Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19063g8.258ON41541521810.0
AGR091W8.258ON41041114440.0
Ecym_43128.258ON41141414310.0
ZYRO0C01738g8.258ON41442114010.0
SAKL0H17138g8.258ON41942313830.0
Kwal_56.238328.258ON41942413740.0
KLTH0G13772g8.258ON42042513710.0
TDEL0F038508.258ON41942213520.0
YLR085C (ARP6)8.258ON43844213530.0
Suva_10.1698.258ON43844213510.0
KAFR0B027008.258ON42042413470.0
Smik_12.1448.258ON43844213430.0
Kpol_543.368.258ON42743113390.0
Skud_12.1538.258ON43844213310.0
TBLA0H014608.258ON44244513310.0
NDAI0B019608.258ON43944213240.0
NCAS0B049908.258ON42042513151e-180
KNAG0G020108.258ON42442213061e-179
CAGL0L12166g8.258ON42142413051e-179
TPHA0A018308.258ON42142412631e-172
TBLA0C004408.23ON3754193096e-31
NCAS0C037008.23ON3754193087e-31
TDEL0C004708.23ON3754193061e-30
CAGL0K12694g8.23ON3754193061e-30
Suva_6.188.23ON3754193061e-30
Smik_6.398.23ON3754193061e-30
YFL039C (ACT1)8.23ON3754193061e-30
KNAG0L002508.23ON3754193061e-30
KAFR0D009408.23ON3754193061e-30
TPHA0D002508.23ON3754193062e-30
ZYRO0F02772g8.23ON3754193052e-30
NDAI0G030408.23ON3754193052e-30
SAKL0B00968g8.23ON3754193052e-30
ABR222W8.23ON3764193043e-30
Kpol_1058.158.23ON3754193025e-30
KLLA0D05357g8.23ON3754193001e-29
KLTH0G18832g8.23ON3754193001e-29
Ecym_15208.23ON3764162982e-29
Skud_6.318.23ON3603762823e-27
Kwal_14.11098.23ON3603762752e-26
Ecym_63852.117ON3774192462e-22
AFR051W2.117ON4054232455e-22
KLLA0E22925g2.117ON3804152437e-22
NDAI0G029003.161ON3913842392e-21
SAKL0E11814g2.117ON3794202322e-20
ZYRO0B04928g3.161ON3913642322e-20
Kwal_33.146422.117ON3834292303e-20
KLTH0F06490g3.161ON3913682271e-19
Ecym_52373.161ON3913842242e-19
NCAS0B071302.117ON3814182232e-19
TBLA0F008703.161ON3913702224e-19
KLTH0B05940g2.117ON3834272224e-19
ADR316W3.161ON3913642215e-19
SAKL0C07370g3.161ON3913842216e-19
NCAS0C035503.161ON3923642207e-19
Kwal_33.141773.161ON3373222188e-19
CAGL0K01595g3.161ON3913862191e-18
TDEL0D046103.161ON3913642172e-18
KNAG0H036502.117ON3874152154e-18
Suva_4.2203.161ON3913842154e-18
KNAG0K01130na 1ON3933862128e-18
Kpol_1023.188.23ON3193412091e-17
Smik_4.2063.161ON3913842101e-17
KLLA0C03850g3.161ON3913642092e-17
YDL029W (ARP2)3.161ON3913862074e-17
KAFR0C01040na 1ON3373022054e-17
Kpol_479.253.161ON3913702065e-17
Skud_4.2223.161ON3913642056e-17
TPHA0I013002.117ON3794162021e-16
TPHA0A009203.161ON3913902003e-16
TBLA0B010702.117ON3834251994e-16
TDEL0B048102.117ON3734181941e-15
ZYRO0G05676g2.117ON3814161905e-15
NDAI0B044602.117ON3814131898e-15
YHR129C (ARP1)2.117ON3843861871e-14
Skud_8.1902.117ON3843851782e-13
KLLA0B13904g1.514ON4563841792e-13
ZYRO0G01936g1.514ON4613841712e-12
KAFR0F005902.117ON3863811693e-12
Smik_8.2102.117ON3843831683e-12
SAKL0D12804g1.514ON4563811693e-12
KNAG0B001701.514ON4533851693e-12
CAGL0F00517g1.514ON4543831667e-12
KAFR0D037001.514ON4493871668e-12
YJR065C (ARP3)1.514ON4493861668e-12
Ecym_31531.514ON4583821659e-12
Suva_12.1541.514ON4493861641e-11
Smik_10.3551.514ON4493861632e-11
NCAS0A122701.514ON4543161632e-11
Skud_10.2891.514ON4493861623e-11
NDAI0A039701.514ON4623811613e-11
AFR419C1.514ON4553151613e-11
TPHA0O010401.514ON4583841604e-11
CAGL0H09042g2.117ON3874011585e-11
Suva_15.3262.117ON3843831585e-11
TBLA0D036801.514ON4583221596e-11
TDEL0F004701.514ON4613001586e-11
Kpol_1056.161.514ON4603901571e-10
KNAG0I018602.248ON7531341572e-10
KLLA0F03421g2.248ON7471421552e-10
Kwal_27.99581.514ON4453001542e-10
KLTH0C02508g1.514ON4513221533e-10
ADL253C2.248ON7511391472e-09
SAKL0E08602g2.248ON7471371454e-09
TDEL0C041402.248ON7491341446e-09
Kwal_23.48482.248ON7451351411e-08
KLTH0G09482g2.248ON7451341383e-08
YNL059C (ARP5)2.248ON7551391383e-08
Suva_14.2812.248ON7551391383e-08
Ecym_32852.248ON7461401373e-08
AFR105C1.287ON4793271364e-08
ZYRO0A01584g2.248ON7481361356e-08
Kpol_282.41.287ON5011061347e-08
Skud_10.1321.287ON4882121348e-08
Skud_14.2722.248ON7551401331e-07
Smik_14.2672.248ON7551391322e-07
NDAI0G055801.287ON5152201302e-07
TBLA0E038602.248ON7591341303e-07
NDAI0D010602.248ON7531391303e-07
Suva_6.1541.287ON4892151284e-07
TPHA0C031602.248ON7551301284e-07
YJL081C (ARP4)1.287ON4892121275e-07
Kpol_1003.162.248ON7491331259e-07
Ecym_63301.287ON4801051241e-06
TPHA0I010301.287ON5031061222e-06
TBLA0D053601.287ON5961251213e-06
KLLA0D02288g1.287ON5201051204e-06
Smik_10.1611.287ON4892121194e-06
KAFR0J011602.248ON7511361179e-06
KLTH0H09702g1.287ON4811051152e-05
Kwal_14.23771.287ON4812171114e-05
CAGL0M03201g1.287ON4932281105e-05
NCAS0B060601.287ON4972191071e-04
KNAG0B019201.287ON5052311071e-04
KAFR0A015601.287ON4851051062e-04
TDEL0D015501.287ON480891062e-04
SAKL0D05874g1.287ON4971051062e-04
ZYRO0G21428g1.287ON4832191053e-04
CAGL0J10054g2.248ON7541371035e-04
SAKL0F13772g7.448ON42287990.001
NCAS0G030502.248ON743120970.003
CAGL0K05335g7.448ON52988910.014
ACR184C7.448ON40185870.037
Kwal_27.105527.448ON35165850.050
NDAI0A013007.448ON565145800.30
KLTH0C05324g7.448ON399269790.34
Suva_16.3647.448ON48068780.51
NCAS0A147207.448ON485113760.69
Suva_13.1555.528ON64566760.75
Smik_16.2787.448ON47668760.83
YPR034W (ARP7)7.448ON47768760.85
NCAS0D008202.329ON672177760.89
Skud_16.3217.448ON47968750.90
SAKL0A08162g6.71ON81755741.5
Kpol_520.117.448ON488147713.1
KLLA0C04191g3.177ON79736713.2
KAFR0D010308.50ON73047704.3
TPHA0B014607.448ON485214695.3
TDEL0C031207.448ON438138695.8
YGR271W (SLH1)5.31ON196740687.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19063g
         (415 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...   844   0.0  
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...   560   0.0  
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...   555   0.0  
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...   544   0.0  
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...   537   0.0  
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...   533   0.0  
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...   532   0.0  
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...   525   0.0  
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...   525   0.0  
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...   525   0.0  
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...   523   0.0  
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...   521   0.0  
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...   520   0.0  
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...   517   0.0  
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...   517   0.0  
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...   514   0.0  
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...   511   e-180
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...   507   e-179
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...   507   e-179
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...   491   e-172
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   123   6e-31
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   123   7e-31
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   122   1e-30
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   122   1e-30
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   122   1e-30
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   122   1e-30
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   122   1e-30
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   122   1e-30
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   122   1e-30
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   122   2e-30
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   122   2e-30
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   122   2e-30
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   122   2e-30
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   121   3e-30
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   120   5e-30
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   120   1e-29
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   120   1e-29
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   119   2e-29
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...   113   3e-27
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...   110   2e-26
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...    99   2e-22
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...    99   5e-22
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    98   7e-22
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...    97   2e-21
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...    94   2e-20
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...    94   2e-20
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...    93   3e-20
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...    92   1e-19
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    91   2e-19
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    91   2e-19
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...    90   4e-19
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...    90   4e-19
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...    90   5e-19
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...    90   6e-19
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...    89   7e-19
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...    89   8e-19
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...    89   1e-18
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...    88   2e-18
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    87   4e-18
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...    87   4e-18
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...    86   8e-18
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...    85   1e-17
Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...    86   1e-17
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...    85   2e-17
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...    84   4e-17
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...    84   4e-17
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...    84   5e-17
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...    84   6e-17
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    82   1e-16
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...    82   3e-16
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    81   4e-16
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    79   1e-15
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...    78   5e-15
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...    77   8e-15
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...    77   1e-14
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...    73   2e-13
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...    74   2e-13
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...    70   2e-12
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...    70   3e-12
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...    69   3e-12
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...    70   3e-12
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...    70   3e-12
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...    69   7e-12
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...    69   8e-12
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...    69   8e-12
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...    68   9e-12
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...    68   1e-11
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...    67   2e-11
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...    67   2e-11
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...    67   3e-11
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514     67   3e-11
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...    67   3e-11
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....    66   4e-11
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...    65   5e-11
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    65   5e-11
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...    66   6e-11
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...    65   6e-11
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....    65   1e-10
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    65   2e-10
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    64   2e-10
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...    64   2e-10
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...    64   3e-10
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    61   2e-09
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    60   4e-09
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    60   6e-09
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    59   1e-08
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    58   3e-08
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    58   3e-08
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    58   3e-08
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    57   3e-08
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    57   4e-08
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    57   6e-08
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    56   7e-08
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    56   8e-08
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    56   1e-07
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    55   2e-07
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    55   2e-07
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    55   3e-07
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    55   3e-07
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    54   4e-07
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    54   4e-07
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    54   5e-07
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    53   9e-07
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    52   1e-06
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    52   2e-06
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    51   3e-06
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    51   4e-06
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    50   4e-06
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    50   9e-06
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    49   2e-05
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    47   4e-05
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    47   5e-05
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    46   1e-04
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    46   1e-04
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    45   2e-04
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    45   2e-04
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    45   2e-04
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    45   3e-04
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    44   5e-04
SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} simi...    43   0.001
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    42   0.003
CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} simil...    40   0.014
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    38   0.037
Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {...    37   0.050
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    35   0.30 
KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {...    35   0.34 
Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034...    35   0.51 
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    34   0.69 
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...    34   0.75 
Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034...    34   0.83 
YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}  ARP7Compo...    34   0.85 
NCAS0D00820 Chr4 (146043..148061) [2019 bp, 672 aa] {ON} Anc_2.3...    34   0.89 
Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034...    33   0.90 
SAKL0A08162g Chr1 complement(721932..724385) [2454 bp, 817 aa] {...    33   1.5  
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    32   3.1  
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    32   3.2  
KAFR0D01030 Chr4 (212780..212792,212864..215043) [2193 bp, 730 a...    32   4.3  
TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {O...    31   5.3  
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    31   5.8  
YGR271W Chr7 (1031791..1037694) [5904 bp, 1967 aa] {ON}  SLH1Put...    31   7.8  

