSLDEKNYSSATALQVCAGG 550

Query: 681 RLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLDRIAT-------PENVPRL 733
           RL ++VV+      Q ++  R  K      I L+K+   +L + A        P NV   
Sbjct: 551 RLFNVVVDNEGTASQLLERGRLRK--RVTIIPLNKISARSLHQNAVKAAKELAPGNVELA 608

Query: 734 FDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKR-RFRVVTLDGKLIDISGTM 790
            +LI    ++ + A   +   +L+ +D + A +V +  R R R +TL G + D  GT+
Sbjct: 609 LNLIGYEEEVSK-AMEFIFGTSLICQDAETAKKVTFHPRVRARSITLQGDIYDPEGTL 665

 Score = 67.4 bits (163), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W+ ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 89.7 bits (221), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 106/207 (51%), Gaps = 23/207 (11%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 183
           +++L+++ FKSYA    I  +   F+A+ G NGSGKSN++D++ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 184 SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKI-LPSAGTMVVERRAFKNNSSKYYVN 242
            +LI+K  Q   +   SV I F   +++D   + I   S   + + R+      SKY +N
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF---NNSDTSNSPIGFESHAKISITRQIILGGVSKYLIN 118

Query: 243 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGT 302
           G  +    V +L +   +++++  FLI+QG++  +  MK +        +L  +E+  GT
Sbjct: 119 GHRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQE-------ILSLIEEAAGT 171

Query: 303 AKFKPQIEKC----------LEEIETL 319
             F+ + EK           L+EI TL
Sbjct: 172 RMFEDRREKAERTMAKKETKLQEIRTL 198

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 80/141 (56%), Gaps = 4/141 (2%)

Query: 1202 KREEVRNKCESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVL 1261
            K +E   K   +K E L K  E    +S+    ++  +     A+LE  +  D  +EG+ 
Sbjct: 1013 KIQETIEKLNEYKRETLIKTWEK---VSVDFGNIFGDLLPNSFAKLEPSEGKD-VTEGLE 1068

Query: 1262 FSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1321
              V   K    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + +
Sbjct: 1069 VKVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGH 1128

Query: 1322 YIKERTKNAQFIVISLRNNMF 1342
             IK R K +QFIV+SL+  MF
Sbjct: 1129 LIKTRFKGSQFIVVSLKEGMF 1149

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 87.8 bits (216), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 96/186 (51%), Gaps = 19/186 (10%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRA-NKMRQGKL 183
           I++L+++ FKSYA    I  +   F+A+ G NGSGKSNV+D++ FV G  + + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 184 SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILP----SAGTMVVERRAFKNNSSKY 239
            +LI+K  Q   +   SV I F       N + K  P    ++  + V R+     +SKY
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVF------SNLDPKCSPIGFENSPKLSVTRQIILGGTSKY 115

Query: 240 YVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDI 299
            +NG  +    V +L +   +++++  FLI+QG++  +  MK          +L  +E+ 
Sbjct: 116 LINGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPSE-------ILSLIEEA 168

Query: 300 IGTAKF 305
            GT  F
Sbjct: 169 AGTKMF 174

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 37.0 bits (84), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 70/148 (47%), Gaps = 18/148 (12%)

Query: 668 DDQYDIAIS---TACPRLDDIVVETVECGQQCIDH--LRK-------NKLGYGRFILLDK 715
           ++ YD A++    A  RL +++V+      Q ++   LRK       NK+   R I  + 
Sbjct: 535 ENNYDSALALQVCAGGRLFNVIVDDQNTASQLLERGKLRKRVTIIPLNKIAT-RVINSES 593

Query: 716 LRKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYGKR-RF 774
           L+   L +   P  V    +L+    ++ +   Y +  ++LV  D + A R+ +  + R 
Sbjct: 594 LK---LAKQLAPGKVQLALNLVGYEEEVSKAMEY-IFGNSLVCNDAETAKRLTFHPQIRT 649

Query: 775 RVVTLDGKLIDISGTMSGGGSSPQSGLM 802
           R +T  G + D  GT+SGG  + +S L+
Sbjct: 650 RSITQQGDVYDPEGTLSGGSRNNKSTLL 677

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
           YJL074C (SMC3) - SMC chromosomal ATPase family member
           [contig 224] FULL
          Length = 1247

 Score = 86.7 bits (213), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 110/440 (25%), Positives = 196/440 (44%), Gaps = 79/440 (17%)

Query: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182
           + I  +++  FK+Y  I  +  F   F+ V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 25  MYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSSLKREE 84

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVE------RRAFKNNS 236
              LIH+     S+ S  V+I FH   D      +++ ++G  V E      RR      
Sbjct: 85  RQGLIHQGT--GSIMSAYVEIVFHDPSD------QMMMTSGIPVTEEHIVRVRRTIGLKK 136

Query: 237 SKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYL 296
            +Y VNGK  + ++++R+ +  G    +   ++ QG + ++   K       D   L  L
Sbjct: 137 DEYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAK-------DKERLLLL 189

Query: 297 EDIIGTAKFKPQIEKCLEEIETLNE-------VCMEKENRFELVDKEKQNLESGKEEALE 349
           ED++G   F+ ++ +  +++E  N           E + R E +D+E+Q LE  +E    
Sbjct: 190 EDVVGARSFEIKLRESSKKMEATNRDRAKITSELSELKARLEELDEERQELEKYQE---- 245

Query: 350 FLDKERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEE-KSQYEHLQK--EAET 406
            L+++R+       + Q  +YD  R+L     +I +L  E+    +S  E++Q+  + ET
Sbjct: 246 -LERDRR-------IFQFVLYD--RELNEVTSQIESLEDEYNNVLQSSEEYIQELYKRET 295

Query: 407 LTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARK-----LKAAEKAFS 461
           L   I N  K  + +E E K   S       DF     +L+ I ++     ++  E    
Sbjct: 296 L---IANLTKNISNVEAELKLKES------TDFQQDKSRLQEIVKRKADLEIRYEETKRQ 346

Query: 462 QSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEME 521
           + + +G+ AV      +KN    E E+ N +  ++            L  + + L  E E
Sbjct: 347 RDQVHGQCAV-----YRKNLATVEEEIQNTSTQLN-----------RLSPRYEQLKLEAE 390

Query: 522 SLERQLEPFRDQIQEKQSEI 541
           + E QL     Q Q KQ EI
Sbjct: 391 AFEAQL----SQYQRKQREI 406

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 67/116 (57%), Gaps = 2/116 (1%)

Query: 1250 VDSLDPFSEGVLFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1307
             D+LD    GV  SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEI
Sbjct: 1114 ADTLDSMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEI 1173

Query: 1308 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTL 1363
            DAALD +  + VAN IKE + +AQFI  + R +M ++A +   +   N +++  T+
Sbjct: 1174 DAALDKQYRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRVKFENKISEIATV 1229

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1227

 Score = 85.9 bits (211), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 83/308 (26%), Positives = 145/308 (47%), Gaps = 46/308 (14%)

Query: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182
           + I ++++  FK+Y     I  F    + ++G NGSGKSN+  ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 183 LSELIHK-SEQFPSLASCSVQIHFHYVHDTDN-----GETKILPSAGTMVVERRAFKNNS 236
              LIH+ +    S+ SCSV+I F   HD DN         I+P     V  RR      
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVF---HDPDNRMILASNASIVPRPNNEVFIRRTVGLKK 117

Query: 237 SKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYL 296
             Y +N +    +++ R+L+  G  + +   ++ QG++  IA   AK     D   L+ L
Sbjct: 118 DDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKI--IALTNAK-----DKERLQLL 170

Query: 297 EDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKE----KQNLESGKEEALEF-- 350
           ED++G   F+ ++   L++I+       E E +   +DKE    K  L   + E LE   
Sbjct: 171 EDVVGAKSFEIKLNDSLKKIK-------ETEFKKSTIDKELSELKNKLNEMEWEKLELEK 223

Query: 351 ---LDKERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEF----QEEKSQYEHLQKE 403
               DK RK       +LQ  +YD  R+L    ++I +L+ ++    Q  +S  + L K 
Sbjct: 224 FNKFDKNRK-------VLQFTLYD--RELNDLINQIESLDDDYNSILQSSESYIQELDKR 274

Query: 404 AETLTHEI 411
            ET+ +++
Sbjct: 275 -ETMVNDV 281

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/103 (40%), Positives = 62/103 (60%), Gaps = 3/103 (2%)

Query: 1255 PFSEGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1312
            P   GV  SV    K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD
Sbjct: 1099 PMYTGVSISVSFNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALD 1158

Query: 1313 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGI-YKN 1354
             +  + VAN +KE +KNAQFI  + R +M ++A     + Y+N
Sbjct: 1159 KQYRTAVANTLKELSKNAQFICTTFRTDMLQVADKFFRVKYEN 1201

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
           similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074C SMC3 Subunit of the multiprotein cohesin complex
           required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 184/753 (24%), Positives = 318/753 (42%), Gaps = 106/753 (14%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLS 184
           I  ++++ FK+Y     +  F    + VVG NGSGKSN   ++ FV     + +++    
Sbjct: 4   IKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRK 63

Query: 185 ELIHKSEQFPSLASCSVQIHFHYVHD-------TDNGETKILPSAGTMVVERRAFKNNSS 237
             I++      + S  V+I F    +        D GE +I          RR       
Sbjct: 64  GFIYQGA--GQVMSAFVEIIFDDPENLMLAPLRNDTGEVRI----------RRTVGLKKD 111

Query: 238 KYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLE 297
           +Y +N K S   +V R+L+  G    +   ++ QG + S+   K       D   L  LE
Sbjct: 112 EYMINDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK-------DLERLHLLE 164

Query: 298 DIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEF--LDKER 355
           D++G   F+ ++++ L+++E       +  N    +DK    L   KEE  ++  L+++R
Sbjct: 165 DVVGAKSFENKLKESLKKMEAAERDRTKITNELNELDKRLSELSDEKEELEKYNNLNRDR 224

Query: 356 KHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQ---EEKSQYEHLQKEAETLTHEIN 412
           K       +LQ  +YD  R+L    ++I  L  E+    E  S+Y +  ++ E L  E+N
Sbjct: 225 K-------VLQFCLYD--RELNDITNQIEQLEGEYNSIIENSSEYVNELEKREVLAVELN 275

Query: 413 NTKKESTALETESK--------NVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSE 464
              K   +LE+E K         + + K  +  +    D +L  I  +L A++   +  E
Sbjct: 276 ---KRMNSLESEIKIKQSTDLPQLKASKLEVAGELADLDTRLNDIQMQLDASQ---AHLE 329

Query: 465 SNGKAAVNEIESLKKNHD-DCE--IELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEME 521
           SN    V EI  +KK  + +C    E+      +S E E L   K+ + + TK   +E+ 
Sbjct: 330 SN----VKEIGEVKKQIEINCSSIAEVQPKFQKLSNEAEIL---KVEIEKLTKR-QRELL 381

Query: 522 SLERQLEPFR------DQIQEKQSEIKLSETKITMLK----SSHSNLLKEKATIESKIED 571
           S + + E FR      D IQE+ + +  S  K  +LK    S  S L  +   + ++IED
Sbjct: 382 SKKGKYEDFRTVNERNDWIQEQINLLNQSLNKSNILKDQLTSQLSTLQHDLENLNAEIED 441

Query: 572 XXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQIVEEAKAN 631
                            ++  ++ +++ A+KE      Q  ++     + + I      +
Sbjct: 442 LADSVNGMGSVA-----QQEDLQNKVTQAKKEYLTKIDQRKQLWRTEQRLQTISTSLDND 496

Query: 632 LNGFQ-NKNRVL---LALTKLQNSGRITG-------FHGRLGDLGTIDDQYDI-AISTAC 679
           +  F+ + N  +   LAL  LQN   I           G +G+L  + D+Y I A     
Sbjct: 497 VKRFESDMNETIDRSLALG-LQNVNDIVNRLNLHEHVFGPVGELIKVSDKYKICAEVVGG 555

Query: 680 PRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLRKCNLD-RIATPENVPR--LFDL 736
             L ++VV+  E     I  L   K G   FI L+KL   ++D     P N+ +     L
Sbjct: 556 NSLFNVVVDNEETASLLIKELFATKGGRVTFIPLNKL---HVDTNFTYPNNLEKNQCTPL 612

Query: 737 ITPVR-DL-FRPAFYSVLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGG- 793
           I  ++ D+ F      V   TLV + L     +A  + +   +TLDG   D  G +SGG 
Sbjct: 613 IKKIKYDVKFEKVIKQVFGRTLVVKSLIDGASLA-KEYKLNAITLDGDRADSKGVLSGGY 671

Query: 794 ---GSSPQSGLMRSKATTASQYSRDEVEKMEVQ 823
                S +   +R    +  +Y + +VE  E++
Sbjct: 672 LDQYKSNRLDTLRDFKQSKREYKKIQVELQEIK 704

 Score = 69.3 bits (168), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 54/99 (54%)

Query: 1274 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1333
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1334 VISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDILHSS 1372
              + R +M  +A     +   N ++  T +   D ++ S
Sbjct: 1177 CTTFRTDMINVADTFFRVKFENKVSTVTEVSRQDAVNFS 1215

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
            YFR031C
          Length = 1170

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 35/86 (40%), Positives = 58/86 (67%)

Query: 1257 SEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1316
            +EG+ F V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  + 
Sbjct: 1064 TEGLEFKVRLGSIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHT 1123

Query: 1317 SIVANYIKERTKNAQFIVISLRNNMF 1342
              + + IK R K +QFIV+SL+  MF
Sbjct: 1124 QNIGHLIKTRFKGSQFIVVSLKEGMF 1149

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 104/232 (44%), Gaps = 29/232 (12%)

Query: 650 NSGRITGFHGRLGDLGTIDDQYDIAIS---TACPRLDDIVVETVECGQQCIDHLRKNKLG 706
           N   + G   +L  L   +D YD A +    A  RL ++VV+      Q ++  R  K  
Sbjct: 519 NPRSVKGVAAQLFTLA--EDNYDSATALQVCAGGRLYNVVVDNERTASQLLEKGRLRK-- 574

Query: 707 YGRFILLDKL--RKCN-----LDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVAR 759
               I L+++  R  N     L +   P  V    +L+    ++ R A   +  ++L+ +
Sbjct: 575 RVTIIPLNRIAARALNSQTLQLAQKTAPGKVELALNLVGYEEEVSR-AMEFIFGNSLICK 633