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score =  844 bits (2181), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/415 (97%), Positives = 403/415 (97%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60
           MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP
Sbjct: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120
           HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV
Sbjct: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120

Query: 121 IFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAVP 180
           IFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAVP
Sbjct: 121 IFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAVP 180

Query: 181 IIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVPPESYFS 240
           IIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVPPESYFS
Sbjct: 181 IIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVPPESYFS 240

Query: 241 SFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSVPETFFHPEIAQ 300
           SFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEK            EVFSVPETFFHPEIAQ
Sbjct: 241 SFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVFSVPETFFHPEIAQ 300

Query: 301 ILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCK 360
           ILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCK
Sbjct: 301 ILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCK 360

Query: 361 VHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGYQQWL 415
           VHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGYQQWL
Sbjct: 361 VHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGYQQWL 415

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/411 (63%), Positives = 321/411 (78%), Gaps = 6/411 (1%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRPHELGQ 65
           L+++NGSYEIKFG +  + P RA NCLT+D+Y R+HLSNQ  ++RDIS   IRRP ELGQ
Sbjct: 5   LLMENGSYEIKFGPANLETPYRARNCLTRDRYGRYHLSNQMDQIRDISHCHIRRPSELGQ 64

Query: 66  LVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQVIFEEY 125
           L+SWELE ++WDYC +N D+F W L    D+KD  L+ SET MTIPE+SKNMDQV+FEEY
Sbjct: 65  LISWELEEQIWDYCLFNPDEFGWEL---KDSKDVDLIASETCMTIPEISKNMDQVVFEEY 121

Query: 126 DFKSMFKGPVAQYIPFYQGQYQDDAMTAAED-KKTSSYKDFQLVIDSGFNCTWAVPIIKG 184
           +F SM K PVAQ++PF + +  D    A E  +  S Y +FQLV+DSGFNCTW +P+IKG
Sbjct: 122 EFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNCTWVMPVIKG 181

Query: 185 VPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVPPESYFSSFHN 244
           VPYYKA KKLDIGGRFL GLL+ETISFRHYNVM+ETIL+NNIKEQC F+PP SYF SF  
Sbjct: 182 VPYYKATKKLDIGGRFLNGLLKETISFRHYNVMDETILINNIKEQCCFMPPVSYFDSFQR 241

Query: 245 KMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSVPETFFHPEIAQILKP 304
           K  T+VEY+LPDFQTS +GYV++P K+             E+F+VPETFFHPEI+ ILKP
Sbjct: 242 KEETRVEYILPDFQTSLIGYVRQP-KQAIPKTSQILRLEDELFTVPETFFHPEISNILKP 300

Query: 305 GIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSP 364
           G+VETILEC++M PEV+RPLLV+NIV  GGNFNI NF  RL TELQRQCP DW  +VH P
Sbjct: 301 GLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATELQRQCPTDWKVRVHQP 360

Query: 365 QEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGYQQWL 415
           +  D +L GW+SM+ F+ +D ++++RVTR EYLEHG DWCTK+RFGY+QW+
Sbjct: 361 K-LDAALQGWKSMRQFSQTDSYKNSRVTRSEYLEHGADWCTKHRFGYEQWI 410

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/414 (61%), Positives = 317/414 (76%), Gaps = 11/414 (2%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRPHELGQ 65
           ++IDNGSYEIKFG S    P RALNCL +DKY R+HLSNQ K++R++S   +RRP ELGQ
Sbjct: 5   IIIDNGSYEIKFGPSSLKSPYRALNCLARDKYGRYHLSNQMKQIREVSNCHVRRPFELGQ 64

Query: 66  LVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQVIFEEY 125
           LVSWELE  +WDYC +N D+F W+L    D+KD  L+VSET M+IPE+SK+MDQV+FEEY
Sbjct: 65  LVSWELEEHIWDYCLFNSDEFSWDL---KDSKDVDLIVSETCMSIPEISKHMDQVVFEEY 121

Query: 126 DFKSMFKGPVAQYIPFYQGQ----YQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAVPI 181
           +F S+ K PVAQYIPF        Y  D +     +K   Y DFQLV+DSGFNCTW +P+
Sbjct: 122 EFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVV--RKKDDYNDFQLVVDSGFNCTWVIPV 179

Query: 182 IKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVPPESYFSS 241
           IKGVPYYKA+KKLDIGGRFLTGLL+ET+SFRHYN+M+ETIL NNIKEQC F+PP SYF S
Sbjct: 180 IKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHYNLMDETILANNIKEQCCFMPPVSYFDS 239

Query: 242 FHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSVPETFFHPEIAQI 301
           F  K  T+++YVLPDFQTS +GYV++P K+             E+F++PETFFHPEIA I
Sbjct: 240 FQKKAETRIDYVLPDFQTSLIGYVRQP-KQAIPEDSQTLNLEDELFTIPETFFHPEIANI 298

Query: 302 LKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKV 361
           LKPG++ET+LE I+M PE++RPL+V+NI   GGNFNI NF  RL TELQRQCP DWS +V
Sbjct: 299 LKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQRQCPTDWSVRV 358

Query: 362 HSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGYQQWL 415
           H P+  D  L GW++M  F+N+D ++  RVTR EYLEHG+DWCTK RFGY+QW+
Sbjct: 359 HLPK-GDTELQGWKAMMRFSNTDSYKQGRVTRAEYLEHGVDWCTKYRFGYEQWI 411

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/421 (62%), Positives = 309/421 (73%), Gaps = 13/421 (3%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60
           M  P +V+DNGSYEIKFG    + P RA N L +DK+  ++LSNQ K ++DIS  + RRP
Sbjct: 1   MESPPIVVDNGSYEIKFGTPDLETPHRAFNALARDKFGSYYLSNQIKTIKDISSVVFRRP 60

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120
           HE GQL SWELES +WDYCF+N D+F  N     D+K  HLVVSET MTIPELSKNMDQV
Sbjct: 61  HEFGQLTSWELESAIWDYCFFNPDEF--NGFDLKDSKGQHLVVSETCMTIPELSKNMDQV 118

Query: 121 IFEEYDFKSMFKGPVAQYIPF------YQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           +FEEY+F SMFK P+A + PF        G+  D     AE     +Y+ FQLVID GFN
Sbjct: 119 VFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAE---PDAYEPFQLVIDVGFN 175

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVP 234
           CTW VP+IKG+PYYKA+KKLDIGGRFL GLL+ET+SFRHYNVM+ETILVNNIKE C FV 
Sbjct: 176 CTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKENCLFVS 235

Query: 235 PESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSVPETFF 294
           P SYF SF +K  T VEYVLPDFQTSFLGYVK P K+             E+FSVPETFF
Sbjct: 236 PVSYFESFKHKEQTAVEYVLPDFQTSFLGYVKDP-KKPLPQDSQTVELKDELFSVPETFF 294

Query: 295 HPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCP 354
           HPEI Q+LKPGI+ETILE +++ PE +RPL++ NIVCTGGNFN+PNF  RL TELQRQ P
Sbjct: 295 HPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATELQRQLP 354

Query: 355 IDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGYQQW 414
            DW+C VH P    K L+GW SM  F NS  +  ARVTREEY EHG+DWCT++RFGYQ W
Sbjct: 355 TDWTCTVHLPS-GPKELYGWSSMASFTNSPLYSDARVTREEYFEHGVDWCTRHRFGYQNW 413

Query: 415 L 415
           +
Sbjct: 414 M 414

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/423 (60%), Positives = 311/423 (73%), Gaps = 12/423 (2%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60
           M +  ++IDNGSYE+KFG +    P RALN L +DKY   HLSNQ  +++DIS    RRP
Sbjct: 1   MDDTPIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHLSNQVSRLKDISNVQFRRP 60

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120
           HELGQL SWEL+S +WDYC YN D+F+W +    +TK  HLV+SE  M++PELSK  DQV
Sbjct: 61  HELGQLTSWELQSCIWDYCLYNPDEFNWEI---GNTKGKHLVLSEMCMSMPELSKGTDQV 117

Query: 121 IFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAED---KKTSS-----YKDFQLVIDSG 172
           +FEEY+F S FKGPVA ++PF     + + + A ED   +K S+     Y DFQLVIDSG
Sbjct: 118 VFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYNDFQLVIDSG 177

Query: 173 FNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTF 232
           FNCTW VPI+KG+PYYKAIKKLDIGGRFL G L+ET+SFRHYNVM+ETILVNNIKE+C F
Sbjct: 178 FNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHYNVMDETILVNNIKEKCLF 237

Query: 233 VPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSVPET 292
           + P SYF+SF  K +T  EYVLPDFQTSF GYVK+  K+K            E+FS+PET
Sbjct: 238 MSPVSYFNSFQKKEDTTAEYVLPDFQTSFQGYVKQQ-KQKIPEDSQTIKLYDELFSIPET 296

Query: 293 FFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQ 352
           FFHPEIA +LKPGIVETILE I+M PE +RPL+V+N V TGGNFNI NF  RL TELQRQ
Sbjct: 297 FFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNFARRLATELQRQ 356

Query: 353 CPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGYQ 412
           CP DW   V  P   D +L GW+SM+ F+ +  ++  RVTREEY EHG+DWCTK RFGYQ
Sbjct: 357 CPTDWDVCVSVPNASDTALFGWDSMRQFSQTTAYQQTRVTREEYYEHGVDWCTKQRFGYQ 416

Query: 413 QWL 415
           +WL
Sbjct: 417 KWL 419

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/424 (59%), Positives = 311/424 (73%), Gaps = 14/424 (3%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60
           M E  L+IDNGSYEIKFG     +P RALN + KDKY  +HLSNQ + ++DIS  +  RP
Sbjct: 1   MEESPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRSIKDISSVVFNRP 60

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119
           HELGQLVSWELE+++WDYC +N DDF+ W++   + TK  HL+ SE+ MTIPELSKNMDQ
Sbjct: 61  HELGQLVSWELETQIWDYCLFNPDDFNGWSI---DTTKGKHLITSESCMTIPELSKNMDQ 117

Query: 120 VIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTA--------AEDKKTSSYKDFQLVIDS 171
           V+FEEY+F++MFK PV  ++PF  G+     + A        +E     +Y DFQLVIDS
Sbjct: 118 VVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNYNDFQLVIDS 177

Query: 172 GFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCT 231
           GFNC+W VP+IKGVPYYKA+KKLDIGGRFL G L+E +SFRHYNVM+ETILVN+IKE C 
Sbjct: 178 GFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKENCL 237

Query: 232 FVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSVPE 291
           F+ P +YF SF ++  T  EYVLPDF TSF GY++KPG +             E+F+VPE
Sbjct: 238 FMSPNAYFESFQSRSKTAKEYVLPDFNTSFQGYLRKPG-QVLPAESQTIVLQDELFAVPE 296

Query: 292 TFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQR 351
           TFFHPEIA +L  GIVETILE I+M PE +RPL+V NIV TGGNFNIPNF  RL TELQR
Sbjct: 297 TFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIPNFASRLATELQR 356

Query: 352 QCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGY 411
           QCP DWSC+V  P+  D  L+GW+ M+ F+ ++ +  +RVTR+EY EHG+DWCT  RFGY
Sbjct: 357 QCPTDWSCRVSLPK-GDAGLYGWKCMQKFSETEDYHESRVTRQEYYEHGVDWCTAKRFGY 415

Query: 412 QQWL 415
           Q WL
Sbjct: 416 QAWL 419

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/425 (58%), Positives = 315/425 (74%), Gaps = 15/425 (3%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60
           M E  +VIDNGSYEIKFG +  ++P  ALN + KDKY  +HLSNQ + ++DIS     RP
Sbjct: 1   MEEAPIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRSIKDISSVTFNRP 60

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119
           H+LGQLVSWELES++WDYC +N D+F  W+L   + TK+ HL+ SE+ MT+PELSKNMDQ
Sbjct: 61  HKLGQLVSWELESQIWDYCLFNPDEFDGWSL---DTTKNKHLIASESCMTLPELSKNMDQ 117

Query: 120 VIFEEYDFKSMFKGPVAQYIPF-YQGQ------YQDDAMTAAEDKKTSS--YKDFQLVID 170
           V+FEEY++ S+FK PV  ++PF  +G        ++DA   A D  + +  Y+D++LVID
Sbjct: 118 VVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDYRDYELVID 177

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQC 230
           SGFNCTW VP+IKGVPYYKA+KKLDIGGRFL G L+E +SFRHYNVM+ETILVN+IKE+C
Sbjct: 178 SGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHYNVMDETILVNSIKEKC 237

Query: 231 TFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSVP 290
            F+ P SYF SF +++ T  EYVLPDF TSF GY++KPG +             E+F+VP
Sbjct: 238 LFMSPNSYFDSFQSRLKTAKEYVLPDFSTSFQGYLRKPG-QTLPEDSQTIILQDELFAVP 296

Query: 291 ETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQ 350
           ETFFHPEIA +L PGI+E ILE I+M PE +RPLLV N+V TGGNFNIPNF  RL TELQ
Sbjct: 297 ETFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIPNFASRLATELQ 356

Query: 351 RQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFG 410
           RQCP DWSC+V  P   D  L+GW+ M+ F+ +  +R +RV+REEY EHG+DWCT  RFG
Sbjct: 357 RQCPTDWSCRVSVPT-GDARLYGWKCMQKFSETQAYRESRVSREEYYEHGVDWCTSKRFG 415

Query: 411 YQQWL 415
           YQ WL
Sbjct: 416 YQAWL 420

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score =  525 bits (1352), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/422 (59%), Positives = 316/422 (74%), Gaps = 13/422 (3%)

Query: 2   SEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRPH 61
           SEP LV+DNGSYE+KFG S   QP RALN L +DK+   +LSNQ  +++DIS    +RPH
Sbjct: 3   SEP-LVVDNGSYEVKFGYSTTSQPFRALNALARDKFGATYLSNQINQIKDISSVSFKRPH 61

Query: 62  ELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120
           E GQL SWEL+S VWDYCF+N ++F  ++L    D+K  HL+ SET MT+PELSKNMDQV
Sbjct: 62  EYGQLTSWELQSCVWDYCFFNPNEFDGFDL---KDSKGQHLIASETCMTLPELSKNMDQV 118

Query: 121 IFEEYDFKSMFKGPVAQYIPFYQG-------QYQDDAMTAAEDKKTSSYKDFQLVIDSGF 173
           +FEEY+F S+ K P++ ++PF +          + D+ +     +T  Y+ FQ+VIDSGF
Sbjct: 119 VFEEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTSTSETKDYEPFQMVIDSGF 178

Query: 174 NCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFV 233
           NCTW VPIIKGVP+YKA+KKLD+GGRF+ GLL+ET+SFRHYNVM+ETILVNNIKE+C F+
Sbjct: 179 NCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHYNVMDETILVNNIKEKCLFM 238

Query: 234 PPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSVPETF 293
            P SYF SF  K  T VEYVLPDFQT+FLGYV    K              E+FSVPETF
Sbjct: 239 SPVSYFDSFAKKDQTAVEYVLPDFQTTFLGYVAD-RKNPPSKDAQTVTLRDELFSVPETF 297

Query: 294 FHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQC 353
           FHPEIAQ+LKPGI+ETILE +++ PE +RPL+V+NI+CTGGNFN+P+F ERL TELQRQ 
Sbjct: 298 FHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERLATELQRQL 357

Query: 354 PIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGYQQ 413
           P DWS K++ PQ K   L GW SM  FA++D +++ARV+R+EY EHG++W TKNRFGYQ 
Sbjct: 358 PTDWSAKIYLPQPKSCELAGWCSMSAFASTDLYKAARVSRQEYYEHGVEWTTKNRFGYQN 417

Query: 414 WL 415
           W+
Sbjct: 418 WI 419

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/442 (58%), Positives = 310/442 (70%), Gaps = 31/442 (7%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60
           M  P +VIDNGSYEIKFG S   +P RALN L KDK+   +LSN  K ++DIS    RRP
Sbjct: 1   METPPIVIDNGSYEIKFGPSTNKKPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119
           HELGQL  WELES +WDYC +N  +F  ++L    + K HHLV SE+ MT+PELSK+ DQ
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDL---KEGKGHHLVASESCMTLPELSKHADQ 117

Query: 120 VIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDK---------------------- 157
           VIFEEY+F S+FK PVA ++PF +    +    + +D+                      
Sbjct: 118 VIFEEYEFDSLFKSPVAVFVPFTKSYKGEMRTISGKDEDIDIVRGNSDSTNSTSSESKNA 177

Query: 158 --KTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN 215
               S Y DFQLVIDSGFNCTW +P++KG+PYYKA+KKLDIGGRFLTGLL+ET+SFRHYN
Sbjct: 178 QDSGSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYN 237

Query: 216 VMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXX 275
           +M+ETILVNNIKEQC FV P SYF SF  K    +EYVLPDFQTSFLGYV+ P KE    
Sbjct: 238 MMDETILVNNIKEQCLFVSPVSYFDSFKTKDKHALEYVLPDFQTSFLGYVRNPRKENVPL 297

Query: 276 --XXXXXXXXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTG 333
                      E+F++PETFFHPEI+QI KPGIVE ILE ++M PE+VRPL+V NIVCTG
Sbjct: 298 PEDAQIITLTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357

Query: 334 GNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTR 393
           GNFN+PNF +RL  ELQRQ P DW+C V  P E D +L GWE M  FA +D +R ARVTR
Sbjct: 358 GNFNLPNFAQRLAAELQRQLPTDWTCHVSVP-EGDCALFGWEVMSQFAKTDSYRKARVTR 416

Query: 394 EEYLEHGLDWCTKNRFGYQQWL 415
           EEY EHG DWCTK+RFGYQ W+
Sbjct: 417 EEYYEHGPDWCTKHRFGYQNWI 438

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/442 (58%), Positives = 319/442 (72%), Gaps = 31/442 (7%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60
           M  P +VIDNGSYEIKFG S    P RALN L KDK+   +LSN  K ++DIS    RRP
Sbjct: 1   MEAPPIVIDNGSYEIKFGPSTNKMPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119
           HELGQL  WELES +WDYC +N  +F  ++L    + K HHLV SE+ MT+PELSK+ DQ
Sbjct: 61  HELGQLTLWELESCIWDYCLFNPSEFDGFDL---KEGKGHHLVASESCMTLPELSKHADQ 117