Query: 760 DLQQANRVAYGKR-RFRVVTLDGKLIDISGTMSGGGSSPQSGLMRSKATTASQYSRD--E 816
           D + A ++ +  + R R +TL G + D  GT+SGG  +  S L+        +Y++    
Sbjct: 634 DAETAKKITFHPQIRTRSITLQGDVYDPEGTLSGGSRNNTSSLL----IDVQKYNKTAKR 689

Query: 817 VEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGS 868
           +E++E++L       +S    + E ES LQK      ++++   K+ L + S
Sbjct: 690 IEELELKL-------KSITRDLEEQESKLQKTRSVRNDLNLATHKLTLAQRS 734

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 66/147 (44%), Gaps = 15/147 (10%)

Query: 659 GRLGDLGTID-DQYDIAIS---TACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLD 714
           G    L T++ D +D A +    A  RL ++VV+  +     ++  R  K      I L+
Sbjct: 525 GVAAQLFTLNKDHFDAASALQVCAGGRLYNVVVDNEKTASLLLEKGRLRK--RVTIIPLN 582

Query: 715 KL-------RKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRV 767
           K+       R   + +   P  V    +LI    ++ R A   +   +LV +D   A +V
Sbjct: 583 KIAARTLNARTLQMAKDIAPGKVELALNLIGYDDEVSR-AMEFIFGGSLVCQDANTAKKV 641

Query: 768 AYGKR-RFRVVTLDGKLIDISGTMSGG 793
            +  + R R +TLDG + D  GT+SGG
Sbjct: 642 TFHPQIRTRSITLDGDVYDPEGTLSGG 668

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1174

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1081 WKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1140

Query: 1330 AQFIVISLRNNMF 1342
            AQFIV+SL+  MF
Sbjct: 1141 AQFIVVSLKEGMF 1153

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 71/161 (44%), Gaps = 25/161 (15%)

Query: 659 GRLGDLGTIDDQYDIAISTA-----CP--RLDDIVVETVECGQQCID--HLRK------- 702
           G    L TI+D    AI +A     C   RL ++VV+      Q ++   LRK       
Sbjct: 529 GVAATLFTINDN---AIESASALQVCAGGRLYNVVVDNETTASQLLEKGRLRKRVTIIPL 585

Query: 703 NKLGYGRFILLDKLRKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQ 762
           NK+   R          N  +   P  V    +LI    +L R A   +   +L+ +D +
Sbjct: 586 NKIASRRL----NENTVNFAKQLAPGKVDLALNLIGYSDELSR-AMEFIFGTSLICKDSE 640

Query: 763 QANRVAYGKR-RFRVVTLDGKLIDISGTMSGGGSSPQSGLM 802
            A +V + +  R R +TL+G + D  GT+SGG  + ++ L+
Sbjct: 641 TAKKVTFHQNIRQRSITLEGDVYDPEGTLSGGSRNNKNSLL 681

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1216

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/200 (25%), Positives = 97/200 (48%), Gaps = 19/200 (9%)

Query: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182
           + I K+++  FK+Y     I  F   ++ ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSA-----GTMVVERRAFKNNSS 237
              LIH+     S+ S SV+I F+     D G + ILPS       + V  RR       
Sbjct: 61  RQGLIHQGS--GSVMSASVEIQFY-----DPGNSMILPSGVAVNPDSTVSIRRTVGLKKD 113

Query: 238 KYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLE 297
            Y +N +    +++ R+++  G  + +   ++ QG + ++   K K         L+ LE
Sbjct: 114 DYQINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDKER-------LQILE 166

Query: 298 DIIGTAKFKPQIEKCLEEIE 317
           D++G   F+ ++   L+++E
Sbjct: 167 DVVGAKSFEAKLTASLKKME 186

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1274 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1333
            +  LSGG+KT+ ++A++ A+    P P Y+ DEIDAALD +  + VA+ IK  + NAQFI
Sbjct: 1109 VEQLSGGQKTVCAIAMILAIQMVDPAPFYLFDEIDAALDKQYRTAVADVIKSLSSNAQFI 1168

Query: 1334 VISLRNNMFELAQNLVGI-YKN 1354
              + R +M ++A     + Y+N
Sbjct: 1169 CTTFRTDMLQVADKFFRVKYEN 1190

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 66/109 (60%), Gaps = 2/109 (1%)

Query: 1252 SLDPFSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1309
            S++    GV  SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDA
Sbjct: 1096 SVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDA 1155

Query: 1310 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMT 1358
            ALD +  + VA+ IKE ++NAQFI  + R++M E+A     +   N ++
Sbjct: 1156 ALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKFYRVKYENKIS 1204

 Score = 41.6 bits (96), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 113/473 (23%), Positives = 195/473 (41%), Gaps = 66/473 (13%)

Query: 659  GRLGDLGTIDDQYD-IAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILLDKLR 717
            G LG+L  ++D+Y   A       L  IVV+T E     I  L + K G   F+ L+++ 
Sbjct: 537  GTLGELIKVNDKYKKCAEVVGGNSLFHIVVDTDETASLIIQELYRMKGGRVTFLPLNRVY 596

Query: 718  KCNLDRIATPENVPRLFDLITPVR--DLFRPAFYSVLRDTLVARDLQQANRVAYGKRRFR 775
              + +    P        LI  +R    F  A   V   T+V RDL    R+A   +RFR
Sbjct: 597  -SDPNITYPPNEQASCTPLIKKIRYDARFEKAVKQVFGKTIVVRDLSTGARLA---KRFR 652

Query: 776  V--VTLDGKLIDISGTMSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLSTKETNYRS 833
            +  +TLDG   D  G ++GG                     D+ +K  + L  K  + RS
Sbjct: 653  LNAITLDGDRADKKGALTGG-------------------YHDQHKKTRLDLLKKLKDSRS 693

Query: 834  AL-SMVHEMESALQKLTDRLPEIDI---QISKIQLEKGSRVAEVESYHQRLSQLARELSM 889
               S+V E+E   QK+ D    ID        +  ++ + +  ++S+  +L+    E   
Sbjct: 694  QYKSLVSELELMRQKIQDIDASIDTVNGTTRSLSNKRETILTNMDSWRAKLNNKKTEKIF 753

Query: 890  NEKNQQPLLDE-----------EKKLDILRQHLQQTID--ASKFSQDKIDDLKDRIMQKG 936
             E++ Q L+ +           E+K+    + L Q  D   S+  Q ++++LK  I+   
Sbjct: 754  LEESMQALIVKAEKTETNIRVSEEKISTYLEELSQDFDNELSRAKQAELENLKSSILDIQ 813

Query: 937  GIELKMQIAKVASLEQHIEILHEXXXXXXX-XXXXLDIDLARATRE-----KNKYSEEVL 990
              +L M    +  L  +I+ L+             L   LA          K++    ++
Sbjct: 814  N-KLYMTSEALEGLTNNIDSLNATLNSKLIPQQKELKAKLAETGDSFIAGLKSEVQSMLI 872

Query: 991  VCNKDISILSEQLESIRLEKERIEEQVIENNERKAELNSSVEK-------LKQELLSIER 1043
            V     + L  QLE    E   I+E++   +ERK     S+EK       L ++L + ++
Sbjct: 873  VK----TTLDNQLEISNEELSGIQEEIKNMSERKKNSEKSLEKANSQQASLLKKLETFQK 928

Query: 1044 DSNEFKAKELEYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIRDVSKLLSQLN 1096
            D+ +   K+   + R E+   LQ+ +++     E +L S       +LL +LN
Sbjct: 929  DAEKSMVKKTTLAARREE---LQQKIREVGLLAEEALNSFNNLSSGELLQRLN 978

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 42/121 (34%), Positives = 71/121 (58%), Gaps = 2/121 (1%)

Query: 1251 DSLDPFSEGVLFSVMPPKKSWRN--ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1308
            DS++    GV  SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1092 DSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1151

Query: 1309 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDI 1368
            AALD +  + VAN IKE + +AQFI  + R++M ++A +   +  +N +++ + +   D 
Sbjct: 1152 AALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVADSFYRVRFDNKISEISAVSQQDA 1211

Query: 1369 L 1369
            +
Sbjct: 1212 I 1212

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
            YFR031C (REAL)
          Length = 1170

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1271 WRN-ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1329
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1330 AQFIVISLRNNMF 1342
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 73/157 (46%), Gaps = 15/157 (9%)

Query: 658 HGRLGDLGTIDD---QYDIAIST-ACPRLDDIVVETVECGQQCIDHLRKNKLGYGRFILL 713
           HG +G L  +D    +Y  A+ T A  RL ++VV+  +   Q ++  R  K      I L
Sbjct: 524 HGVVGQLFQLDYDNIRYSTALQTCAGGRLFNVVVQDSQTATQLLERGRLRK--RVTIIPL 581

Query: 714 DKL--RKCN-----LDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANR 766
           DK+  R  N     L +   P  V    +LI   + + + A   +  ++L+  D + A +
Sbjct: 582 DKIYARTINPQVLELAKTVAPGKVELAINLIKFDKTVTK-AMEFIFGNSLICEDPETAKK 640

Query: 767 VAY-GKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLM 802
           + +  K R R +TL G + D  GT+SGG  +    L+
Sbjct: 641 ITFHPKIRIRSITLQGDVYDPEGTLSGGSKNTSDSLL 677

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1229

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/73 (47%), Positives = 51/73 (69%)

Query: 1273 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1332
            ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAALD +  + VAN IKE + NAQF
Sbjct: 1119 HVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAALDKQYRTSVANTIKELSANAQF 1178

Query: 1333 IVISLRNNMFELA 1345
            I  + R++M  +A
Sbjct: 1179 ICTTFRSDMLRVA 1191

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 91/374 (24%), Positives = 163/374 (43%), Gaps = 53/374 (14%)

Query: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182
           + I ++ +  FK+Y     I  F    + V+G NGSGKSN   ++ FV     N +++ +
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKIL-----PSAGTMVVERRAFKNNSS 237
              LIH+     S+ S  V+I F      DN + ++L     PS+   VV RR       
Sbjct: 61  RQGLIHQGS--GSVMSAYVEIVF------DNSDGRLLNAAASPSSPDEVVIRRTIGLKKD 112

Query: 238 KYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLE 297
           +Y +N K  +  E+  LL+  G    +  +++ QG + ++   K       D   L+ L+
Sbjct: 113 EYSLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRIVALTNAK-------DYERLQLLK 165

Query: 298 DIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKH 357
           ++ G   F+ ++   L +++  N       NR + +D E + L+   +E  E  ++  K+
Sbjct: 166 EVTGANSFEKKLRDSLNKMDATN------RNR-KKIDSELRELDEKLQELNEEREELEKY 218

Query: 358 TILK--AQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTK 415
             L+   ++ Q  +YD  R+L    + I  L+ E+       E   +E +     I+N  
Sbjct: 219 NALERDRKVFQFTLYD--RELNDVTNHIEKLDSEYNNTVDSSEQYVQEMDKREVLISNVT 276

Query: 416 ------------KESTALETESKN---VNSKKRSLEKDFIATDEKLKSIARKLKAAEKAF 460
                       K+ST LE    N   V  KK  L       D K + + R++++  +  
Sbjct: 277 KNLVNIDAELKIKKSTDLEQSKANQLDVEEKKADL-------DVKCEELQRQIRSTSEQA 329

Query: 461 SQSESNGKAAVNEI 474
              ESN  + +N+I
Sbjct: 330 KTDESNLASVLNDI 343

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
           Ashbya gossypii AAL182W
          Length = 1232

 Score = 79.7 bits (195), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 53/196 (27%), Positives = 97/196 (49%), Gaps = 12/196 (6%)

Query: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182
           + I K++++ FK+Y    EI  F    + VVG NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVN 242
              LI++     S+ S  V+I F   HD +N     +P +   +  RR       +Y +N
Sbjct: 61  RRSLIYQGT--SSVMSGYVEIVF---HDAENRTLLGIPDSNGAIRIRRTVGLKKDEYMIN 115

Query: 243 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGT 302
            K S+ ++V RLL+  G    +   ++ QG + S+   K       D   L+ LE+++G 
Sbjct: 116 NKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAK-------DRERLQLLEEVVGA 168

Query: 303 AKFKPQIEKCLEEIET 318
             F+ ++++ L+ ++ 
Sbjct: 169 KSFERKLKESLQRMDA 184

 Score = 77.0 bits (188), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 63/122 (51%), Gaps = 2/122 (1%)

Query: 1251 DSLDPFSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEID 1308
            D+ D    GV   V     K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEID
Sbjct: 1093 DNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEID 1152

Query: 1309 AALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGIYKNNNMTKSTTLQNIDI 1368
            AALD +  + VA  IKE +  AQFI  + R++M  +A     +   N ++    +   D 
Sbjct: 1153 AALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKFYRVKYENKISTVVEVTRTDA 1212

Query: 1369 LH 1370
            LH
Sbjct: 1213 LH 1214

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 98/198 (49%), Gaps = 17/198 (8%)

Query: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182
           + I K+++  FK+Y    EI  F    + VVG NGSGKSN   ++ FV       +++ +
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSA--GTMVVERRAFKNNSSKYY 240
              LI++     S+ S  V+I FH        E + L  A  G ++  RR       +Y 
Sbjct: 61  RRSLIYQGT--SSVMSGYVEIVFH------GAENRTLLGAQDGGVIHIRRTVGLKKDEYM 112

Query: 241 VNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDII 300
           +N K ++ ++V RLL+  G    +   ++ QG + S+   + +         L+ LE++I
Sbjct: 113 INNKNASRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAQNRER-------LQLLEEVI 165

Query: 301 GTAKFKPQIEKCLEEIET 318
           G   F+ ++++ L+++ET
Sbjct: 166 GAKSFERKLKESLQKMET 183

 Score = 70.5 bits (171), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 3/91 (3%)

Query: 1273 NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQF 1332
            ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  +K+ +  AQF
Sbjct: 1122 HVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQF 1181

Query: 1333 IVISLRNNMFELAQNLVGIYKNNNMTKSTTL 1363
            I  + R +M  +A      Y+ N   K +T+
Sbjct: 1182 ICTTFRGDMIAVADRF---YRVNFENKISTV 1209

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 77.0 bits (188), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 43/105 (40%), Positives = 63/105 (60%), Gaps = 3/105 (2%)

Query: 1253 LDPFSEGVLFSV-MPPKKSWR-NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1310
            L+    GV  SV    KK+ +  +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1095 LESVYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1154