Query: 120 VIFEEYDFKSMFKGPVAQYIPF---YQGQYQ---------DDAMTAAEDKKTSS------ 161
           VIFEEY+F S+FK PVA ++PF   Y+G+ +         D A++ ++DK  +S      
Sbjct: 118 VIFEEYEFDSLFKSPVAVFVPFTKSYKGKMRTISGKDEDADVAISDSDDKTFTSKEPVDE 177

Query: 162 ------YKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN 215
                 Y DFQLVIDSGF+CTW +P++KG+PYYKA+KKLDIGGRFLTGLL+ET+SFRHYN
Sbjct: 178 TNSNNDYHDFQLVIDSGFDCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYN 237

Query: 216 VMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKX-- 273
           +M+ETILVNNIKE+C FV P SYF SF +K    +EYVLPDFQTSF+GYV+ P +E    
Sbjct: 238 MMDETILVNNIKEKCLFVSPTSYFDSFKSKNKHVLEYVLPDFQTSFIGYVRHPNEEDSPL 297

Query: 274 XXXXXXXXXXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTG 333
                      E+F++PETFFHPEI+QI+KPGIVE ILE ++M PE+VRPL++ NIVCTG
Sbjct: 298 PTDAQSITLTDELFTIPETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTG 357

Query: 334 GNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTR 393
           GNFN+PNF +RL  ELQRQ P DW+C V  P E D +L GWE M  FA ++ ++ ARVTR
Sbjct: 358 GNFNLPNFAQRLARELQRQLPTDWTCNVSVP-EGDCTLFGWEVMSQFAKTESYQRARVTR 416

Query: 394 EEYLEHGLDWCTKNRFGYQQWL 415
           EEY EHG DWCTK+RFGYQ W+
Sbjct: 417 EEYYEHGPDWCTKHRFGYQNWI 438

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/424 (58%), Positives = 310/424 (73%), Gaps = 13/424 (3%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60
           M E  +VIDNGSY +KFG +  + P  ALN +  DKY   +LSNQ K ++DIS   I+RP
Sbjct: 1   MEETPVVIDNGSYRVKFGPASLEAPYCALNAIANDKYDASYLSNQIKSIKDISSVSIKRP 60

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120
           H LGQL SWE+++ +WDYC YN D+F  N  +  DTK  HL+ SET MT+PEL KNMDQV
Sbjct: 61  HTLGQLTSWEMQTLIWDYCLYNPDEF--NGFNIGDTKSKHLITSETCMTLPELGKNMDQV 118

Query: 121 IFEEYDFKSMFKGPVAQYIPFYQGQY------QDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           IFEEY+F S+ K PVA Y+PF +         + D     E   T  Y+DFQLV+DSGFN
Sbjct: 119 IFEEYEFGSLMKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQLVVDSGFN 178

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVP 234
           CTW +P+IKG+PYYKA+KKLDIGGRFL GLL+ET+SFRHYNVM+ETILVNNIKE+C FV 
Sbjct: 179 CTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHYNVMDETILVNNIKEKCLFVS 238

Query: 235 PESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXX---XXXXXXXXXXEVFSVPE 291
           P SYF SF NK  T  EYVLPDFQTSFLGYV +P  E+               E+F+VPE
Sbjct: 239 PASYFDSFKNKDITSREYVLPDFQTSFLGYV-RPSNEQGKPLPEDSQSITLKDELFAVPE 297

Query: 292 TFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQR 351
           TFFHPEI+QILKPG+VETILE ++M PEV+RPL+V+NI+C GGNFN+P+F  R+  ELQR
Sbjct: 298 TFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPHFASRVAKELQR 357

Query: 352 QCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGY 411
           Q P DW C++ +  + +  L GW++M  FA++D +++ RVTREEY EHG+DWCTK+RFGY
Sbjct: 358 QLPTDWKCRI-TISKGNSELSGWKAMSSFASTDIYKATRVTREEYYEHGIDWCTKHRFGY 416

Query: 412 QQWL 415
           Q W+
Sbjct: 417 QNWV 420

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  521 bits (1343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/442 (57%), Positives = 314/442 (71%), Gaps = 31/442 (7%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60
           M    +VIDNGSYEIKFG S  ++P RALN L KDK+   +LSN  K ++DIS    RRP
Sbjct: 1   METAPIVIDNGSYEIKFGPSTNEKPFRALNALAKDKFGTSYLSNHIKNIKDISSVTFRRP 60

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119
           HELGQL  WELES +WDYCF+N  +F  ++L    + K HHLV SE+ MT+PELSK+ DQ
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPIEFDGFDL---KEGKGHHLVASESCMTLPELSKHADQ 117

Query: 120 VIFEEYDFKSMFKGPVAQYIPFYQ----------GQYQDDAMTAAEDKKT---------- 159
           VIFEEY+F S+FK PVA ++PF +          G+ +D  +  ++  +           
Sbjct: 118 VIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADMPSNNPRDT 177

Query: 160 ----SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN 215
               S Y DFQLVIDSGFNCTW +P++KG+PYYKA+KKLD+GGRFLTGLL+ET+SFRHYN
Sbjct: 178 QKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKETLSFRHYN 237

Query: 216 VMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKX-- 273
           +M+ETILVNNIKE+C FV P SYF SF  K    +EYVLPDFQTSFLGYV+   KE    
Sbjct: 238 MMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHALEYVLPDFQTSFLGYVRNRRKENSPL 297

Query: 274 XXXXXXXXXXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTG 333
                      E+F++PETFFHPEIAQI KPGIVE ILE ++M PE+VRPL+V NIVCTG
Sbjct: 298 AEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357

Query: 334 GNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTR 393
           GNFN+PNF +RL  ELQRQ P DW+C V  P E D +L GWE M  F+++  +R+ARVTR
Sbjct: 358 GNFNLPNFAQRLAAELQRQLPTDWTCHVSVP-ESDCALFGWEVMSQFSSTASYRNARVTR 416

Query: 394 EEYLEHGLDWCTKNRFGYQQWL 415
           EEY EHG DWCTK+RFGYQ W+
Sbjct: 417 EEYYEHGSDWCTKHRFGYQNWI 438

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score =  520 bits (1339), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/431 (60%), Positives = 310/431 (71%), Gaps = 20/431 (4%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60
           M +  +VIDNGSYE+KFG S    P RALN L KDKY  ++LSNQ   ++DIS   IRRP
Sbjct: 1   MEQNPIVIDNGSYEVKFGYSDAKVPNRALNALAKDKYGAWYLSNQMNNIKDISSVTIRRP 60

Query: 61  HELGQLVSWELESEVWDYCFYNEDDF-HWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119
           HELGQLVSWELE  VWDYCF+N D+F ++NL    +TK HHLVVSET MT+PELS NMDQ
Sbjct: 61  HELGQLVSWELEGTVWDYCFFNPDEFPNFNL---KETKGHHLVVSETCMTLPELSANMDQ 117

Query: 120 VIFEEYDFKSMFKGPVAQYIPFYQGQYQ--------DDAMTAAEDKKTSS-----YKDFQ 166
           V+FEEY+F+S+FK PVA ++PF   Q          DD M        S      Y DF 
Sbjct: 118 VMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKNPYSDFN 177

Query: 167 LVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNI 226
           LVIDSGFNCTW +PIIKGVPYYKA+KK+++GGRFL GL +ETIS+RHY+V +ETILVNNI
Sbjct: 178 LVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHYDVTDETILVNNI 237

Query: 227 KEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVK-KPGKEKXXXXXXXXXXXXE 285
           KE+C F+ P SY  SF NK    V+YVLPDFQTSF+GYVK K    +            E
Sbjct: 238 KEKCLFMSPTSYMDSFKNKDRYSVDYVLPDFQTSFIGYVKDKKSNSQLPENSQVITLTDE 297

Query: 286 VFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERL 345
           +FSVPET FHPE+A++LKPGIVETILE +++ PE +RPLLV NIVC GGNFN+PNF  RL
Sbjct: 298 LFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGNFNMPNFGSRL 357

Query: 346 QTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFA-NSDQFRSARVTREEYLEHGLDWC 404
            TELQRQ P DW C ++ P EKD  L GW+SM  FA N+D ++ AR++REEY EHG DW 
Sbjct: 358 ATELQRQLPTDWVCNIYIP-EKDCELQGWKSMSQFAQNTDIYKKARISREEYYEHGTDWT 416

Query: 405 TKNRFGYQQWL 415
           TK RFGYQ W+
Sbjct: 417 TKKRFGYQNWI 427

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/442 (57%), Positives = 311/442 (70%), Gaps = 31/442 (7%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60
           M    +VIDNGSYEIKF  S  + P RALN L KDK+   +LSN  K ++DIS    RRP
Sbjct: 1   MERSPIVIDNGSYEIKFAPSTNEMPFRALNALAKDKFGTSYLSNHIKNIKDISSITFRRP 60

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFH-WNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119
           HELGQL  WELES +WDYCF+N  +F  ++L    + K HHLV SE+ MT+PELSK+ DQ
Sbjct: 61  HELGQLTLWELESCIWDYCFFNPSEFRGFDL---KEGKGHHLVASESCMTLPELSKHADQ 117

Query: 120 VIFEEYDFKSMFKGPVAQYIPF---YQGQY--------QDDAMTAAEDKKT--------- 159
           VIFEEY+F S+FK PVA ++PF   Y+G+         + D +T+     T         
Sbjct: 118 VIFEEYEFDSLFKSPVAVFVPFTKSYKGKLKTISGKDEEADVVTSNSGITTFTSRECGSA 177

Query: 160 ----SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN 215
               S Y DFQLVIDSGFNCTW +P++KG+PYYKA+KKLDIGGRFLTGLL+ET+SFRHYN
Sbjct: 178 QNSDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHYN 237