Query: 1311 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGI-YKN 1354
            LD +  + VAN IK+ +KNAQFI  + R +M  +A     + Y+N
Sbjct: 1155 LDKQYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRFYRVKYEN 1199

 Score = 72.0 bits (175), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 92/197 (46%), Gaps = 15/197 (7%)

Query: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182
           + I ++V+  FK+Y     I  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNG---ETKILPSAGTMVVERRAFKNNSSKY 239
              LIH+     S+ S SV+I F   HD D+     + ++P     V  RR        Y
Sbjct: 61  RQGLIHQGS--GSVMSASVEIVF---HDPDHRIILSSGVIPRPNDEVFVRRTVGLKKDDY 115

Query: 240 YVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDI 299
            +N +    +++ R+L+  G  +     ++ QG +  IA   AK     D   L  LED+
Sbjct: 116 QINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRI--IALTNAK-----DKERLLLLEDV 168

Query: 300 IGTAKFKPQIEKCLEEI 316
           IG   F+ ++   L+ +
Sbjct: 169 IGAKSFETKLRASLKNM 185

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 76.6 bits (187), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 65/110 (59%), Gaps = 3/110 (2%)

Query: 1248 ELVDSLDPFSEGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1305
            E++++ +    GV  SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1306 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGI-YKN 1354
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A     + Y+N
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRVKYEN 1201

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 94/201 (46%), Gaps = 19/201 (9%)

Query: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182
           + I ++V+  FK+Y     I  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSA------GTMVVERRAFKNNS 236
              LIH+     S+ S SV+I FH     D     ILPS          +  RR      
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFH-----DPEHKMILPSGVVPRENNDEICIRRTVGLKK 114

Query: 237 SKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYL 296
             Y +N +     +V R+L+  G  + +   ++ QG++ S+   K K         L+ L
Sbjct: 115 DDYQLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDKER-------LQLL 167

Query: 297 EDIIGTAKFKPQIEKCLEEIE 317
           ED++G   F+ +++  L+++E
Sbjct: 168 EDVVGAKSFEVKLKASLKKME 188

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 75.9 bits (185), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 3/105 (2%)

Query: 1253 LDPFSEGVLFSVMPPKKSWR--NISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1310
            ++P   GV  SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1311 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGI-YKN 1354
            LD +  + VA  I++ + NAQFI  + R +M E+A     + Y+N
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRVKYEN 1203

 Score = 75.5 bits (184), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 121/254 (47%), Gaps = 18/254 (7%)

Query: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182
           + I ++V+  FK+Y     I  F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVN 242
              LIH+     ++ S SV+I FH  +      + ++P     V  RR        Y +N
Sbjct: 61  RQGLIHQGSG-GAVMSASVEIVFHDPNHKIILPSGVVPRENDEVYIRRTVGLKKDDYQLN 119

Query: 243 GKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGT 302
            +     +V R+L+  G  +++   ++ QG++  IA   AK     D   L  LED++G 
Sbjct: 120 DRNVTKGDVVRMLESTGFSMNNPYNIVPQGKI--IALTNAK-----DKERLNLLEDVVGA 172

Query: 303 AKFKPQIEKCLEEIETL----NEVCMEKENRFELVDKEKQ-NLESGKEEALEFLDKERKH 357
             F+ +++  L++++      N++ ME     EL  K K+ N E  + E    LDK RK 
Sbjct: 173 KSFELKLKASLKKMDETEQKRNQIDMEMN---ELNSKLKEMNQERKELEKFNSLDKNRK- 228

Query: 358 TILKAQLLQRQIYD 371
            + +  L  R++ D
Sbjct: 229 -VFQFTLYDRELND 241

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 74.7 bits (182), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/82 (42%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1274 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1333
            +  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE +KNAQFI
Sbjct: 1122 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSKNAQFI 1181

Query: 1334 VISLRNNMFELAQNLVGI-YKN 1354
              + R +M ++A     + Y+N
Sbjct: 1182 CTTFRTDMLQVADKFFRVKYEN 1203

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 97/453 (21%), Positives = 191/453 (42%), Gaps = 76/453 (16%)

Query: 659  GRLGDLGTIDDQYDIAISTACPR------LDDIVVETVECGQQCIDHLRKNKLGYGRFIL 712
            G LG+L  ++D+Y      AC        L  +VV+T E     ++ L + K G   FI 
Sbjct: 538  GTLGELIKVNDKY-----KACAEVIGGNSLFHVVVDTEETATLIMNELYRMKGGRVTFIP 592

Query: 713  LDKLRKCNLDR-IATPENVPRLFDLITPVRDL-----FRPAFYSVLRDTLVARDLQQANR 766
            L++L   +LD  +  P N          ++ +     F  A   V   T+V +DL Q  +
Sbjct: 593  LNRL---SLDSDVKFPSNTTTQIQFTPLIKKIKYQPRFEKAVKHVFGRTIVVKDLGQGLK 649

Query: 767  VAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLMRSKATTASQYSRDEVEKMEVQLST 826
            +A  K +   +TLDG   D  G ++GG                 Q+ R  ++ ++  L+ 
Sbjct: 650  LA-KKHKLNAITLDGDRADKRGVLTGG--------------YLDQHKRTRLDSLK-NLNE 693

Query: 827  KETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARE 886
              + ++  +  +  + + L  +   + +++  I ++  E+ S +  +E Y          
Sbjct: 694  SRSQHKKIIDELEIVRNELNDIDAEIDQVNGSIRRVSNERESVLTNIEIYRT-------- 745

Query: 887  LSMNEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQ-IA 945
             S+N K  + L+ EE  L+ +   L++      F+Q+K+   ++ ++Q    EL ++   
Sbjct: 746  -SLNTKKNEKLILEES-LNAIVVKLEKLNTNLTFAQEKLKTYENDLLQNFDSELSIEEKR 803

Query: 946  KVASLEQHIEILHEXXXXXXXXXXXLDIDLARATRE------------KNKYSEEVLVCN 993
            K+ SL + I ++H            +  ++     E            + K SE   + +
Sbjct: 804  KLESLTKEIGVVHNKLNVTSEALEGITTNIDSLNAELDSKLIPQESDLQAKVSE---IGD 860

Query: 994  KDISILSEQLESIRLEKERIEEQVIENNERKAELNSSVEKLKQELLSIERDSNEFKAKEL 1053
              I  L ++L+ ++LEKE + +Q               E    EL +I+R+  +  A+E 
Sbjct: 861  AFILGLQDELKELQLEKESVGKQH--------------ENAILELSAIQREIEKLVAEET 906

Query: 1054 EYSDRLEKLHGLQEYVKKQLRSYETSLQSLKIR 1086
                 LEK +  Q  + K+L +++ S++   I+
Sbjct: 907  NNKKLLEKANNQQRLLLKKLDNFQKSVEKTMIK 939

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
           SMC3Subunit of the multiprotein cohesin complex required
           for sister chromatid cohesion in mitotic cells; also
           required, with Rec8p, for cohesion and recombination
           during meiosis; phylogenetically conserved SMC
           chromosomal ATPase family member
          Length = 1230

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 98/201 (48%), Gaps = 20/201 (9%)

Query: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182
           + I ++++  FK+Y     I  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTM------VVERRAFKNNS 236
              LIH+     S+ S SV+I FH     D   + ILPS G +      V  RR      
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFH-----DPDHSMILPS-GVLSRGDDEVTIRRTVGLKK 113

Query: 237 SKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYL 296
             Y +N +     ++ R+L+  G  +++   ++ QG++ ++   K K         L+ L
Sbjct: 114 DDYQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDKER-------LQLL 166

Query: 297 EDIIGTAKFKPQIEKCLEEIE 317
           ED++G   F+ +++  L+++E
Sbjct: 167 EDVVGAKSFEVKLKASLKKME 187

 Score = 73.2 bits (178), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 1/82 (1%)

Query: 1274 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1333
            +  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  +KE +KNAQFI
Sbjct: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLLKELSKNAQFI 1182

Query: 1334 VISLRNNMFELAQNLVGI-YKN 1354
              + R +M ++A     + Y+N
Sbjct: 1183 CTTFRTDMLQVADKFFRVKYEN 1204

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
           (REAL)
          Length = 1230

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 97/201 (48%), Gaps = 20/201 (9%)

Query: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182
           + I ++V+  FK+Y     I  F    + ++G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTM------VVERRAFKNNS 236
              LIH+     S+ S SV+I FH     D   + ILPS G +      V  RR      
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFH-----DPDHSMILPS-GVLSRGDDEVTIRRTVGLKK 113

Query: 237 SKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYL 296
             Y +N +     ++ R+L+  G  + +   ++ QG++ ++   K K         L+ L
Sbjct: 114 DDYQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDKER-------LQLL 166

Query: 297 EDIIGTAKFKPQIEKCLEEIE 317
           ED++G   F+ +++  L+++E
Sbjct: 167 EDVVGAKSFEVKLKASLKKME 187

 Score = 70.5 bits (171), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 1274 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1333
            +  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  + VA  IKE + +AQFI
Sbjct: 1123 VEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYRTAVATLIKELSNDAQFI 1182

Query: 1334 VISLRNNMFELAQNLVGI-YKN 1354
              + R +M ++A     + Y+N
Sbjct: 1183 CTTFRTDMLQVADKFFRVKYEN 1204

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa]
           {ON} similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074c SMC3 required for structural maintenance of
           chromosomes
          Length = 1219

 Score = 72.4 bits (176), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 117/250 (46%), Gaps = 9/250 (3%)

Query: 123 LCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182
           + I ++++  FK+Y     IG F    + V+G NGSGKSN   ++ FV     + +++ +
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVE-RRAFKNNSSKYYV 241
              LIH+     S+ S SV+I FH    +    T I  +  +  V  RR        Y V
Sbjct: 61  RQGLIHQGAG-ASVMSASVEIVFHDPEHSIIAPTGINSNGSSDEVRIRRTVGLKKDDYQV 119

Query: 242 NGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIG 301
           N +     ++ R+L+  G  + +   ++ QG + S+   K K         L+ LE+++G
Sbjct: 120 NDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDKER-------LQLLEEVVG 172

Query: 302 TAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILK 361
              F+ +++  +++++   +   +     E ++ +   +E  ++E  ++   ER   +L+
Sbjct: 173 AKSFEVKLKASMKQMDETEQKRAQISAEMEELESKLNEMEKERKELEKYNSLERDRKVLR 232

Query: 362 AQLLQRQIYD 371
             L  R++ D
Sbjct: 233 YTLHDRELQD 242

 Score = 72.0 bits (175), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 59/103 (57%), Gaps = 4/103 (3%)

Query: 1255 PFSEGVLFSVMPPKKS--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1312
            P+ EGV  SV    K      +  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDAALD
Sbjct: 1092 PY-EGVSISVSFNSKQDEQLKVEQLSGGQKTVCAIALILAIQMVEPAPFYLFDEIDAALD 1150

Query: 1313 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQNLVGI-YKN 1354
             +    VA  I + + NAQFI  + R++M + A     + Y+N
Sbjct: 1151 KQYRRAVAQTISQLSNNAQFICTTFRSDMVDAANKFYRVKYEN 1193

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 70.1 bits (170), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 73/139 (52%), Gaps = 4/139 (2%)

Query: 1210 CESFKNERLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKK 1269
             ++ K +++      F  +S    ++++ +   G  EL +      +S GV   V    K
Sbjct: 952  IDNLKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSK 1010

Query: 1270 S--WRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1327
            +     I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  +
Sbjct: 1011 NDEQLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLS 1070

Query: 1328 KNA-QFIVISLRNNMFELA 1345
            +N  QFI+ + R++M E+A
Sbjct: 1071 QNGTQFILTTFRSDMIEIA 1089

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 108/461 (23%), Positives = 198/461 (42%), Gaps = 68/461 (14%)

Query: 104 STRLELQKMHEANTQTSQRLCIDKLVLNNFKSYAGIQEIGPFH--TSFSAVVGPNGSGKS 161
           S RL+L K++  + Q      I K+ L NF +YA    +  FH   S + ++GPNGSGKS
Sbjct: 30  SKRLKLSKVNYTDFQPG---SIIKIRLKNFVTYA----LTEFHLSPSLNMIIGPNGSGKS 82

Query: 162 NVIDSMLFVFGFRANKM-RQGKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILP 220
             + ++      R   + R  ++ + I   E       C ++I     +    G   +L 
Sbjct: 83  TFVCAICLGLAGRPEYIGRSKRVEDFIKNGED-----ECEIEITLKN-NSKIQGIANVLS 136

Query: 221 SAGTMVVERRAFKN-NSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQ 279
           S   + + R   ++   S Y++N + ++   V  ++ +  I LD+    + Q  VE  A+
Sbjct: 137 SDDVIKITRVLIRHRKKSDYFINDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFAR 196

Query: 280 MKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLN--EVCMEKE-----NRFEL 332
           +K+      D  L E +  I         +   LEE++ L   E+  EKE      R + 
Sbjct: 197 LKS------DKLLFETIRSI------DTDLITVLEELKELQGEELAEEKEVSFKQQRLQE 244

Query: 333 VDKEKQNLESGKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLATS--CDKISALNME- 389
           +  EK+ LE+      EF  K+ +  I K  L   +I D   K+  S  C + +  N++ 
Sbjct: 245 LTAEKERLETSVRVLEEFQRKKDQLEIHKKLLPYVKIKDHKEKIRASKKCYEDAKRNLKA 304

Query: 390 FQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLE------KDFIATD 443
             ++K  + H +++ E  T +         ALE++    N+K+R         K    + 
Sbjct: 305 LLQDKKPFSHAKRQLERATED---------ALESK----NNKEREYRENQVKFKSIPVSL 351

Query: 444 EKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNH-------SIS 496
           EK++   +K  A    +    +  K  + E+ES  +N  +   +L+ L         SI 
Sbjct: 352 EKIREEIQKNSAQINYYRGRSAKLKQGIEELESQLENQRE---DLNGLKEPEQGEFDSID 408

Query: 497 IEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEK 537
            E+ KL++      E+ +DL    + ++ ++   + Q+Q K
Sbjct: 409 TERTKLSDELQGYTEQYRDLKTSADDIDYRMRNVQHQVQTK 449

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1334
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 994  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRNERIVHKAMVENACAENTSQYFL 1053

Query: 1335 ISLRNNMFELAQNLVGIYKNNNM 1357
            I+         + L G+Y +  M
Sbjct: 1054 IT--------PKLLTGLYYHEKM 1068

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 96/453 (21%), Positives = 193/453 (42%), Gaps = 61/453 (13%)

Query: 112 MHEANTQTSQRL-------------CIDKLVLNNFKSYAGIQEIGPFH--TSFSAVVGPN 156
           ++E   Q+S+RL              I KL L NF +Y+    +  FH   S + ++GPN
Sbjct: 43  LNEIEMQSSKRLKFGKEDLSQFQPGSIVKLRLENFVTYS----LTEFHLSPSLNMIIGPN 98

Query: 157 GSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGET 216
           GSGKS  + ++      +   + +GK  +   K+ +   L   +++         D G T
Sbjct: 99  GSGKSTFVCAVCLGLAGKPEYIGRGKRVDSFIKNGENRGLIEVTLK--------RDPGRT 150

Query: 217 -KILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVE 275
              +   GT  V R  +    S+YY+N +  +   V  L+ E  I LD+    + Q  VE
Sbjct: 151 GSFVAVDGTTKVSRVLWVGKKSEYYLNDEPVSELTVKNLMGELNIQLDNLCQFLSQERVE 210

Query: 276 SIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDK 335
             A++K+      D  L+E +  +         + +  + ++TL E  + +    EL   
Sbjct: 211 EFARLKS------DKLLMETVRSV------NVNLLESFKNLKTLQEEQITEAKELELKTS 258

Query: 336 EKQNLESGKE------EALEFLDKERKHTILKAQLLQR-QIYDSNRKLATSCDKISALNM 388
           + ++L   ++      +ALE   ++++   +  +LL   +I D  RK A    K      
Sbjct: 259 KLRDLNETRDKLVSSVQALEAFKRKKQELDINEKLLPYVKIKDHKRKCAQYKKK------ 312

Query: 389 EFQEEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKS 448
            +QE + Q + L  + E +         E+   +     + +K + L+ +F    +K + 
Sbjct: 313 -YQEARDQLKALITDKEPMRQAQQAIDAEAAEKQDIKSGLETKFQHLQSEFKVYPKKQQE 371

Query: 449 IARKLKAAE---KAFSQSESNGKAAVNEIESLKKNHDDCEIEL----HNLNHSISIEKEK 501
           +  K++  +   K + Q     K A++ I+    N  +    L    +NL   I  E+++
Sbjct: 372 LEEKVREKQGKIKYYEQRTFKVKEAISGIKEQLSNERNKLTTLPAPDNNLFDEIDTERKR 431

Query: 502 LNEIKIHLHEKTKDLSQEMESLERQLEPFRDQI 534
           ++   + L ++ +DL+    +L R ++ ++  +
Sbjct: 432 VSIQNLELEQEVRDLNTRSYNLGRNIQNWKGNL 464

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 56/113 (49%), Gaps = 4/113 (3%)

Query: 1228 ISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNL-SGGEKTLSS 1286
            IS+    ++Q +  GG+  LE  +    +   ++          +  S + SGGE+ +S+
Sbjct: 961  ISINFSRLFQNVGSGGSVVLEKNELFSNWKINIMVRFRDSALMKKLDSQIQSGGERAVST 1020

Query: 1287 LALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIVIS 1336
            +  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I+++
Sbjct: 1021 VLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYILVT 1073

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 53.1 bits (126), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 79/162 (48%), Gaps = 16/162 (9%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTS--FSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQG 181
           I  L L NF +YA    +  FH S   + ++GPNGSGKS  + ++      +   + R  
Sbjct: 47  IVTLRLENFVTYA----LTEFHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRST 102

Query: 182 KLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKN-NSSKYY 240
           K+ + I   E   S+   +++       D +  E + + S GT  V R   +N  +S+Y+
Sbjct: 103 KIEDYIKNGED-RSVIEVTLK------RDPE-AEDRYVASDGTTKVTRVLHRNRKASEYF 154

Query: 241 VNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKA 282
           +NG+    + V RL+ E  I LD+    + Q  VE  A++K+
Sbjct: 155 LNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLKS 196

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1334
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1335 IS 1336
            ++
Sbjct: 1049 VT 1050

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 45/85 (52%), Gaps = 3/85 (3%)

Query: 1255 PFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1314
            P  + +++++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1315 NVSIVANYIKERTKN---AQFIVIS 1336
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

 Score = 33.5 bits (75), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 181
           I K+ L NF  +   +  +GP     + +VG NGSGKS ++ ++    G +A+   +G
Sbjct: 74  IKKVSLRNFMCHENFELALGP---RLNFIVGNNGSGKSAILTAITIGLGAKASDTNRG 128

>KNAG0D04340 Chr4 complement(786487..793149) [6663 bp, 2220 aa] {ON}
            Anc_4.238 YDL058W
          Length = 2220

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 102/399 (25%), Positives = 185/399 (46%), Gaps = 57/399 (14%)

Query: 309  IEKCLEEI-ETLNEVCMEKENRFELVDKEKQ-NLESGKEEALEFLD--------KERKHT 358
            I++ LE+I E L ++  EKE R +L+ KE   NLE+ K+  LE LD        K ++ T
Sbjct: 769  IDEQLEDITEKLEQMTKEKE-RLDLLQKEMVVNLET-KDSHLEELDESTKALNDKLKQMT 826

Query: 359  ILKAQL------LQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEIN 412
            ++K +       + R+++  NR   T  +KI     + +++  + E   KE +TL   I+
Sbjct: 827  VMKEKAEEGINKMSRELFALNRNNQTLDEKIK---QQAKDQAKENEKRLKEIKTLNDTIS 883

Query: 413  NTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVN 472
            +   E++ L  + K + ++K+ LE      DE+  +I ++L   +  F   +S       
Sbjct: 884  SKNSENSKLNNKIKELETQKKFLE------DERT-TILKELAEWKSKFQSHDSLVPKLTE 936

Query: 473  EIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRD 532
            +++SL  N+ D EIE  N+   ++ E+ K      HL E   DL++++ESLER      +
Sbjct: 937  KLKSLANNYKDLEIENTNIKTRLNEEQSK------HLSE-VSDLNEKIESLERTEISLTE 989

Query: 533  QIQEKQSEIKLSETKITMLKSSHSN----LLKEKATIESKIEDXXXXXXXXXXXXXXXRN 588
            + ++ ++++   E +I   K  H      L  EK  +E +IE                R 
Sbjct: 990  EKKDLETKLSSLEHEINSFKGDHDTKIEQLCTEKDGLEQQIEQLTNSLKKSDEEKENARL 1049

Query: 589  EKSKVEARISTAQKECEEAQKQTNEM-RDVLIQQRQIVE---EAKANLNGFQNKNRVLLA 644
              + +  R+   +KE EE +    E+ ++   +  QI E   +A+ ++   +N    L +
Sbjct: 1050 AVTDLTTRLDGMKKEYEEREVTFEELEKNAQTEAAQISEKLKKAEEDVAALENTKAKLFS 1109

Query: 645  LTKLQ-------------NSGRITGFHGRLGDL-GTIDD 669
              KLQ             + G I   +GR+ D  GTI++
Sbjct: 1110 EIKLQENAIEKSKETITGHEGTIEQLNGRIADYEGTIEE 1148

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 65/251 (25%), Positives = 115/251 (45%), Gaps = 40/251 (15%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLS 184
           + +L L+NF +Y+ + E   F  S + VVGPNGSGKS ++ ++      R   +  G++ 
Sbjct: 57  VVRLRLHNFVTYS-LAEF-EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYL--GRMK 112

Query: 185 ELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNN--SSKYYVN 242
               +S+ F    + S +I   ++   D G         T+ V R   +N+  +S YYV+
Sbjct: 113 ----RSDSFIKNGADSARIDV-WLAGEDPG--------TTLKVSRVLTRNHKKASLYYVD 159

Query: 243 GKESNYTEVTRLLK-EEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIG 301
           G E++   V +L+  +  I LD+    + Q  V+  A+++        D LL  LE +  
Sbjct: 160 GVETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRP-------DKLL--LETVRA 210

Query: 302 TAKFKPQIEKCLEEIETLN--EVCMEKENRFE-----LVDKEKQNLESGKEEALEFLDKE 354
             +   Q+  C  ++  L    + ++KE + E        + +Q+ E G   AL   +  
Sbjct: 211 CDR---QLLDCWTQLAQLQREHISLDKEVQLERETSRTSPRSRQDSE-GAVSALRTYENT 266

Query: 355 RKHTILKAQLL 365
           RK  +   QLL
Sbjct: 267 RKQIMTHNQLL 277

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 70/166 (42%), Gaps = 46/166 (27%)

Query: 1176 IEVLEEYARRLAEYQRR------KLDLNQAVAKREEVRNKCESFKNERLEKFMEGF---- 1225
            I +L+E  R+LA+ + R      KLD   A A    ++ + E   +  +EK  E F    
Sbjct: 903  IAILQEVERKLADVKARLPAMVRKLDA--ATASMSTMQAELEPRLDTIVEKISERFTNLF 960

Query: 1226 ------GIISMTLKEMYQ------MITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRN 1273
                  G I ++   +YQ      M+    NA L+ +DS                     
Sbjct: 961  TNVGSAGAIQLSKPHLYQEWEMKIMVKFRDNAPLKRLDS--------------------- 999

Query: 1274 ISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1319
                SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 1000 -HTQSGGERAVSTVLYIIALQEFTSAPFRVVDEINQGMDQRNERIV 1044

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] {ON}
            similar to uniprot|Q08204 YOL034W Saccharomyces
            cerevisiae YOL034W SMC5 Structural maintenance of
            chromosomes (SMC) protein, interacts with Rhc18p and
            Nse1p to form a large complex
          Length = 1119

 Score = 46.6 bits (109), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 81/190 (42%), Gaps = 35/190 (18%)

Query: 1167 DYLDNFNGDIEVLEEYARRLAEYQRRKLDLN-QAVAKREEVRNKCESFKNERLEKFMEGF 1225
            D L   N DI +LE+    L    R KL  N Q +    E+RN  E     RL+  ++  
Sbjct: 915  DILKKTNEDISILEKTLPHL----RAKLASNAQTIL---EIRNSLEP----RLDDIVKQ- 962

Query: 1226 GIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNL-------- 1277
              IS     ++  +   G  EL+  DS + +        +  K  +R+ S L        
Sbjct: 963  --ISKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSELQQLNPHVQ 1013

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI-----VANYIKERTKNAQF 1332
            SGGE+ +S++  + AL ++  +P  V+DEI+  +D  N  I     V N   E T     
Sbjct: 1014 SGGERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENACAENTSQYFL 1073

Query: 1333 IVISLRNNMF 1342
            I   L  N+F
Sbjct: 1074 ITPKLLTNLF 1083

 Score = 39.7 bits (91), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 136/306 (44%), Gaps = 39/306 (12%)

Query: 127 KLVLNNFKSYAGIQEIGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKL 183
           KL L NF +YA    +  FH   S + ++GPNGSGKS  + ++      +   + R  K+
Sbjct: 62  KLKLTNFVTYA----LTEFHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRSKKV 117

Query: 184 SELIHKSEQFP----SLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKY 239
            E I           +L + S  +H  +  +  N +  ++     + +E++      SKY
Sbjct: 118 EEYIKNGTDEGVIEITLKNSSALLHSDF--NMINTDDDVVHVKRVLSMEKK-----KSKY 170

Query: 240 YVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDI 299
           Y+N K      V  +++   I LD+    + Q  VE  A++K       D  L E +  I
Sbjct: 171 YINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKP------DTLLNETIRSI 224

Query: 300 IGTAKFKPQIEKCLEEIETL----NEVCME---KENRFELVDKEKQNLESGKEEALEFLD 352
                    +EK L E+++L    NE+ ++   KEN+ + +   +  LES +  ALE  +
Sbjct: 225 EAGL-----LEK-LSELKSLQAEGNELQIDLGAKENKLKELTSSRAALES-QAHALELYE 277

Query: 353 KERKHTILKAQLLQRQIYDSNR-KLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEI 411
           ++ +   +  +LL       ++ K+    DK +AL  E +  +++ +        LT + 
Sbjct: 278 EKARELDIHQKLLNYTYLKEHKEKIRGLKDKRNALRNEVKTMENESKPFNLLGVRLTADE 337

Query: 412 NNTKKE 417
           NN K +
Sbjct: 338 NNCKSD 343

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 45.8 bits (107), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1261 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1320
            +F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I  
Sbjct: 996  IFILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGT 1055

Query: 1321 NYIKERTKN---AQFIVIS 1336
              I  + K+    Q I+I+
Sbjct: 1056 KLILNKLKDIARTQTIIIT 1074

 Score = 40.0 bits (92), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 14/118 (11%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK- 182
           I K+VL NF  +   + E+GP     + +VG NGSGKS ++ ++    G RA    +G  
Sbjct: 75  IKKVVLWNFMCHEHFELELGP---RLNFIVGNNGSGKSAILTAITVGLGARAMDTNRGNS 131

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYY 240
           L +LI +        S  +++H     D  N       + G  ++  R  KN+ +  +
Sbjct: 132 LKDLIRE-----GCHSTKIRLHL----DNLNHGAYYQGTFGNEIIIERVIKNDGTSSF 180

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 71/322 (22%), Positives = 137/322 (42%), Gaps = 31/322 (9%)

Query: 124 CIDKLVLNNFKSYAGIQEIGPFHTS--FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 181
            I  + L NF +Y+    +  FH S   + ++GPNGSGKS  + ++      +   + + 
Sbjct: 45  AIVSIRLTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRA 100

Query: 182 KLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSK--- 238
           K  E   K+      A  +++I    + ++ N     + SA    +  R     + +   
Sbjct: 101 KRVEDFIKN----GTAESTIEIQ---LRNSRNVSGLPMISAEDEAINVRTVLMKARRKCA 153

Query: 239 YYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKA-----KAEKDNDDGLL 293
           YY+NG+  +  ++  L+    I LD+    + Q  VE  A++KA     +  +  D  LL
Sbjct: 154 YYINGEPVSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLKADKLLEQTVRSVDASLL 213

Query: 294 EYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDK 353
             LE          Q++   +E  +LN      + + E +   K++LE+      E+  K
Sbjct: 214 GLLE----------QLKTSQQEELSLNREVELGQKKLEKLMTHKESLENQVRALEEYERK 263