Query: 216 VMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXX 275
           +M+ETILVNN+KE+C FV P SYF SF  K    +EYVLPDFQTSF+GYV+ P +E    
Sbjct: 238 MMDETILVNNVKEKCLFVSPVSYFDSFKAKDKHALEYVLPDFQTSFIGYVRNPREENSPL 297

Query: 276 --XXXXXXXXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTG 333
                      E+F++PETFFHPEI+QI KPGIVE ILE ++M PE+VRPL+V NIVCTG
Sbjct: 298 PEDAQTIALTDELFTIPETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTG 357

Query: 334 GNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTR 393
           GNFN+PNF +RL  ELQRQ P DW+C V  P   D +L GWE M  FA ++ +R ARVTR
Sbjct: 358 GNFNLPNFAQRLAAELQRQLPTDWTCHVSVPI-GDCALFGWEVMSQFAKTESYRRARVTR 416

Query: 394 EEYLEHGLDWCTKNRFGYQQWL 415
           +EY EHG DWCTK RFGYQ W+
Sbjct: 417 DEYYEHGPDWCTKQRFGYQNWI 438

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/445 (55%), Positives = 319/445 (71%), Gaps = 33/445 (7%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60
           M +  +VIDNGSYEIKFG S    P RA+N + KDKY+  +LSNQ K ++DIS    RRP
Sbjct: 1   MDDLPIVIDNGSYEIKFGVSNSRIPFRAINAIAKDKYNTVYLSNQIKGIKDISSVNFRRP 60

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120
           +ELGQL SWELES +WDYCFYN ++F  +     DT   HLV+SET +++PE S+N+D +
Sbjct: 61  YELGQLTSWELESAIWDYCFYNPEEF--DGFQLEDTSKKHLVISETCLSLPEFSRNIDHI 118

Query: 121 IFEEYDFKSMFKGPVAQYIPFY--------------------QGQYQDDAMT-------A 153
           IFEEY++ S++K PVA +IPF                       ++Q+  +T       +
Sbjct: 119 IFEEYNYGSIYKSPVAGFIPFADLTKDVISISGKADDDDDDNNAKFQEQLVTNDLNTYIS 178

Query: 154 AED---KKTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETIS 210
           +E+    KT+ YKDFQL+IDSGFNCTW +P+IKG+PYYKAIKK+DIGGRFLTGLL+ET+S
Sbjct: 179 SEEPSVTKTAEYKDFQLIIDSGFNCTWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLS 238

Query: 211 FRHYNVMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGK 270
           FRHYNV +ETILVNNIKE+C FV P+SY  SF  K  T VEYVLPDF T+F+GY+K   K
Sbjct: 239 FRHYNVTDETILVNNIKEKCLFVAPKSYAESFKLKNKTAVEYVLPDFHTTFMGYIKDNSK 298

Query: 271 EKXXXXXXXXXXXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIV 330
            K            E+FSV ET FHPEI++ILKPGI+ETI+E ++M PEV+RPL+V NIV
Sbjct: 299 TKLPDNAQLITLKDELFSVTETIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIV 358

Query: 331 CTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSAR 390
           C GGNFN+PNF +RL +ELQRQ P DW+  V+ P+  D  L GW++M  F+++D +R AR
Sbjct: 359 CIGGNFNLPNFSKRLTSELQRQLPTDWTTHVYIPK-IDAELFGWKAMAQFSDTDSYRKAR 417

Query: 391 VTREEYLEHGLDWCTKNRFGYQQWL 415
           +TREEY+EHG++WCTK+RFGYQ W+
Sbjct: 418 ITREEYMEHGVEWCTKHRFGYQNWI 442

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 252/442 (57%), Positives = 314/442 (71%), Gaps = 30/442 (6%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60
           M    LV+DNGSYEIKFG S  ++P RALN    DKY   +LSNQ KK++++S+  +RRP
Sbjct: 1   MDSTPLVLDNGSYEIKFGLSNSERPYRALNGFAVDKYGSAYLSNQMKKIQEVSEVTLRRP 60

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120
           HELGQL SWELES +WDYC YN D+F       +  K  HL+VSE  MT+PELSKNMDQV
Sbjct: 61  HELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKK--HLIVSEPCMTLPELSKNMDQV 118

Query: 121 IFEEYDFKSMFKGPVAQYIPF-------------YQGQYQDDAMTA------------AE 155
           IFEEY+F S+FK P A YIPF               G+  DD M               +
Sbjct: 119 IFEEYEFDSLFKAPTAGYIPFGVQADDRKVLLDTISGKKNDDDMIGQSENVTISTDNLKD 178

Query: 156 DKK--TSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
           DKK  ++ Y+D++LVIDSGFNCTW +P+IKGVPYYKAIKKLDIGGRFLTGLL+ET+SFRH
Sbjct: 179 DKKKFSNDYQDYELVIDSGFNCTWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRH 238

Query: 214 YNVMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKX 273
           Y++M+ET+LVNNIKE+C FV P SYF SF  K  T VEY+LPD  +S+LGY ++   +  
Sbjct: 239 YDLMDETLLVNNIKEKCLFVSPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPL 298

Query: 274 XXXXXXXXXXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTG 333
                      E+FSVPETFFHPEI++ILKPGIVETILE ++M PE++RPLLVANIVCTG
Sbjct: 299 PEGSQVVKLYDELFSVPETFFHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTG 358

Query: 334 GNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTR 393
           GNFN+P+F  RL  ELQRQ P DW+C++  P+ K+  L  W+SM  FAN+D ++  R+++
Sbjct: 359 GNFNLPHFAARLAAELQRQLPTDWTCRISVPK-KECELFSWKSMCQFANTDSYKKTRISK 417

Query: 394 EEYLEHGLDWCTKNRFGYQQWL 415
           EEY EHG DW TK++FGYQ WL
Sbjct: 418 EEYYEHGPDWLTKHKFGYQNWL 439

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score =  511 bits (1315), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 247/425 (58%), Positives = 305/425 (71%), Gaps = 15/425 (3%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60
           M    + IDNGSYEIKFG +    P RA+N    DKY   +LSNQ K ++DI+    RRP
Sbjct: 1   MESSPIAIDNGSYEIKFGTTDLSSPYRAINAFAIDKYHTTYLSNQIKNIKDITSVTFRRP 60

Query: 61  HELGQLVSWELESEVWDYCFYNEDDF-HWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119
           HELGQL SWELES +WDY  +N D+F  ++L   ND K  HL+ SET MT+PELSKNMDQ
Sbjct: 61  HELGQLTSWELESSIWDYALFNPDEFPGFDL---NDLKGKHLIASETCMTLPELSKNMDQ 117

Query: 120 VIFEEYDFKSMFKGPVAQYIPF--------YQGQYQDD-AMTAAEDKKTSSYKDFQLVID 170
           V+FEEY+F S +K  +A +I F          G+ ++D ++ +    +   Y D+QLVID
Sbjct: 118 VVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYNDYQLVID 177

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQC 230
           SGFNCTW +P+IKGVPYYKA+KKLDIGGRFL GLL+ET+SFRHY+VM+ETILVNNIKE C
Sbjct: 178 SGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETILVNNIKENC 237

Query: 231 TFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSVP 290
            FV P SYF SF NK  T VEYVLP+FQT+FLG+V+   K              E+FSVP
Sbjct: 238 LFVSPTSYFDSFKNKNETAVEYVLPNFQTTFLGHVRDKTK-PLPENTQTIKLYDELFSVP 296

Query: 291 ETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQ 350
           ETFFHPEIA+ILKPG+VETILE ++M PE++RPLLV N+VCTGGNFN+P+F  RL +ELQ
Sbjct: 297 ETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLPHFATRLTSELQ 356

Query: 351 RQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFG 410
           RQ P DW C+   P  K+  L GW++M  FA+++ +R  RVTREEY EHG DW TKNRFG
Sbjct: 357 RQLPTDWICRTSVPT-KECELFGWKAMAQFASTESYRKTRVTREEYYEHGTDWLTKNRFG 415

Query: 411 YQQWL 415
           YQ W+
Sbjct: 416 YQNWI 420

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score =  507 bits (1306), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 247/422 (58%), Positives = 299/422 (70%), Gaps = 13/422 (3%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRPHELGQ 65
            VIDNGSYEIKFG +    P RA N + KDKY   +LSN  K +RDIS A IRRPHELGQ
Sbjct: 4   FVIDNGSYEIKFGHANLVTPFRANNGIAKDKYGASYLSNHMKTIRDISSATIRRPHELGQ 63

Query: 66  LVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQVIFEEY 125
           LVSWELE  +WDYC YN D+F      DN T++  L+++ET  T+PELSKN DQV+FEEY
Sbjct: 64  LVSWELEGCIWDYCLYNPDEFDGFHLGDN-TREQDLILTETCFTLPELSKNSDQVVFEEY 122

Query: 126 DFKSMFKGPVAQYIPFYQ--GQY-------QDDAM-TAAEDKKTSSYKDFQLVIDSGFNC 175
           +F +MFK P + ++PF    G         +D A+ T      T  Y+DFQLVIDSGFNC
Sbjct: 123 EFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRDFQLVIDSGFNC 182

Query: 176 TWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVPP 235
           TW VPIIKGVP+YKAIKK+DIGGRFL GLL+ET+SFRHYN+M+ETIL+NNIKE+C FV P
Sbjct: 183 TWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHYNMMDETILLNNIKEKCLFVSP 242

Query: 236 ESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKX--XXXXXXXXXXXEVFSVPETF 293
            SYF SF  K    VEYVLPDFQTSFLGY+      K              E F+VPETF
Sbjct: 243 VSYFDSFKTKQQQAVEYVLPDFQTSFLGYLVDESNRKGIDRGSVQTITLTDERFAVPETF 302

Query: 294 FHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQC 353
           FHPE+A ILKPG+VETILE I+M PE +RP+LV+NIVC GGNF +P+   RL +ELQRQ 
Sbjct: 303 FHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKLPHMSSRLTSELQRQL 362

Query: 354 PIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGYQQ 413
           P DW+C+V  P   D  L  W +M  F+++D +++ RVTREEYLEHG DWC+K+RF YQ 
Sbjct: 363 PTDWTCRVTVPSSSDCELAAWNAMAQFSSTDVYKTTRVTREEYLEHGTDWCSKHRFTYQN 422