Query: 354 ERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINN 413
           + +  I K  L   ++ +  R+L     +   +  E +E     +  +  +  L  E+ N
Sbjct: 264 KEEIDIHKRLLPYVRVKNHKRQLKDLKSEYERVKQELKEFLKDKKPFKIASNALLSEVEN 323

Query: 414 TKKESTALETESKNVNSKKRSL 435
           ++++    E+E   V S +RSL
Sbjct: 324 SQRQKQGKESEYIQVKSTQRSL 345

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1334
            SGGE+ +S++  + AL  +   P  V+DEI+  +D R   IV   + E       +Q+ +
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENTSQYFL 1051

Query: 1335 IS 1336
            I+
Sbjct: 1052 IT 1053

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/151 (27%), Positives = 77/151 (50%), Gaps = 24/151 (15%)

Query: 1200 VAKREEVRNKCESFKNE---RLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPF 1256
            V +   +R K  S ++E   RL++ +E    IS   ++++  + +G   E+ LV   D +
Sbjct: 913  VKRLSSIRRKMWSIRSELEPRLDEIVEN---ISTRFRKLF--LNVGSAGEVCLVKP-DLY 966

Query: 1257 SEGVLFSVMPPKKSWRNISNL--------SGGEKTLSSLALVFALHKYKPTPLYVMDEID 1308
            SE  +      K  +R+++ L        SGGE+ +S++  + +L ++   P  V+DEI+
Sbjct: 967  SEWKI----EIKVKFRDVAELKKLDSHIQSGGERAVSTVLYMISLQEFTNAPFRVVDEIN 1022

Query: 1309 AALDFRNVSIVANYIKER--TKN-AQFIVIS 1336
              +D RN  IV   + E    KN +Q+ +I+
Sbjct: 1023 QGMDARNERIVHKAMVENACAKNTSQYFLIT 1053

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 75/164 (45%), Gaps = 10/164 (6%)

Query: 121 QRLCIDKLVLNNFKSYAGIQEIGPFH--TSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM 178
           Q   I KL L NF +Y+    +  FH   S + ++GPNGSGKS+ + ++      +   +
Sbjct: 42  QEGAIIKLRLVNFVTYS----LTEFHLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYI 97

Query: 179 RQGKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSK 238
            + K  E   K+    S+   +V+        +  G +  + +  T++++ +        
Sbjct: 98  GRAKKVEDFIKNGTEESVIELTVKNSKAVSGYSMIGGSDEVINIKTVIMKAK----KKCI 153

Query: 239 YYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKA 282
           YY+NG+     +V  L+    I LD+    + Q  VE  A++K+
Sbjct: 154 YYINGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLKS 197

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034w SMC5
          Length = 1105

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 107/468 (22%), Positives = 193/468 (41%), Gaps = 71/468 (15%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKL 183
           I K+ L NF +Y   +  + P   S + ++GPNGSGKS  + ++      +   + + K 
Sbjct: 38  IVKIRLENFVTYNYTEFNLSP---SLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQ 94

Query: 184 SELIHKSEQF-----------PSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAF 232
            E   K+ Q            P++    +   FH + +  NG  K L +    + +R   
Sbjct: 95  VEDFIKNGQDTSKIEIVLKDDPNIDIEFLGSSFHRIRN--NGNYKGLLTITRNLEKRTKI 152

Query: 233 KNNSSK-----YYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKD 287
             N  K     Y +NG  +  + V  L+ +  I LD+    + Q  VE  A  K + EK 
Sbjct: 153 GRNLEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFA--KLRPEKL 210

Query: 288 NDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQ-----NLES 342
            D+ +     +++   +   +++  L+EIE  NE+    ++  +L   E+       L +
Sbjct: 211 LDETIRAIDSELLSMFEVLKKLQ--LQEIEMSNEIQTNTDSLKKLKTDEENFQQEVQLLN 268

Query: 343 GKEEALEFLDKERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQK 402
             +E L+ LDK +K       L   +I D   KL T   ++     + QE        QK
Sbjct: 269 EYQETLDTLDKHKK------LLPYLKIQDHREKLLTYKRQVEGAKKQLQE-------FQK 315

Query: 403 EAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQ 462
           E E     + +  +    L  E +N+  KK       ++T  KL+    KL A  +   +
Sbjct: 316 EREPYMQVLASLNESDAQLNIEKENIEEKK-------VSTKRKLEKTVSKLNALREEIEK 368

Query: 463 SESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMES 522
                     +IE  K   +  +I+       I  +KE ++ IK     K  D+    ES
Sbjct: 369 KNL-------QIEYYKGRSNKLKIK-------IETKKEDIDNIK----RKISDIETPEES 410

Query: 523 LERQLEPFRDQIQEKQSEI--KLSETKITMLKSSHSNLLKEKATIESK 568
              +LE  R+ + E++S++  ++ E    M   +H+  + E+  ++ K
Sbjct: 411 EVTELERKRNDLIERESQVNSEIDEVDTQMSTQNHNLAILERKMVDKK 458

 Score = 40.4 bits (93), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 67/148 (45%), Gaps = 28/148 (18%)

Query: 1209 KCESFKNE----------RLEKFMEGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSE 1258
            KC + + E          RLE  + G G       E+++ +   G   L     L  FS+
Sbjct: 922  KCNTIRKEMSDKQKVLEPRLESIVSGIG---RKFSELFKDVGTAGGVTLNRKSKL--FSD 976

Query: 1259 GVLFSVMPPKKSWRNISNL-----SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD- 1312
              L  +M   +    +S L     SGGE+ +S++  + AL K+   P  V+DEI+  +D 
Sbjct: 977  WKL-EIMVQFRDEGKLSGLDSHTQSGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDT 1035

Query: 1313 -FRNV---SIVANYIKERTKNAQFIVIS 1336
             F  +   ++V N  +E T  +Q+ +I+
Sbjct: 1036 NFERLVHKAMVQNACEEGT--SQYFLIT 1061

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 83/186 (44%), Gaps = 8/186 (4%)

Query: 98  RLSPKKSTRLELQKMHEANTQTSQRLCIDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPN 156
           R    +  R +  K+  A+  + Q  CI K+ L +F +Y   +  + P   S + ++GPN
Sbjct: 15  RFGEDRGPRSKRVKIAGADLSSFQPGCITKIRLQDFVTYTLTEFNLSP---SLNMIIGPN 71

Query: 157 GSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGET 216
           GSGKS  + ++      +   + + K  E   K+ Q  S    +++ +   VHD +N   
Sbjct: 72  GSGKSTFVCAVCLGLAGKPEYIGRSKKVEDFIKNGQDVSRIEITLK-NSPKVHDIENINA 130

Query: 217 KILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVES 276
                  T ++ R   +   S Y +N  + +   V  L+ +  I LD+    + Q  VE 
Sbjct: 131 HDETIKITRIITRSKRR---SDYLINDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEE 187

Query: 277 IAQMKA 282
            A++K+
Sbjct: 188 FARLKS 193

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 11/83 (13%)

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1334
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1335 ISLRNNMFELAQNLVGIYKNNNM 1357
            I+         + L G+Y +  M
Sbjct: 1047 IT--------PKLLTGLYYHEKM 1061

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 78/181 (43%), Gaps = 23/181 (12%)

Query: 125 IDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKL 183
           I KL L N  +Y+ I E      S + +VGPNGSGKS  + ++      +   + R  K+
Sbjct: 37  IVKLRLQNVMTYS-ITEFN-LSPSLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSKKI 94

Query: 184 SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNG 243
              I   E        + QI         N   KI     T ++ R   K   S+YY++ 
Sbjct: 95  DNFIKNGEN-------TAQIDTFLRGHMPNEVIKI-----TRIMTRNKKK---SEYYIDD 139

Query: 244 KESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKA-----KAEKDNDDGLLEYLED 298
             S  T V +L  E  I LD+    + Q  VE  A++K+     +  +  +  LLE LED
Sbjct: 140 SPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLKSDKLLIETIRSINPSLLETLED 199

Query: 299 I 299
           +
Sbjct: 200 L 200

 Score = 40.4 bits (93), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1334
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1335 IS 1336
            I+
Sbjct: 1035 IT 1036

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1089

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 104/451 (23%), Positives = 201/451 (44%), Gaps = 55/451 (12%)

Query: 98  RLSPKKSTRLELQKMHEANTQTSQRLCIDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPN 156
           ++S  K  R  L K+   +T+  Q   I K+ L NF +Y+  +  + P   S + ++GPN
Sbjct: 18  QISTSKPARKRL-KITAIDTEQFQPGSIIKIKLWNFVTYSLAEFTLSP---SLNMIIGPN 73

Query: 157 GSGKSNVIDSMLFVFGFRANKM-RQGKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGE 215
           GSGKS  + ++      +   + R  KL + I   E         V++    V ++D   
Sbjct: 74  GSGKSTFVCAVCLGLAGKPEYIGRSSKLEDYIKNGED-----QSVVEVTLKNVPESDFNT 128

Query: 216 TKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVE 275
             IL       + R   K    +Y +NG     T +   +K+  I LD+    + Q  VE
Sbjct: 129 DTILIKT---TINRGKKK---PEYAINGSTVTETYIRAFVKKLNIQLDNLCQFLSQERVE 182

Query: 276 SIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETL--NEVCMEKENRFELV 333
             A++K+       D LLE     I ++         LE+++TL   E+ ++K+   +L 
Sbjct: 183 EFARLKS-------DKLLEETIRSIDSSML-----TSLEKLKTLQTTEISLQKD--VDLK 228

Query: 334 DKEKQNLESGKEE---ALEFLDKERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEF 390
           +K+ Q L + +E+   A++ L KE +H  LK ++   Q+     K+     K+ +   +F
Sbjct: 229 NKKLQELTAQREKLEGAVKAL-KEYEH--LKKEIEIHQLLLPYVKIKDHKSKVQSYIRDF 285

Query: 391 QEEKSQYEHLQKEAETLTHEINNTKKE-----------STALETESKNVNSKKRSLEK-- 437
           +E K + +   ++ +      N+ +K+           +++L  E K +NS    L K  
Sbjct: 286 REAKQKLKSFLQDKKPFIKAKNSLEKKQAKYQALKQDTNSSLINERKKLNSILNDLGKGK 345

Query: 438 -DFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSIS 496
            + I   ++++    + K  +++   +E   +  +  +E+L+        E+ N  +++ 
Sbjct: 346 EEIIKRKKQIEYYENRTKKLQESIRSTEKEKEDKIASLETLQLPDQQTLDEITNERNTL- 404

Query: 497 IEKEKLNEIKIH-LHEKTKDLSQEMESLERQ 526
           IEKE     KI  +  +   ++ EM +L+RQ
Sbjct: 405 IEKESNITTKIRSIDSRVATINHEMMTLDRQ 435

 Score = 40.0 bits (92), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 27/42 (64%)

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1319
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERII 1025

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1261 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1320
            +F +    +  RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I  
Sbjct: 981  MFVLTANDEKPRNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGT 1040

Query: 1321 NYIKERTKN---AQFIVIS 1336
              + ++ K+    Q I+I+
Sbjct: 1041 TLVVKKLKDLARTQTIIIT 1059

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 1261 LFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1320
            +  + P    +R +S  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +
Sbjct: 1004 ILILTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGS 1063

Query: 1321 NYIKERTK---NAQFIVIS 1336
              I ++ K   N Q I+I+
Sbjct: 1064 KLIVKKLKDIPNTQTIIIT 1082

 Score = 39.7 bits (91), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 66/134 (49%), Gaps = 21/134 (15%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 182
           I KL L+NF  +     E+GP     + +VG NGSGKS ++ ++    G +A++  +G  
Sbjct: 80  IKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGSS 136

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPS----AGTMVVERRAFKNNSSK 238
           L +LI         A C+      Y+  +++G    +P       T+++ER   + +++ 
Sbjct: 137 LKDLI--------TAGCNSSRITIYL--SNSGIGAYVPKGKQYGDTIIIERTISRTSTAG 186

Query: 239 YYVNGKESNYTEVT 252
           + +  K  N TE++
Sbjct: 187 FSL--KSENGTEIS 198

>CAGL0D00924g Chr4 (108341..114283) [5943 bp, 1980 aa] {ON} similar to
            uniprot|P25386 Saccharomyces cerevisiae YDL058w USO1
            intracellular protein transport protein
          Length = 1980

 Score = 42.4 bits (98), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 89/193 (46%), Gaps = 21/193 (10%)

Query: 376  LATSCDKISALNMEFQEEKSQYEHLQKEAETLTHE----INNTKKESTALETESKNVNSK 431
            +A   +K+ AL   F+E +++ + ++ E E +T E    I     E  +LE   KN+ S+
Sbjct: 924  VAKLTEKLKALATSFKELQAERDTIKSELEKITQERDTNIAAITSEKKSLEELYKNMESE 983

Query: 432  KRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNL 491
            K  L K     +  ++S  +K +  + A    ES  K    EI   K N +  + E   L
Sbjct: 984  KDGLLKKITELETGIESDNKKFEDEKSAL---ESETKRLTLEIAEFKSNAEKLDTERERL 1040

Query: 492  NHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITML 551
                   KEKLNE    + EK KDL+             + QI+  QSEI   + +IT L
Sbjct: 1041 QTLTESYKEKLNEANSSIDEKNKDLNN-----------IQQQIEGSQSEISTLKAEITQL 1089

Query: 552  KSSHSNLLKEKAT 564
            K+S   L +EK+T
Sbjct: 1090 KTS---LNEEKST 1099

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 42.4 bits (98), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1272 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1329
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1330 -AQFIVIS 1336
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK- 182
           I K+ L NF  +   + E GP     + +VG NGSGKS V+ ++    G +A+   +G  
Sbjct: 85  IKKIKLRNFMCHENFEMEFGP---RLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRGNS 141

Query: 183 LSELI 187
           L +LI
Sbjct: 142 LKDLI 146

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1272 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1329
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1330 -AQFIVIS 1336
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 182
           I K++L NF  +   + E+G   +  + +VG NGSGKS ++ ++    G +A++  +G  
Sbjct: 88  IKKVILRNFMCHEHFELELG---SRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 144

Query: 183 LSELIH 188
           L +LI 
Sbjct: 145 LKDLIR 150

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1272 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1329
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1330 -AQFIVIS 1336
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 5/65 (7%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 182
           I K++L NF  +   + E+G   +  + +VG NGSGKS ++ ++    G +A++  +G  
Sbjct: 82  IKKVILRNFMCHEHFELELG---SRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 183 LSELI 187
           L +LI
Sbjct: 139 LKDLI 143

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1272 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1329
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1330 -AQFIVIS 1336
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 63/126 (50%), Gaps = 16/126 (12%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 182
           I K++L NF  +   + E+G   +  + +VG NGSGKS ++ ++    G +A++  +G  
Sbjct: 82  IKKVILRNFMCHEHFELELG---SRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 138

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYV- 241
           L +LI +          S +I  H + +++ G  +       ++VER   ++  + + + 
Sbjct: 139 LKDLIRE-------GCYSAKITLH-LDNSNYGAYQQGTFGNEIIVERIIKRDGPASFSLK 190

Query: 242 --NGKE 245
             NG+E
Sbjct: 191 SENGRE 196

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1272 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1329
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1330 -AQFIVIS 1336
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

 Score = 35.8 bits (81), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 62/126 (49%), Gaps = 16/126 (12%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 182
           I K++L NF  +   + E+G   +  + +VG NGSGKS ++ ++    G +A++  +G  
Sbjct: 83  IKKVILRNFMCHEHFELELG---SRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSS 139

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYV- 241
           L +LI +          S +I  H + ++  G  +       ++VER   ++  + + + 
Sbjct: 140 LKDLIRE-------GCYSAKITLH-LDNSKYGAYQQGTFGNEIIVERTIKRDGPASFSLK 191

Query: 242 --NGKE 245
             NGKE
Sbjct: 192 SENGKE 197

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1272 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1329
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 1008 RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLL 1067

Query: 1330 -AQFIVIS 1336
              Q I+I+
Sbjct: 1068 RTQTIIIT 1075

 Score = 36.2 bits (82), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 181
           I K++L NF  +   + ++GP     + +VG NGSGKS V+ ++    G +A+   +G
Sbjct: 76  IKKVILRNFMCHEHFELDLGP---RLNFIVGNNGSGKSAVLTAITIGLGAKASDTNRG 130

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1272 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1329
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1330 -AQFIVIS 1336
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]
           {ON} Anc_4.237 YLR383W
          Length = 1102

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 61/124 (49%), Gaps = 13/124 (10%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 182
           + K++L NF  +   + E+GP     + +VG NGSGKS ++ ++    G +A++  +G  
Sbjct: 72  LKKVILRNFMCHENFEMELGP---RLNFIVGNNGSGKSAILTAIAVGLGVKASETNRGVS 128

Query: 183 LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVN 242
           L +LI +        S S +I   Y+ ++  G  K      T+++ER   ++    + + 
Sbjct: 129 LKDLIRE-------GSYSAKITL-YLDNSRIGSYKSDVYGDTIIIERTLKRDGPPSFSLK 180

Query: 243 GKES 246
            KE 
Sbjct: 181 TKEG 184

 Score = 37.0 bits (84), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1272 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1329
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1330 -AQFIVIS 1336
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
           complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 117/268 (43%), Gaps = 44/268 (16%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKL 183
           I K+ + NF +Y  ++ ++ P   SF+ ++GPNGSGKS V+ ++      + +   +G +
Sbjct: 51  IIKIKMKNFMTYGLVEYQLCP---SFNMIIGPNGSGKSTVVCALGLGLASKLDITGRGDI 107

Query: 184 -SELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERR-AFKNNSSKYYV 241
            ++ I   +      S  ++I   Y     N +  + P+  T+ ++R  +     S Y +
Sbjct: 108 VTQYIQNGK-----TSGKIEITLKYSDRIKNVKG-VNPNRETVTIKREISIDAKKSNYKI 161

Query: 242 NGKESNYTEVTRLLKEEGIDLDH----------KRFLILQGEVESIAQMKAKAEKDNDDG 291
           N    N  +V  ++ +  I LD+          K F  L+GE   +  ++A      D  
Sbjct: 162 NNTVVNEKDVRDIVSKLNIQLDNLCQYLPQERLKDFARLKGEKLLLETIRAV-----DPA 216

Query: 292 LL-----------EYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNL 340
           LL           E + D +  AK K +IE+  +E E L  +  E    +    K K +L
Sbjct: 217 LLSDFNEMKELQEEQIRDDVTLAKNKSRIEELKKEGERLKHLVDE----YNTYVKIKSDL 272

Query: 341 ESGKEEALEFLDKERKHTI--LKAQLLQ 366
           +  K+    F   E K ++  LK Q L+
Sbjct: 273 KLCKDARPYFYINEHKESLRSLKQQFLE 300

 Score = 40.8 bits (94), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1334
            SGGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q+I+
Sbjct: 995  SGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQYIL 1054

Query: 1335 IS 1336
            ++
Sbjct: 1055 VT 1056

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 94/430 (21%), Positives = 192/430 (44%), Gaps = 54/430 (12%)

Query: 124 CIDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK 182
            I K+ L NF +Y   + ++ P   S + ++GPNGSGKS  + ++      +   +++ K
Sbjct: 35  AIVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSK 91

Query: 183 -LSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERRAFKNNS-SKYY 240
            + + I   E        S++I        + G   +   A T+ + R   K+ S S+Y 
Sbjct: 92  RVEDFIKNGED-----RGSIEITLKNSPKVE-GMPGVDSEADTIKITRELIKSKSKSRYM 145

Query: 241 VNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMK-----AKAEKDNDDGLLEY 295
           +N +  +  +V  L+ +  I LD+    + Q  VE  A++K     A+  +  D  LL+ 
Sbjct: 146 INDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLKSDKLLAETTRSIDAKLLDV 205

Query: 296 LEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKER 355
           LE ++   + K        EI +  E+ + K+   EL+ ++++  ES K  A + L+ ++
Sbjct: 206 LE-LLKDLQAK--------EISSQRELDLNKQKYDELLVQKEKLSESVK--AFKELESKK 254

Query: 356 KHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTK 415
               L  QLL         KL    +K++    +  + K+  + L+K+ +  ++   N +
Sbjct: 255 SELELHLQLLPYA------KLKDHKEKLADYKRDLDQAKANLKSLRKDKKPFSNAKQNLE 308

Query: 416 KESTALETESKNVNSKKRSLEKD---FIATDEKLKSIARKLKAAEKAF-------SQSES 465
           +    LE  S   + K + L++D   +   +++L+SI  +++  E+          + E 
Sbjct: 309 ER---LEILSNKRDLKDKQLKEDQASYRRVEQELESIREEIEKKEQQIEYYRNRTKKLEE 365

Query: 466 NGKAAVNEIESLKKNHDDCEI-------ELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQ 518
                  E+E+  K  +  E+       E+ +  H + + +  LNE  + L  +   ++ 
Sbjct: 366 TAAKTREELENKYKLLETIELPSQSVFDEITSQRHDLILREANLNESILELDNRASGINH 425

Query: 519 EMESLERQLE 528
            M  LE+Q++
Sbjct: 426 NMRHLEKQMD 435

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1332
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1333 IVIS 1336
             +I+
Sbjct: 1039 FLIT 1042

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 41.2 bits (95), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 4/58 (6%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 181
           I ++ L NF  +   + E GP     + +VG NGSGKS ++ ++  VFG +A+   +G
Sbjct: 62  IKRITLKNFMCHEHFELEFGPM---LNFIVGSNGSGKSAILTAITIVFGAKASDTNRG 116

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 1272 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1329
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I ++  +  
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMIMKKLSSNI 1060

Query: 1330 -AQFIVIS 1336
              Q I+I+
Sbjct: 1061 RTQTIIIT 1068

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1095

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1334
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1335 IS 1336
            I+
Sbjct: 1050 IT 1051

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 57/246 (23%), Positives = 106/246 (43%), Gaps = 41/246 (16%)

Query: 124 CIDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFV------FGFRAN 176
            I K+ L NF +Y   +  + P   S + ++GPNGSGKS  + ++         F  RA 
Sbjct: 37  SIVKIKLQNFVTYRLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIGRAK 93

Query: 177 K----MRQGKLS---ELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVER 229
           +    ++ G+ +   E+  K+ + P+    S+ + F+         T+++   G      
Sbjct: 94  RVDDFIKNGEDTSRIEIFLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLIQRDGNKC--- 150

Query: 230 RAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKA-----KA 284
                  S Y++N K      +  L+K   I LD+    + Q  VE  A++K+     + 
Sbjct: 151 ------KSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLKSDKLLVET 204

Query: 285 EKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGK 344
            +  D  LL+ L+D+  +   +  +E         NEV + K+ RF  ++ ++  LE+  
Sbjct: 205 VRSIDAQLLQILDDLKSSQNDETTLE---------NEVDI-KQKRFNELETDRNKLEASV 254

Query: 345 EEALEF 350
               EF
Sbjct: 255 RSLKEF 260

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_7.101
            YOL034W
          Length = 1119

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1334
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1335 IS 1336
            I+
Sbjct: 1074 IT 1075

 Score = 37.4 bits (85), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 113/285 (39%), Gaps = 59/285 (20%)

Query: 100 SPKKSTRLELQKMHEANTQTSQRLCIDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGS 158
           + +KS +L   K+   N    Q   I K+ L NF +Y   +  + P   S + ++GPNGS
Sbjct: 30  TSRKSKKL---KLSTVNYDKFQPASIVKIKLENFVTYKLTEFNLSP---SLNMIIGPNGS 83

Query: 159 GKSNVIDSMLFVFGFRANKM-RQGKLSELIHKSEQFPSLASCSVQIHFHYVHDTDN---- 213
           GKS  + +       +   + R  ++ + I   E         ++I    V   D     
Sbjct: 84  GKSTFVCAACLGLAGKPEYIGRSKRVDDYIKNGED-----RSKIEIFLKNVESMDKLKNF 138

Query: 214 ------------------GETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLL 255
                             G+  ++    T ++ R   K   S YY+N K  +   V  L+
Sbjct: 139 NNNNNKNNNNGAQVDLKCGQLDLI--KFTRIIHRDKKK---SDYYINDKPVSELTVKNLV 193

Query: 256 KEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEE 315
           K   I LD+    + Q  VE  A++K+      D  L+E +  I       P +   LEE
Sbjct: 194 KALSIQLDNLCQFLSQERVEEFARLKS------DKLLVETVRSI------DPNLLDILEE 241

Query: 316 IETLN--EVCME-----KENRFELVDKEKQNLESGKEEALEFLDK 353
           ++ L   E  +E     K+ R+  +  E+  LE+  +   EF +K
Sbjct: 242 LKVLQNEEQTVEDELEIKQKRYTELCNERTKLEASVQSLKEFENK 286

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 15/85 (17%)

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1332
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1333 IVISLRNNMFELAQNLVGIYKNNNM 1357
             +I+         + L G+Y +  M
Sbjct: 1056 FLIT--------PKLLTGLYYHEKM 1072

 Score = 33.9 bits (76), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 35/68 (51%), Gaps = 5/68 (7%)

Query: 127 KLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKM-RQGKLS 184
           KL + NF +Y   + ++ P   S + ++GPNGSGKS  + ++      +   + R  KL 
Sbjct: 48  KLRMENFVTYKVAEFDLSP---SLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKLE 104

Query: 185 ELIHKSEQ 192
           + I   E+
Sbjct: 105 DFIKNGEE 112

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 36/70 (51%), Gaps = 5/70 (7%)

Query: 1272 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1326
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1327 TKNAQFIVIS 1336
              + Q I+I+
Sbjct: 1057 KSDTQTIIIT 1066

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
           (REAL)
          Length = 1092

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 86/358 (24%), Positives = 161/358 (44%), Gaps = 55/358 (15%)

Query: 111 KMHEANTQTSQRLCIDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLF 169
           K+  A+  + Q   I K+ L +F +Y   +  + P   S + ++GPNGSGKS  + ++  
Sbjct: 28  KVAAADLSSFQPGSIIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCL 84

Query: 170 VFGFRANKMRQGKLSELIHKSEQFPSLASCSVQ-------IHFHYVHDTDNGETKILPSA 222
               +   + + K  E   K+ Q  S    +++       I F   HD     T+I+  +
Sbjct: 85  GLAGKPEYIGRSKKVEDFIKNGQDTSRIEITLKNSPKIHDIEFINTHDETIKVTRIITRS 144

Query: 223 GTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKA 282
                +RR      S Y +N ++ +   V  L+ +  I LD+    + Q  VE  A++K+
Sbjct: 145 -----KRR------SDYLINDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKS 193

Query: 283 -----KAEKDNDDGLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEK 337
                +  +  D  LL+ L++++     +  ++K L +++ L  V + +E+     DK +
Sbjct: 194 VKLLVETIRSIDASLLDVLDELMELQANEQSLQKDL-DVKKLKVVHLRQES-----DKLR 247

Query: 338 QNLESGKEEALEFLDKERKHTILKAQLLQR-QIYDSNRKLATSCDKISALNMEFQEEKSQ 396
           +++ES ++       K++    L +QLL   ++ D   KL T  +       E++  KS 
Sbjct: 248 KSVESLRD-----FQKKKGEIELHSQLLPYVKVKDHKEKLNTYKE-------EYERAKSN 295

Query: 397 YEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKD-FIATDEKLKSIARKL 453
              L K+ +       NTKK    LE     + ++K SL+ D F+   EK+  I  +L
Sbjct: 296 LRALLKDKKPFA----NTKK---TLENRVHEL-TEKCSLKNDEFVKAKEKVNEIFERL 345

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%)

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1319
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIV 1028

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
            (REAL)
          Length = 1093

 Score = 40.8 bits (94), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1334
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1335 IS 1336
            I+
Sbjct: 1047 IT 1048

 Score = 33.1 bits (74), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 62/135 (45%), Gaps = 4/135 (2%)

Query: 148 SFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSELIHKSEQFPSLASCSVQIHFHY 207
           S + ++GPNGSGKS  + ++      +   + + K  E   K+ Q  S    +++ +   
Sbjct: 63  SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDFIKNGQDVSRIEITLK-NSPK 121

Query: 208 VHDTDNGETKILPSAGTMVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRF 267
           V+D +N          T ++ R   +   S Y +N  E + + V  L+ +  I LD+   
Sbjct: 122 VNDIENVNAHDETIKITRIITRSKRR---SDYLINDCEVSESVVKALVAQLNIQLDNLCQ 178

Query: 268 LILQGEVESIAQMKA 282
            + Q  VE  A++K+
Sbjct: 179 FLSQERVEEFARLKS 193

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; binds single-stranded DNA and has ATPase
            activity; S. pombe homolog forms a heterodimer with S.
            pombe Rad18p that is involved in DNA repair
          Length = 1093