Query: 414 WL 415
           W+
Sbjct: 423 WI 424

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score =  507 bits (1305), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 241/424 (56%), Positives = 299/424 (70%), Gaps = 15/424 (3%)

Query: 2   SEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRPH 61
           ++  +VIDNGSY++KFG +   +P  ALN L KDKY   HLSNQ + ++DIS  + RRPH
Sbjct: 3   ADQAIVIDNGSYQVKFGLASEVRPRVALNALAKDKYGVTHLSNQVQNIKDISSVVFRRPH 62

Query: 62  ELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQVI 121
           ELGQL SWELES +WDYC YN D+F  +       ++ H+V+SET MT+PELSKN DQV+
Sbjct: 63  ELGQLTSWELESCIWDYCLYNPDEFGIDW---QSLENRHVVLSETCMTLPELSKNTDQVL 119

Query: 122 FEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAED----------KKTSSYKDFQLVIDS 171
           FEEY+  S++K P A YIPFY        ++   D          +    Y DF LVIDS
Sbjct: 120 FEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAGKEYNDFSLVIDS 179

Query: 172 GFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCT 231
           GFNCTW +PI+KGVPYYKA+KKLD+GGRFL GLL+ETISFRHYNVM+E+ILVNNIKEQC 
Sbjct: 180 GFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHYNVMDESILVNNIKEQCL 239

Query: 232 FVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSVPE 291
           +V P SYF +F  K   K+++VLPDFQTSF GYV+ P K              E FSVPE
Sbjct: 240 YVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDP-KTALPDNAQILTLTDERFSVPE 298

Query: 292 TFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQR 351
            FFHPEI+Q LKPGI+ET+LE I M PE++RPL+ +NIVC GGNFN+P F +RL +ELQR
Sbjct: 299 AFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNLPGFTDRLVSELQR 358

Query: 352 QCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRFGY 411
           Q P DW C+       DKSL GW +M  FA++D ++ ARVT+E+Y EHGLDW TK RFGY
Sbjct: 359 QLPTDWVCRAKI-SSGDKSLTGWTAMAKFAHTDAYKKARVTKEDYFEHGLDWTTKERFGY 417

Query: 412 QQWL 415
           Q W+
Sbjct: 418 QNWV 421

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score =  491 bits (1263), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 236/424 (55%), Positives = 300/424 (70%), Gaps = 12/424 (2%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRP 60
           M E  L+IDNGSYEIKFG S  + P  ALN L KDKY  ++LSNQ   ++DIS   I+RP
Sbjct: 1   MGEAPLLIDNGSYEIKFGYSNQETPFVALNALAKDKYETYYLSNQINNIKDISSVSIKRP 60

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120
           H+LGQLVSWELE E+WDYCFYN DDF       N+  ++HLV++ET MT+PELS+N DQV
Sbjct: 61  HQLGQLVSWELEHEIWDYCFYNGDDFKG--FEVNEDSENHLVLTETPMTLPELSRNTDQV 118

Query: 121 IFEEYDFKSMFKGPVAQYIPFYQG------QYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           +FEEY F S++K P A +IPF +       +    + T  +  K ++Y+DF LVIDSG+N
Sbjct: 119 VFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVIDSGYN 178

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVP 234
           C+W +P+IKGVPYYKA+KK+D+GGRFL GLL+ETIS+RHY+V +E++LVNNIKE C F+ 
Sbjct: 179 CSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHYDVTDESMLVNNIKENCMFIS 238

Query: 235 PESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXX-XXXXXXXXXXEVFSVPETF 293
           P SY  SF  K  TKVEYVLPDFQTSF+GYV+   K               E+FSVPE F
Sbjct: 239 PVSYIESFKKKALTKVEYVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILEDELFSVPEGF 298

Query: 294 FHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQC 353
           FHPE+A +LKPGI+ETILE + + PE +R L+V NIVCTGGNFNIPNF  R+ TELQ+Q 
Sbjct: 299 FHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSRIYTELQKQV 358

Query: 354 PIDWSCKVHSPQEKDKSLHGWESMKDFA--NSDQFRSARVTREEYLEHGLDWCTKNRFGY 411
             +W C V  P+  +  L  W++MK F   N + ++  RVT++EY EHG +W TK RFGY
Sbjct: 359 QTEWVCDVSIPK-ANAELQNWKAMKSFTENNEELYKHTRVTKQEYNEHGFEWTTKQRFGY 417

Query: 412 QQWL 415
           Q WL
Sbjct: 418 QNWL 421

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  123 bits (309), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 170/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G     AI ++D+ GR LT  L + +S R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSLPHAIMRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTAAQSSSIEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG    P  
Sbjct: 252 --NERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMEVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  123 bits (308), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 110/419 (26%), Positives = 170/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G     AI ++D+ GR LT  L + +S R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTAAQSSSIEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP I  +   GI +T    I  C   VR  L  NIV +GG    P  
Sbjct: 252 --NERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  122 bits (306), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 170/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G     AI ++D+ GR LT  L + +S R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTAAQSSSIEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG    P  
Sbjct: 252 --NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  122 bits (306), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 170/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G     AI ++D+ GR LT  L + +S R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTAAQSSSIEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG    P  
Sbjct: 252 --NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  122 bits (306), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 170/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G     AI ++D+ GR LT  L + +S R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTAAQSSSIEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG    P  
Sbjct: 252 --NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  122 bits (306), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 170/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G     AI ++D+ GR LT  L + +S R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTAAQSSSIEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG    P  
Sbjct: 252 --NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  122 bits (306), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 170/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G     AI ++D+ GR LT  L + +S R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTAAQSSSIEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG    P  
Sbjct: 252 --NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  122 bits (306), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 170/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G     AI ++D+ GR LT  L + +S R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTAAQSSSIEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG    P  
Sbjct: 252 --NERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  122 bits (306), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 170/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G     AI ++D+ GR LT  L + +S R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTAAQSSSIEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG    P  
Sbjct: 252 --NERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  122 bits (306), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 170/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G     AI ++D+ GR LT  L + +S R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTAAQSSSIEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG    P  
Sbjct: 252 --NERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGTTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  122 bits (305), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 108/419 (25%), Positives = 170/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G     AI ++D+ GR LT  L + +S R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSMPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTAAQSSSVEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   G+ +T    I  C   VR  L  NIV +GG    P  
Sbjct: 252 --NERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGTTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  122 bits (305), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 109/419 (26%), Positives = 171/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G     AI ++D+ GR LT  L + +S R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTASQSSSIEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG+   P  
Sbjct: 252 --NERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGSTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  122 bits (305), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 108/419 (25%), Positives = 170/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQILFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G     AI ++D+ GR +T  L + +S R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTAAQSSAIEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG    P  
Sbjct: 252 --NERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  121 bits (304), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 108/419 (25%), Positives = 170/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 8   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 63

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 64  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 113

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 114 KSNREKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 155

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G     AI ++D+ GR +T  L + +S R Y+     E  +V +IKE
Sbjct: 156 SGDGVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKE 215

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 216 KLCYVALD-----FEQEMQTAAQSSAIEKSYELPDGQVITIG------------------ 252

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG    P  
Sbjct: 253 --NERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGI 310

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 311 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 367

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  120 bits (302), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 108/419 (25%), Positives = 169/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G      I ++D+ GR LT  L + +S R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTAAQSSSIEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG    P  
Sbjct: 252 --NERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  120 bits (300), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 107/419 (25%), Positives = 170/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KNNREKMTQILFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G     AI ++D+ GR +T  L + ++ R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSLPHAILRIDLAGRDITDYLMKILAERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTASQSSAVEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG    P  
Sbjct: 252 --NERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  120 bits (300), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 107/419 (25%), Positives = 169/419 (40%), Gaps = 82/419 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQILFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKE 228
           SG   T  VPI  G      I ++D+ GR +T  L + +S R Y+     E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTAAQSSAIEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
              E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG    P  
Sbjct: 252 --NERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGI 309

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
            ER+Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 310 AERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 366

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  119 bits (298), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 106/416 (25%), Positives = 175/416 (42%), Gaps = 76/416 (18%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRAL--NCLTKDKYSRF---------HLSNQTKKMRDIS 53
            LVIDNGS   K G +G D P RA+  + + + ++            ++ ++ +  R I 
Sbjct: 8   ALVIDNGSGMCKAGFAGDDAP-RAVFPSIVGRPRHQGIMVGMGQKDCYVGDEAQSKRGI- 65

Query: 54  QALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPEL 113
              +R P E G + +W+   ++W + FYNE             ++H ++++E  M     
Sbjct: 66  -LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNPKSN 116

Query: 114 SKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGF 173
            + M Q++FE ++  + +   +   +  Y                 SS +   +V+DSG 
Sbjct: 117 REKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLDSGD 158

Query: 174 NCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYN--VMEETILVNNIKEQCT 231
             T  VPI  G     AI ++D+ GR +T  L + +S R Y+     E  +V +IKE+  
Sbjct: 159 GVTHVVPIYAGFSLPHAILRIDLAGRDMTDYLMKILSERGYSFSTTAEREIVRDIKEKLC 218

Query: 232 FVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXX 284
           +V  +     +  +M T  +       Y LPD Q   +G                     
Sbjct: 219 YVALD-----YDQEMQTAAQSSAIEKSYELPDGQVITIG--------------------N 253

Query: 285 EVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHER 344
           E F  PE  FHP +  +   GI +T    I  C   VR  L  NIV +GG    P   ER
Sbjct: 254 ERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAER 313

Query: 345 LQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
           +Q E+    P     K+ +P E+  S+  W      A+   F+   ++++EY E G
Sbjct: 314 MQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLTTFQQMWISKQEYDESG 367

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score =  113 bits (282), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 97/376 (25%), Positives = 156/376 (41%), Gaps = 68/376 (18%)

Query: 34  KDKYSRFHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHD 93
           KD Y    + ++ +  R I    +R P E G + +W+   ++W + FYNE          
Sbjct: 35  KDSY----VGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA------ 82