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1334
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1335 IS 1336
            I+
Sbjct: 1047 IT 1048

 Score = 32.7 bits (73), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 40/178 (22%), Positives = 77/178 (43%), Gaps = 18/178 (10%)

Query: 111 KMHEANTQTSQRLCIDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLF 169
           K+ + +  + Q   I K+ L +F +Y   +  + P   S + ++GPNGSGKS  + ++  
Sbjct: 28  KIAKPDLSSFQPGSIIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCL 84

Query: 170 VFGFRANKM-RQGKLSELIHKSEQFP----SLASCSVQIHFHYVHDTDNGETKILPSAGT 224
               +   + R  K+ + I   +       +L +        Y+ D  +   KI     T
Sbjct: 85  GLAGKPEYIGRSKKVEDFIKNGQDVSKIEITLKNSPNVTDIEYI-DARDETIKI-----T 138

Query: 225 MVVERRAFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKA 282
            ++ R       S Y +N  + + + V  L+ +  I LD+    + Q  VE  A++K+
Sbjct: 139 RIITR---SKRRSDYLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLKS 193

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] {ON}
            Anc_7.101 YOL034W
          Length = 1117

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 27/42 (64%)

Query: 1278 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1319
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIV 1053

 Score = 33.9 bits (76), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 78/179 (43%), Gaps = 18/179 (10%)

Query: 110 QKMHEANTQTSQRLCIDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSML 168
           QK+   N    +   I K+ L+NF +Y   + ++ P   S + ++GPNGSGKS  + ++ 
Sbjct: 51  QKLIRDNLADFKPGSIIKIKLHNFVTYEFTEFDLSP---SLNMIIGPNGSGKSTFVCAVC 107

Query: 169 FVFGFRANKM-RQGKLSELIHKSEQFPSLASCSVQIHF---HYVHDTDNGETKILPSAGT 224
                +   + R   + + I   E+        ++I       +HD +     +L  + T
Sbjct: 108 LGLAGKPEYIGRSRNVDDYIKNDEE-----HGEIEITLKNSEAIHDVEG----VLEGSDT 158

Query: 225 MVVERRAFKN-NSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKA 282
           + + R   ++   S+Y +N        V  L+    I LD+    + Q  VE  A++K+
Sbjct: 159 ITITRILTRSKKKSEYKINDSLVTEATVKELVSLLNIQLDNLCQFLSQERVEEFARLKS 217

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 40.4 bits (93), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 56/132 (42%), Gaps = 34/132 (25%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 182
           I K++L NF  +     E+ P   + + +VG NGSGKS ++ +++   G +A++  +G  
Sbjct: 73  IRKVILRNFMCHENFSVELTP---NLNFIVGNNGSGKSAILTAIIVALGVKASETSRGSS 129

Query: 183 LSELIHKSEQFPSLASCSVQIH--------------FHYVHDTDNGETKILPSAGTMVVE 228
           L ELI K        S  V +H              F Y HD            G +++ 
Sbjct: 130 LKELIRK-----GCNSSKVTLHLDNNKGDLDINGKDFAYKHD----------QYGDIIII 174

Query: 229 RRAFKNNSSKYY 240
            R  K +S   +
Sbjct: 175 ERTIKKDSGASF 186

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1272 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1318
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 40.0 bits (92), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1256 FSEGVLFSVM--PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1313
            FS+G L  ++  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1314 RN----VSIVANYIKERTKNAQFIV 1334
             N      ++ N + + T+    I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETRTQTIII 1068

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 182
           I K+ L NF  +   + E+GP     + +VG NGSGKS V+ ++    G +A    +G  
Sbjct: 70  IKKVQLRNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGSS 126

Query: 183 LSELIHKSEQ 192
           L +LI +  Q
Sbjct: 127 LKDLIREGCQ 136

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 39.7 bits (91), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 1269 KSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1328
            K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K
Sbjct: 995  KEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLK 1054

Query: 1329 N---AQFIVIS 1336
            +    Q I+I+
Sbjct: 1055 DDSRTQTIIIT 1065

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 5/65 (7%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGK- 182
           I K+ L NF  +   +  +GP     + +VG NGSGKS ++ ++    G +AN   +G  
Sbjct: 71  IKKIKLVNFMCHEHFELTLGP---RLNFIVGNNGSGKSAILTAITIGLGAKANSTNRGNS 127

Query: 183 LSELI 187
           L +LI
Sbjct: 128 LKDLI 132

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 39.3 bits (90), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 127 KLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 181
           ++ L NF  +   + E GP     + +VG NGSGKS ++ ++  VFG +A+   +G
Sbjct: 64  RITLKNFMCHEHFELEFGP---RLNFIVGSNGSGKSAILTAITVVFGAKASDTNRG 116

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1272 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1323
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 1272 RNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1323
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I    I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTIGTKLI 1061

 Score = 37.7 bits (86), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 125 IDKLVLNNFKSYAGIQ-EIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG-K 182
           I K++L NF  +   + E+GP     + +VG NGSGKS V+ ++    G +A    +G  
Sbjct: 75  IKKVILKNFMCHEHFELELGP---RLNFIVGNNGSGKSAVLTAITIGLGAKATDTNRGSS 131

Query: 183 LSELI 187
           L +LI
Sbjct: 132 LKDLI 136

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 1275 SNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1334
            + LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1335 ISL 1337
            IS+
Sbjct: 655  ISI 657

>KAFR0J01770 Chr10 (339037..339522) [486 bp, 161 aa] {ON} Anc_2.215
           YNL079C
          Length = 161

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 30/91 (32%), Positives = 49/91 (53%), Gaps = 3/91 (3%)

Query: 398 EHLQKEAETLTHEINNTKK---ESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLK 454
           E L+ E E L  ++  +K+   +ST L++ ++N+N K  +LE D   TD KLK    KL+
Sbjct: 51  EQLETEVENLESQLAESKQLGEDSTNLQSTNENLNKKNETLENDLEETDSKLKETIEKLR 110

Query: 455 AAEKAFSQSESNGKAAVNEIESLKKNHDDCE 485
            A+    Q E    A  NE + L++ + + E
Sbjct: 111 DADLRVEQLEKRLVALENEKDQLEEKNQELE 141

>NCAS0D03610 Chr4 (671837..674632) [2796 bp, 931 aa] {ON} Anc_6.179
           YGL093W
          Length = 931

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 74/164 (45%), Gaps = 11/164 (6%)

Query: 801 LMRSKATTASQYSRDEVEKMEVQLSTKETNYRSALSMVHEMESALQKLTDRLPEIDIQIS 860
           LM  +     QYS+ E +K   +      N      + H +   L  L +   +I+  + 
Sbjct: 566 LMNEQLQLVKQYSKLEAKKAWYEWRKLHLN-----GITHVLLENLTILQEEYDKIEKDLQ 620

Query: 861 KIQLEKGSRVAEVESYHQRLSQLARELSMNEKNQQPLLDEEKKLDILRQHLQ-QTIDASK 919
           KIQ +  SRV E+++      +L REL  N  NQ+P L ++  +  LRQ L+  +I    
Sbjct: 621 KIQ-QVNSRVKEIKNSISHEIKLLRELPANMYNQEPTLTDKVNIARLRQELKSHSISLGN 679

Query: 920 FS--QDKIDDLKDRIMQKGGI--ELKMQIAKVASLEQHIEILHE 959
               + K D LK+ I     I  + KMQI  +   + H+ I+ E
Sbjct: 680 LPSLKAKHDKLKEDIENTTAILSKAKMQIKSLDDNDSHLAIIPE 723

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 37.0 bits (84), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 1300 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQNLVG 1350
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1351 IYKNNNMTKST 1361
              K  +  KS 
Sbjct: 999  FIKKVDSCKSC 1009

>AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDL058W
            (USO1)
          Length = 1292

 Score = 36.6 bits (83), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 102/234 (43%), Gaps = 36/234 (15%)

Query: 301  GTAKFKPQIEKC--LEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHT 358
            GT K K + E    L+EI  L   C  +++   L+ K K+ L++  E      D + +H 
Sbjct: 890  GTQKKKLEDEHAGLLKEIADLKSQCASQDS---LIPKLKEKLKTLAES---LKDTQNEHA 943

Query: 359  ILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKES 418
             L+ Q+   Q        ATS  +I+ LN E Q+ K +   L    + LT E+   + ++
Sbjct: 944  TLQKQVGNIQ--------ATSHAEITQLNAELQKLKDENVILISRKDELTQELEKLQAQT 995

Query: 419  TALETESKNV---NSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIE 475
             A E ++ ++   N++K  L              + KL  AEK     ++  +    E  
Sbjct: 996  AAGEKQTSDIALLNTQKSEL--------------SAKLSRAEKELVNQKAKAEGLFQERA 1041

Query: 476  SLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDL---SQEMESLERQ 526
             LK   +  E +L   +  +S  + +LNEI+  L     DL    QE E L++Q
Sbjct: 1042 ELKDKLNTSEKQLQESSQKLSNAQSELNEIRSRLKANEHDLITSRQEAEKLKKQ 1095

 Score = 33.9 bits (76), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 68/133 (51%), Gaps = 18/133 (13%)

Query: 305  FKPQIEKCLEEIET----LNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTIL 360
            +K Q+ K   E+E+    L +  +E+ +R E + KE ++L +     +  L+KE+K  ++
Sbjct: 1118 YKAQVSKLSAELESTMGQLQKSSVEQTDRIENLIKENKDLNT----TIATLEKEKKAQVV 1173

Query: 361  ------KAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQK---EAETLTHEI 411
                   A+   + + D N++ A S      +N + QE + Q E LQ+   E ETL  E+
Sbjct: 1174 VNAHQENARANNKAVVD-NKQKAKSQPATPLVNSKVQELEEQLEALQRKCSEMETLQKEV 1232

Query: 412  NNTKKESTALETE 424
               K+ +T LE+E
Sbjct: 1233 KELKENATQLESE 1245

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 36.2 bits (82), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 29/58 (50%)

Query: 1266 PPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1323
            P  +  RN+   SGGEK+ S ++L+ A  +   + +  +DE D  +D  N  I    I
Sbjct: 996  PNDEKPRNVDTFSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRQIGTKLI 1053

>KLLA0F00770g Chr6 (65967..67853) [1887 bp, 628 aa] {ON} some
           similarities with uniprot|Q08581 Saccharomyces
           cerevisiae YOR195W SLK19 Kinetochore-associated protein
           required for normal segregation of chromosomes in
           meiosis and mitosis
          Length = 628

 Score = 35.8 bits (81), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 67/144 (46%), Gaps = 19/144 (13%)

Query: 751 VLRDTLVARDLQQANRVAYGKRRFRVVTLDGKLIDISGTMSGGGSSPQSGLMRSKATTAS 810
           V +DT+  RDL              +  L+ KL       S   SS +S L  ++A   S
Sbjct: 360 VFQDTIKPRDLS-------------ITELNKKLQQFEANGSDEVSSLKSKLQITEAELDS 406

Query: 811 QYSRDEVEKMEVQLSTKET---NYRSALSMVHE-MESALQKLTDRLPEIDIQISKIQLEK 866
           +  ++E+E + ++LSTKET     RS ++ V E  E +L +L     ++D   S+    +
Sbjct: 407 K--KNEIESLNLKLSTKETALEELRSHITQVTEDKEKSLSELEQTKRDLDSLTSRNGNIE 464

Query: 867 GSRVAEVESYHQRLSQLARELSMN 890
              +AE+E  H+ +S +   L  N
Sbjct: 465 SEHLAELERLHENMSHMETNLKQN 488

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 51/215 (23%), Positives = 100/215 (46%), Gaps = 37/215 (17%)

Query: 349 EFLDKERKHTILK--------------AQLLQRQIYDSNRK---LATSCDKISALNMEFQ 391
           E +D ERK  +LK              A+LL R I  SNR    LA    + +  + E +
Sbjct: 672 EIIDWERKCDVLKIQNEKLKRNAQNENAELLTRMIGSSNRLNRLLAMRPIEATTPSNEGE 731

Query: 392 EEKSQYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIAR 451
           +     E L+K  + +  EI+ T K    L+ E + +  +K +L+ D +A ++KL+++ +
Sbjct: 732 KGIEGVEPLRK-MDKVIGEIHETAKVKKQLKDERQKLTDEKTALQADLLAKNDKLEALRK 790

Query: 452 KLKAAEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNL----------------NHSI 495
               + K+   ++     + +E+E   +  DD + ++  L                ++S 
Sbjct: 791 IFDGSLKSMLLTQKAIDLSRSELEKYNQCTDDLQQQIEKLKNEQTEEQGQHRTVVHSNSE 850

Query: 496 SIEKEKLNEIKIHLHEKTKD---LSQEMESLERQL 527
           +I + KLN +K  L+   +D   L +E+ +L+++L
Sbjct: 851 TIHRMKLNNLKTELYISKEDRDTLKEEVLALKKRL 885

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 83/179 (46%), Gaps = 23/179 (12%)

Query: 365  LQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHEINNTKKESTA---L 421
            LQ  +  +  +++ + +K+ A   E ++ K +Y+ L ++ + LTH+ N T+K       L
Sbjct: 1212 LQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQ-QKLTHK-NETEKLHNVIGDL 1269

Query: 422  ETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNH 481
            E +  NV +    LE  F           R  K A +    S+    A  NE+  LK+  
Sbjct: 1270 EVKLLNVQNANADLENKF----------NRLKKQAHEKLDASKKQQTALTNELNELKETK 1319

Query: 482  DDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKD--------LSQEMESLERQLEPFRD 532
            D  E  LHN    +   + KL E  + + E +KD          +E+ESL+++L+ FR+
Sbjct: 1320 DKLEENLHNEESKVVDLELKLKEHGLQVGEVSKDHDSIAFKPFVEEIESLKKELQVFRN 1378

>TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4.238
            YDL058W
          Length = 2536

 Score = 35.0 bits (79), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 94/403 (23%), Positives = 178/403 (44%), Gaps = 81/403 (20%)

Query: 303  AKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEFLDKERKHTILKA 362
            A+   Q+EK  EEI  LN    +  +R +L  K   ++ES   +    L+KE    +LK 
Sbjct: 1665 AELNSQLEKHKEEIADLNSSLNDINSRLDLKIKNFDSIESKNSD----LEKE----LLKV 1716