Query: 94  NDTKDHHLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTA 153
              ++H ++++E  M      + M Q++FE ++  + +   +   +  Y           
Sbjct: 83  --PEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVS-IQAVLSLY----------- 128

Query: 154 AEDKKTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
                 SS +   +V+DSG   T  VPI  G     AI ++D+ GR LT  L + +S R 
Sbjct: 129 ------SSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERG 182

Query: 214 YN--VMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGY 264
           Y+     E  +V +IKE+  +V  +     F  +M T  +       Y LPD Q   +G 
Sbjct: 183 YSFSTTAEREIVRDIKEKLCYVALD-----FEQEMQTAAQSSSIEKSYELPDGQVITIG- 236

Query: 265 VKKPGKEKXXXXXXXXXXXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPL 324
                               E F  PE  FHP +  +   GI +T    I  C   VR  
Sbjct: 237 -------------------NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKE 277

Query: 325 LVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSD 384
           L  NIV +GG    P   ER+Q E+    P     K+ +P E+  S+  W      A+  
Sbjct: 278 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 335

Query: 385 QFRSARVTREEYLEHG 400
            F+   ++++EY E G
Sbjct: 336 TFQQMWISKQEYDESG 351

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score =  110 bits (275), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 95/376 (25%), Positives = 155/376 (41%), Gaps = 68/376 (18%)

Query: 34  KDKYSRFHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHD 93
           KD Y    + ++ +  R I    +R P E G + +W+   ++W + FYNE          
Sbjct: 35  KDSY----VGDEAQSKRGI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA------ 82

Query: 94  NDTKDHHLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTA 153
              ++H ++++E  M      + M Q++FE ++  + +   +   +  Y           
Sbjct: 83  --PEEHPVLLTEAPMNPKSNREKMTQILFETFNVPAFYVS-IQAVLSLY----------- 128

Query: 154 AEDKKTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
                 SS +   +V+DSG   T  VPI  G      I ++D+ GR +T  L + +S R 
Sbjct: 129 ------SSGRTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMKILSERG 182

Query: 214 YN--VMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGY 264
           Y+     E  +V +IKE+  +V  +     F  +M T  +       Y LPD Q   +G 
Sbjct: 183 YSFSTTAEREIVRDIKEKLCYVALD-----FEQEMQTAAQSSAIEKSYELPDGQVITIG- 236

Query: 265 VKKPGKEKXXXXXXXXXXXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPL 324
                               E F  PE  FHP +  +   GI +T    I  C   VR  
Sbjct: 237 -------------------NERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKE 277

Query: 325 LVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSD 384
           L  NIV +GG    P   ER+Q E+    P     K+ +P E+  S+  W      A+  
Sbjct: 278 LYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSV--WIGGSILASLT 335

Query: 385 QFRSARVTREEYLEHG 400
            F+   ++++EY E G
Sbjct: 336 TFQQMWISKQEYDESG 351

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score = 99.4 bits (246), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 98/419 (23%), Positives = 175/419 (41%), Gaps = 67/419 (15%)

Query: 6   LVIDNGSYEIKFGESGWDQP-LRALNCLTKDKYSRFH---------LSNQTKKMRDISQA 55
           +V+DNGS  IK G SG ++P     + +   KY++           + NQ +++R + + 
Sbjct: 10  IVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEGDTFIGNQAQELRGLLK- 68

Query: 56  LIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSK 115
            +R P E G + +W     +W Y F              + +DH ++++E  +      +
Sbjct: 69  -LRHPVEHGIVKNWSDMEHIWSYVFNKSLQLQ-------NVEDHPILITEAPLNPRNNRE 120

Query: 116 NMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNC 175
            M +++FE ++  +++   +   +  Y                 +S +    V+D G  C
Sbjct: 121 RMCELLFESFNVPALYVS-IQAVLSLY-----------------ASGRTTGCVVDCGDGC 162

Query: 176 TWAVPIIKGVPYYKAIKKLDIGGR----FLTGLLQETISFRHYNVMEETILVNNIKEQCT 231
             AVP+  G     +I+++DI GR    FL  LL++T      +  E  + V  IKE+  
Sbjct: 163 CHAVPVFDGFSIPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREV-VRIIKEKAC 221

Query: 232 FVPPESYFSSFHNKMNTK-VEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSVP 290
           +V  + +    +  +N    ++ LPD +T  LG                     E F  P
Sbjct: 222 YVAKDPHIEEQNFSINPNYTKFKLPDGKTIDLG--------------------QEKFRAP 261

Query: 291 ETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQ 350
           E  F PE+       + +   + I      +R LL +N++ +GG   +P F +RL +EL+
Sbjct: 262 EILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLLSGGTSILPGFGDRLLSELK 321

Query: 351 RQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
                    K+ +P E+  S   W      +    F+   VTR E+ E   D C  +RF
Sbjct: 322 SLSDSQTKIKIFAPPERKYST--WIGGSILSGLSTFKKLWVTRAEW-EEAAD-CIHSRF 376

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score = 99.0 bits (245), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 103/423 (24%), Positives = 176/423 (41%), Gaps = 68/423 (16%)

Query: 2   SEPVLVIDNGSYEIKFGESGWDQP-LRALNCLTKDKYSRFH---------LSNQTKKMRD 51
           ++PV V+DNGS  IK G SG ++P     + +   KY++           + NQ +++R 
Sbjct: 35  NQPV-VLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEGDTFIGNQAQELRG 93

Query: 52  ISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIP 111
           + +  +R P + G + +W    +VW Y F              + +DH  +V+E  +   
Sbjct: 94  LLK--LRYPLQHGIVTNWADMEQVWGYVFNKSLQLQ-------NVEDHPNLVTEAPLNPH 144

Query: 112 ELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDS 171
           +  + M +++FE ++  +++   V   +  Y                 +S +    V+D 
Sbjct: 145 KNREKMCELLFESFNVPALYVS-VQAVLSLY-----------------ASGRTTGCVVDC 186

Query: 172 GFNCTWAVPIIKGVPYYKAIKKLDIGGR----FLTGLLQETISFRHYNVMEETILVNNIK 227
           G  C  AVP+  G     +I+++DI GR    FL  LL++T      +  E  I V  IK
Sbjct: 187 GDGCCHAVPVFDGFSVPSSIRRIDIAGRDITEFLQLLLRKTTGVSLLSSSEREI-VRTIK 245

Query: 228 EQCTFVPPESYFSSFHNKMNTKV-EYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEV 286
           E+  FV  +      +  MN    ++ LPD +T  LG                     E 
Sbjct: 246 EKACFVTKDPKLEEQNFPMNPSFSKFKLPDGKTIELG--------------------QER 285

Query: 287 FSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQ 346
           +  PE  F PE+       + +   + I      +R LL +NI+ +GG   +P F +RL 
Sbjct: 286 YRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILLSGGTSMLPGFGDRLL 345

Query: 347 TELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTK 406
            EL+         K+ +P E+  S   W      +    F+   VT+ E+ E     C  
Sbjct: 346 KELKSLSGSRTKIKIFAPPERKYST--WIGGSILSGLSTFKKLWVTKSEWEE--FPDCIH 401

Query: 407 NRF 409
           +RF
Sbjct: 402 SRF 404

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 98.2 bits (243), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 101/415 (24%), Positives = 178/415 (42%), Gaps = 59/415 (14%)

Query: 6   LVIDNGSYEIKFGESGWDQP------LRALNCLTKDKYSRFH----LSNQTKKMRDISQA 55
           +V+DNGS  IK G  G D+P      L  +   +K    RF     + NQ +++R + + 
Sbjct: 13  IVLDNGSGLIKAGFGGEDKPKCYEHSLVGIPKYSKVMAGRFDGNTFVGNQAQEIRGLLK- 71

Query: 56  LIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSK 115
            +R P E G +  W    ++W + F             +  +DH ++V+E  +   +  +
Sbjct: 72  -LRHPLEHGVVTDWNALEQLWGHVFEKGLQL-------SSLQDHPVLVTEAPLNPKKNRE 123

Query: 116 NMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNC 175
            M +++FE +   +++   +   +  Y                 +S +    V+DSG  C
Sbjct: 124 QMCELLFETFSVPAVYVS-IQAVLSLY-----------------ASGRTTGCVLDSGDGC 165

Query: 176 TWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVPP 235
           + AVP+  G     AI+++DI GR ++ LLQ  I  +   V   ++L ++ +E    +  
Sbjct: 166 SHAVPVYDGYTLPSAIRRIDIAGRDISELLQVLIR-KSTGV---SLLSSSEREIVRIIKE 221

Query: 236 ESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKP-GKEKXXXXXXXXXXXXEVFSVPETFF 294
           ++ + +   K   K  Y +   QT F    + P GK+             E F  PE  F
Sbjct: 222 KACYIALDPKEEEK-NYTMHGKQTMF----RLPDGKQ--------IELDNEKFRAPEILF 268

Query: 295 HPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCP 354
           +P++       + E + E I      +R  L +NIV +GG   IP F +R+  EL+  C 
Sbjct: 269 NPQLIGSEFQSLPEILYESIQKVDLDLRTSLFSNIVFSGGTTMIPGFGDRVLKELKLSCE 328

Query: 355 IDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
                K+ +P E+  S   W      +    F+   VT++E+ E+    C   RF
Sbjct: 329 PQTKIKIFAPPERKYST--WIGGSILSGLSTFKKIWVTKKEWEEN--PRCVHARF 379

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 96.7 bits (239), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 101/384 (26%), Positives = 156/384 (40%), Gaps = 72/384 (18%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFH-LSNQTKKMRDI----------SQ 54
           +V+D G+  +K G +G + P      +      R    +N T  +RDI          S 
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEASDVRSY 66

Query: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
             I  P E G + +W     +WDY F+N+          N+T    ++++E  M   +  
Sbjct: 67  LQISYPMENGIIKNWTDMELLWDYAFFNQMKL-------NNTSGGKILLTEPPMNPLKNR 119

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           + M +V+FE+YDF  ++    A    + QG                      +V+DSG  
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VVVDSGDG 161

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTF 232
            T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+  +
Sbjct: 162 VTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221