Query: 363  QLLQRQIYDSNRKLATSC-DKISALNMEFQEEKSQYEH---------------------- 399
                  + +S+ K   S  DKI++L+ EF++E++Q                         
Sbjct: 1717 NEELAHLKESSSKTILSLNDKITSLSEEFEKERTQLTEGSDSITKEYSEKINRLEESLRK 1776

Query: 400  --LQKEAETLTH---------EINNTKKESTALETESK----NVNSKKRSLEKDFIATDE 444
              L K+ ETL +         +++ T+K+ TA E + K     +N +K SL+K    + E
Sbjct: 1777 VELDKDKETLEYKNKLTSIIDQLSETEKDLTAAEEDKKILTETLNDQKTSLDK----SHE 1832

Query: 445  KLKSIARKLKAA-------EKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISI 497
            +L+ + ++L  A           S+ +SN +A + E+ESL     D + +L+  N + + 
Sbjct: 1833 ELELLNKQLSDALSDAQSKVNCISELQSNNEALIKEVESLHLQITDLDSKLNEANVNSNS 1892

Query: 498  EKEKLNEIKI----------HLHEKTKDLSQEMESLER-------QLEPFRDQIQEKQSE 540
            ++ +++++ I           +H + K L+ E E  E+       +L   +   + K++E
Sbjct: 1893 KENEISDLLIKAKDNSDQLSEMHSRIKTLTNEFELNEKLLNEKSEELSAIKAVTEGKENE 1952

Query: 541  IK-------LSETKITMLKSSHSNLLKEKATIESKIEDXXXXXXXXXXXXXXXRNEKSKV 593
            IK       LSE +I ++KS   N  +  A+ E K+ +                 +KS +
Sbjct: 1953 IKKLTQELALSEEEIAVIKSKLKNSDETAASTERKLLETKEILSQMPTDLTTANKDKSDL 2012

Query: 594  EARISTAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQ 636
              +++  +K+ +    Q NE  D+L  + + ++E +  L   Q
Sbjct: 2013 SIQLTETKKQLDVLNLQINENGDLLSSKIESLKEKEDQLEKLQ 2055

>CAGL0L08338g Chr12 complement(920067..920552) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P40414 Saccharomyces
           cerevisiae YIL138c TPM2 tropomyosin
          Length = 161

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 36/62 (58%), Gaps = 3/62 (4%)

Query: 399 HLQKEAETLTHEINNTKK---ESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKA 455
            L +E E L  +I  TK+   EST L++ ++N N K + LE++   TD KLK  + +LK 
Sbjct: 52  QLDQEVEKLEDQIKETKELAEESTTLKSHNENFNKKNQMLEEELEETDRKLKETSDRLKE 111

Query: 456 AE 457
            E
Sbjct: 112 IE 113

>Ecym_4024 Chr4 (57388..59376) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii AFR281C
          Length = 662

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 62/127 (48%), Gaps = 23/127 (18%)

Query: 512 KTKDLSQEMESLERQLEPFRDQIQEKQSEIKLSETKITMLKS--------SHSNLLKEKA 563
           + + L  E   LE +L   RD+I  K   +   E +++ +KS        SHS LL ++ 
Sbjct: 519 RAESLQWENSELELELHSLRDEITSKNKLLDSMEQELSNIKSEYEEYQQVSHSKLLSQRI 578

Query: 564 TIESKIEDXXXXXXXXXXXXXXXRNEKSKVEARISTAQKECEEAQKQTNEMRDVLIQQRQ 623
            IE K+E                +N++ K + R+S A++E EEA+ +  E++ + IQQ +
Sbjct: 579 EIE-KLE-------------RKIQNDRHKTQQRVSQAEQEVEEAKFKLKELK-LNIQQEK 623

Query: 624 IVEEAKA 630
           ++   K 
Sbjct: 624 LLLHKKV 630

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 76/157 (48%), Gaps = 15/157 (9%)

Query: 779 LDGKLIDISGTMSGGGSSPQSGLMRSKATTASQYSRDEVEKMEV------QLSTKETNYR 832
           +DGKL++I+G  +  GSS  S       + AS + R++   +E       QL ++   Y 
Sbjct: 367 VDGKLVEITGNPTLLGSSSSSAKDHEDYSLASNFLRNKEYHLEYVQVLISQLESQREYYE 426

Query: 833 SALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARELSMNEK 892
           + LS   E +S +  LT  L  + ++  + +L+K   + EV     +L+  A+E  +  +
Sbjct: 427 TKLSE-KENDSKIDDLTRDLDHLKLRFKESELKKN--INEV-----KLNNEAKENKLIIR 478

Query: 893 NQQPLLDE-EKKLDILRQHLQQTIDASKFSQDKIDDL 928
             Q  LD  EK+ D+LR+  +  +       D++ DL
Sbjct: 479 GLQDNLDHLEKQNDLLRRQNESLVAEKNDLNDQVKDL 515

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 1256 FSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1315
            F EGV   V P        + LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGPRG------TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1316 VSIVANYIKERT 1327
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>CAGL0D03938g Chr4 (392433..394304) [1872 bp, 623 aa] {ON} weakly
           similar to uniprot|P38769 Saccharomyces cerevisiae
           YHR035w
          Length = 623

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 49/112 (43%), Gaps = 14/112 (12%)

Query: 346 EALEFLDKERKHTILKAQLLQRQIYDSNR----KLATSCDKISALNMEFQEEKSQYEHLQ 401
           + +E ++   +H I   + L+  +Y  NR    K AT C    A N+  + +K  YE L 
Sbjct: 168 DGIEIMNSYNEHVIAHIKALRNSVYTHNRKKRAKRATGCALFLA-NLLCKSDKLHYEVLS 226

Query: 402 --------KEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEK 445
                      + ++ E+ NT ++ T L+ +        RS  K ++A D K
Sbjct: 227 FLSGPCTLGNGKVISREVKNTIRQFTDLDQQKAKYFDDARSFYK-YLAADSK 277

>SAKL0G11110g Chr7 complement(942330..947945) [5616 bp, 1871 aa] {ON}
            similar to uniprot|P08964 Saccharomyces cerevisiae
            YHR023W MYO1 Type II myosin heavy chain required for
            wild- type cytokinesis and cell separation localizes to
            the actomyosin ring binds to myosin light chains Mlc1p
            and Mlc2p through its IQ1 and IQ2 motifs respectively
          Length = 1871

 Score = 33.5 bits (75), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 56/263 (21%), Positives = 124/263 (47%), Gaps = 26/263 (9%)

Query: 394  KSQYEHLQKEAETLTHEINNTKKESTA-LETESKNVNSKKRSLEKDFIATDEKLKSIARK 452
            K QYE  Q+E  +   EI++ ++ S   LE+E K +  K   +  +     +   S+   
Sbjct: 894  KKQYEDAQREITSFK-EISSERESSIKQLESEKKELQLKLNQINSEISIAKKSEVSLTTT 952

Query: 453  LKAAEKAFSQSESNGKAAVNEIES----LKKNHDDCEIELHNLNHSISIEKEKLNEIKIH 508
             K+ +    + ++ G +   EI+     LK + ++ E+++ +L  S  I  ++LN     
Sbjct: 953  AKSLKDEIEELKALGTSKQREIDDLKTKLKTSDEELELKMKSLEKSFEITSKRLNT---- 1008

Query: 509  LHEKTKDLSQEMESLERQLEPFRDQIQEKQSEIKL-------SETKITMLKSSHSNLLKE 561
            L E+ KDL  ++++ +R+    + Q+  K+ E+K         +T+I++L  S  +L+ E
Sbjct: 1009 LVEENKDLRGQIDTAKREAGETQRQLDSKERELKRLVEKNEQHQTEISLLAKSRDDLVSE 1068

Query: 562  KATIESKIEDXXXXXXXXXXXXXXXRNEKSKVE-------ARISTAQKECEEAQKQTNEM 614
             + + +++                 + E + ++       A ++T++ E      Q+++ 
Sbjct: 1069 HSKVVAELRHSRKEVSEYKQRCQKLKEECTSIKKQLEEEIASLATSKVEANNGNDQSSDS 1128

Query: 615  RDVLIQQRQIVEEAKANLNGFQN 637
            R+V + Q ++++E   +LN F N
Sbjct: 1129 REVSLLQDELLKE--RSLNRFLN 1149

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209C STE6 ATP-binding cassette (ABC) transporter
            required for the export of a-factor catalyzes ATP
            hydrolysis coupled to a-factor transport contains 12
            transmembrane domains and two ATP binding domains
            expressed only in MATa cells
          Length = 1298

 Score = 33.1 bits (74), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 52/90 (57%), Gaps = 5/90 (5%)

Query: 1277 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1336
            LSGG+  L  LA+V AL + KP  L V+DE  +ALD ++  I++ ++++ +++   +V++
Sbjct: 1198 LSGGQ--LQRLAIVRALLR-KP-QLLVLDECTSALDAQHGFIMSEFVRQGSQSTTTLVLT 1253

Query: 1337 LRNNMFELAQNLVGIYKNNNMTKSTTLQNI 1366
                M   A N +  + N N+ +  + + +
Sbjct: 1254 HSEQMMR-ACNRILTFANGNIIEDGSFERL 1282

>ZYRO0A07524g Chr1 (615902..619174) [3273 bp, 1090 aa] {ON} highly
            similar to uniprot|P15436 Saccharomyces cerevisiae
            YDL102W CDC2 Catalytic subunit of DNA polymerase delta
            required for chromosomal DNA replication during mitosis
            and meiosis intragenic recombination repair of double
            strand DNA breaks and DNA replication during nucleotide
            excision repair (NER)
          Length = 1090

 Score = 33.1 bits (74), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 9/63 (14%)

Query: 1300 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAQNLVG 1350
            PLYV++   +ID+     N      +SIVA  + E+  NA F+V S++ N   +   L+G
Sbjct: 935  PLYVLEHNMQIDSRYYLTNQLQNPIISIVAPILGEKQANAMFVVKSIKINTGNMKGGLMG 994

Query: 1351 IYK 1353
              K
Sbjct: 995  FVK 997

>CAGL0A02596g Chr1 (278467..281085) [2619 bp, 872 aa] {ON} similar
           to uniprot|P32380 Saccharomyces cerevisiae YDR356w NUF1
          Length = 872

 Score = 33.1 bits (74), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (50%), Gaps = 14/120 (11%)

Query: 396 QYEHLQKEAETLTHEINNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKA 455
           Q E L+KE E L   I+   KES  +E   ++ N + R LE D +  +E+   I  KL++
Sbjct: 586 QIEALRKENENL---ISREHKESNNIEITLQDKNIQIRRLEADIVQLNEERNDILNKLRS 642

Query: 456 AEKAFSQSESNGKAAVNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKD 515
            E+A  + +S  K A+  I  L+       ++L N N S+   K+ L E K   +EK KD
Sbjct: 643 LEQAKDRYKSEMKDALETISRLR-------VDLEN-NKSLKDSKDSLIERK---YEKLKD 691

>KNAG0L02010 Chr12 (357972..360080) [2109 bp, 702 aa] {ON} Anc_5.689
           YOR080W
          Length = 702

 Score = 32.7 bits (73), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 32/141 (22%), Positives = 69/141 (48%), Gaps = 13/141 (9%)

Query: 424 ESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAAVNEIESLKKNHDD 483
           E+++++ K   L  +  A  EKL    + L+ A+K   + + N K  +   + L+K  DD
Sbjct: 57  ETRHLHPKYTKLLDNLCACYEKLDQCPKALRIADKMIQRDQFNMKCYIRRGKLLQKLGDD 116

Query: 484 CEIELHNLNHSISIEKEKLNEIKIHLHEK-TKDLSQEMESLERQLEP----------FRD 532
                HN   +++   E   +  I   ++    ++ ++ +++++L+P          F D
Sbjct: 117 LA-AYHNYKRALNKSTECSRKYDIDSPQRYIVMINDQLTAIKQRLKPPAQAKSTKRQFID 175

Query: 533 QIQEKQSEI-KLSETKITMLK 552
            IQE Q+E+ +L + K++ +K
Sbjct: 176 PIQEHQTELEQLKKVKLSSIK 196

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
            similar to uniprot|P53278 Saccharomyces cerevisiae
            YGR130C Protein of unknown function green fluorescent
            protein (GFP)-fusion protein localizes to the cytoplasm
            in a punctate pattern
          Length = 994

 Score = 32.7 bits (73), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 45/76 (59%), Gaps = 6/76 (7%)

Query: 1000 SEQL-ESIRLEKERIEEQVIENNERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDR 1058
            SE L E I  EK+R EE+ ++ + R  EL   VEKL++ +  I+ D+NE    E+ +  R
Sbjct: 523  SEWLTEFISSEKKRYEEKQVDYDNRLEELKKEVEKLEESMQEIKDDANEL--IEIRHG-R 579

Query: 1059 LEK--LHGLQEYVKKQ 1072
            L K  L   Q+Y++K+
Sbjct: 580  LSKKFLESTQQYIEKK 595

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 32.3 bits (72), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 78/164 (47%), Gaps = 21/164 (12%)

Query: 779 LDGKLIDISGTMSGGGSSPQ---------SGLMRSKATTASQYSRDEVEKMEVQLSTKET 829
           +DGKL+++ G +    ++P          + LMR+K     +Y  + V+ +  QL ++  
Sbjct: 367 VDGKLVEV-GNIGSTLNTPSDRNKNENLVTNLMRNK-----EYHLEYVQVLISQLESQRE 420

Query: 830 NYRSALSMV---HEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLARE 886
            Y   L  V   +  E  LQ L D+L  + +Q+S  Q E+ ++  E+E+ +  LS     
Sbjct: 421 YYELKLKDVSNKNNEEQQLQDLKDQLKSLKLQLS--QNEQATK-KELEANNMMLSGFQAN 477

Query: 887 LSMNEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKD 930
           L  +EK    L  E+ KL+   ++LQ+ +    F  D  +  KD
Sbjct: 478 LDKSEKFIDNLKQEKMKLEEENKNLQEQLQDLMFYLDTQNKFKD 521

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 134,919,590
Number of extensions: 5997231
Number of successful extensions: 44586
Number of sequences better than 10.0: 1880
Number of HSP's gapped: 40574
Number of HSP's successfully gapped: 4240
Length of query: 1372
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1250
Effective length of database: 39,492,147
Effective search space: 49365183750
Effective search space used: 49365183750
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)