Query: 233 VPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVF 287
           V   SY      K+     T VE Y LPD      G   K G+E+              F
Sbjct: 222 V---SYDLDLDTKLARETTTLVESYELPD------GRTIKVGQER--------------F 258

Query: 288 SVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQT 347
             PE  F P +  + +PG+ E +   I      VR  L   IV +GG+   P    RL+ 
Sbjct: 259 EAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEK 318

Query: 348 ELQRQCPIDWSCKV--HSPQEKDK 369
           EL++     W  +V  + P   DK
Sbjct: 319 ELKQL----WYTRVLHNDPSRLDK 338

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 99/420 (23%), Positives = 179/420 (42%), Gaps = 69/420 (16%)

Query: 6   LVIDNGSYEIKFGESGWDQP-LRALNCLTKDKYSRFH---------LSNQTKKMRDISQA 55
           +V+DNGS  IK G SG ++P     + +   KY++           + NQ +++R + + 
Sbjct: 12  IVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLEGEQFIGNQAQELRGLLK- 70

Query: 56  LIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSK 115
            +R P E G + +W     +W++ F+            N+ ++H ++ +E  +   +  +
Sbjct: 71  -LRYPLEHGIVKNWSDMELIWNHVFHKSLQL-------NNIEEHPVLATEAPLNPLKNRE 122

Query: 116 NMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNC 175
            M +++FE ++  +++   +   +  Y                 +S +    V+D G  C
Sbjct: 123 AMCEMLFETFNVPAVYVS-IQAVLSLY-----------------ASGRTTGCVLDCGDGC 164

Query: 176 TWAVPIIKGVPYYKAIKKLDIGGR----FLTGLLQETISFRHYNVMEETILVNNIKEQCT 231
             +VP+  G     +I+++D+ GR    FL  LL++T      +  E  I V  IKE+  
Sbjct: 165 CHSVPVFDGFSLPSSIRRIDVAGRDVTEFLQLLLRKTTGVSLLSSSEREI-VRIIKEKAC 223

Query: 232 FVP--PESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSV 289
           +V   P +   ++H    + + + LPD      G V     EK              F  
Sbjct: 224 YVARDPLTEEQTYHLTPTSTI-FKLPD------GKVLDLKNEK--------------FRA 262

Query: 290 PETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTEL 349
           PE  F P++       I E   + I+     +RP L++NIV +GG    P F +RL TEL
Sbjct: 263 PEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVLSGGTTMFPGFGDRLLTEL 322

Query: 350 QRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
           +         K+ +P E+  S   W      +    F+   VT+ E+ E+    C  +RF
Sbjct: 323 RNLSEPQTKIKIFAPPERKYST--WIGGSILSGLSTFKKIWVTKSEWQEN--PDCVHSRF 378

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 92/364 (25%), Positives = 150/364 (41%), Gaps = 66/364 (18%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFH-LSNQTKKMRDI----------SQ 54
           +V+D G+  +K G +G + P      +      R     + +  ++DI          S 
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEASDVRSY 66

Query: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
             I  P E G + +W+    +WDY FYN+  F         T    ++++E  M   +  
Sbjct: 67  LQISYPMENGIIRNWQDMEHLWDYAFYNQMKF-------PSTSGGKILLTEPPMNPLKNR 119

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           + M +V+FE+YDF  ++    A    + QG                      +V+DSG  
Sbjct: 120 ELMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VVVDSGDG 161

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTF 232
            T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+ ++
Sbjct: 162 VTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSY 221

Query: 233 VPPESYFSSFHNKMNTKV-----EYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVF 287
           V   SY  +   K+  +       Y LPD      G V K G+E+              F
Sbjct: 222 V---SYDLNLDTKLARETTVLVENYELPD------GRVIKVGQER--------------F 258

Query: 288 SVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQT 347
             PE  F P++  + +PGI E +   I      +R  L   IV +GG+   P    RL+ 
Sbjct: 259 EAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAIVLSGGSSMYPGLPSRLEK 318

Query: 348 ELQR 351
           EL++
Sbjct: 319 ELKQ 322

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score = 93.2 bits (230), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 106/429 (24%), Positives = 181/429 (42%), Gaps = 76/429 (17%)

Query: 2   SEPVLVIDNGSYEIKFGESGWDQP-LRALNCLTKDKYSRFH----------LSNQTKKMR 50
           ++PV V+DNGS  IK G SG ++P     + +   KY +            + N+ +K R
Sbjct: 9   NQPV-VLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSSRGQLVGNEAQKQR 67

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            + +  ++ P E G +  W    ++W + FY+           N+  DH ++V+E  +  
Sbjct: 68  GLLR--LQYPVEHGIVQDWSGLEQLWTHVFYSSLKL-------NNIGDHPMLVTEAPLNP 118

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
            E    M ++++E ++  +++   +   +  Y G                  +    VID
Sbjct: 119 LENRDKMCEMLYETFNVPAVYVS-IQAVLALYAGG-----------------RTTGCVID 160

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGR----FLTGLLQETISFRHYNVMEETILVNNI 226
            G  C  +VP+  G     AI+++D+ GR    FL  LL+++I     +  E  I V  I
Sbjct: 161 CGDGCCQSVPVYDGFSIPSAIRRIDVAGRDVTEFLQLLLRKSIGVTLLSSSEREI-VRMI 219

Query: 227 KEQCTFVPPE------SYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXX 280
           KE+  +V PE       Y SS  ++  TK  + LPD +   LG                 
Sbjct: 220 KEKACYVAPEVAAEEQKYASSRGSEELTK--FKLPDGKILSLG----------------- 260

Query: 281 XXXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPN 340
               E F  PE  F P++       I +   + I+     +R  L +++V +GG+     
Sbjct: 261 ---AEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSLVLSGGSTLFAG 317

Query: 341 FHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHG 400
           F +RL  EL+ +C  +   K+ +P E+  S+  W      A    F    VTR E+ E+ 
Sbjct: 318 FGDRLLNELRSRCEPNVKIKIFAPPERKYSV--WIGGSILAGLSTFEKIWVTRSEWQEN- 374

Query: 401 LDWCTKNRF 409
              C  +RF
Sbjct: 375 -PQCVHSRF 382

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 92.0 bits (227), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 97/368 (26%), Positives = 150/368 (40%), Gaps = 74/368 (20%)

Query: 6   LVIDNGSYEIKFGESGWDQP------------LRA---LNCLTKDKYSRFHLSNQTKKMR 50
           +V+D G+  +K G +G + P            LRA    N +T  K     + ++   +R
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLK--DIMIGDEASAVR 64

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
              Q  I  P E G + +W     +WDY FY++            T    ++++E  M  
Sbjct: 65  SYLQ--ISYPMENGVIKNWSDMELLWDYAFYDQMKLP-------STSGGKVMLTEPPMNP 115

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M +V+FE+YDF  ++    A    + QG                      +V+D
Sbjct: 116 LRNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VVVD 157

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKE 228
           SG   T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE
Sbjct: 158 SGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKE 217

Query: 229 QCTFVPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXX 283
           + ++V   SY      K+     T VE Y LPD      G V K G E+           
Sbjct: 218 KLSYV---SYDLDLDTKLARETTTLVENYELPD------GRVIKVGSER----------- 257

Query: 284 XEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHE 343
              F  PE  F P +  + +PG+ E +   I      VR  L   IV +GG+   P    
Sbjct: 258 ---FEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAIVLSGGSSMYPGLPS 314

Query: 344 RLQTELQR 351
           RL+ EL++
Sbjct: 315 RLEKELKQ 322

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 90.9 bits (224), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 99/384 (25%), Positives = 154/384 (40%), Gaps = 72/384 (18%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRF-HLSNQTKKMRDI----------SQ 54
           +V+D G+  +K G +G + P      +      R    SN +  ++DI          S 
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEASNVRSY 66

Query: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
             I  P E G + +W    ++WDY FY++            T  H ++++E  M   +  
Sbjct: 67  LQISYPMENGIIKNWADMEQLWDYAFYDQMKIP-------STAGHKVLLTEPPMNPLKNR 119

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           + M +V+FE+YDF  ++    A    + QG                      +V+DSG  
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VVVDSGDG 161

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTF 232
            T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+  +
Sbjct: 162 VTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCY 221

Query: 233 VPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVF 287
           V   SY      K+     T VE Y LPD      G V K G E+              F
Sbjct: 222 V---SYDLDLDTKLAHETTTLVETYELPD------GRVIKVGSER--------------F 258

Query: 288 SVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQT 347
             PE  F P +  + + GI E +   I      +   L   IV +GG+   P    RL+ 
Sbjct: 259 EAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAIVLSGGSSMYPGLPSRLEK 318

Query: 348 ELQRQCPIDWSCKV--HSPQEKDK 369
           EL++     W  +V  + P   DK
Sbjct: 319 ELKQL----WFTRVLKNDPARLDK 338

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 98/418 (23%), Positives = 173/418 (41%), Gaps = 73/418 (17%)

Query: 2   SEPVLVIDNGSYEIKFGESGWDQP-LRALNCLTKDKYSRFHLSN------------QTKK 48
           ++PV V+DNGS  IK G SG ++P     N +   KY +  L+N            + +K
Sbjct: 8   NQPV-VLDNGSSVIKSGFSGQNKPQCFEYNLIGTPKYEKVMLTNAISNNDLTYIGNRAQK 66

Query: 49  MRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLM 108
            R + +  +R P   G + +W+    +W + F +       +   ND  +H L+++E  +
Sbjct: 67  SRGLLR--LRHPMNRGIVENWDDMETLWSHTFND-------ILKINDFDEHPLLITEAPL 117

Query: 109 TIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLV 168
              +    M +V FE++DF +++   +A   P     Y     T               V
Sbjct: 118 NPEKNRDKMCEVFFEKFDFAAVY---IAN--PSTLSLYASGRTTGC-------------V 159

Query: 169 IDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVME-----ETILV 223
           +D G     +VPI +G     +I+++D+GGR +T  LQ  I  R Y  +      E  +V
Sbjct: 160 LDCGDGYCSSVPIYEGFALPSSIRRIDVGGRDVTEQLQFQI--RKYTGISLYSSSEHEIV 217

Query: 224 NNIKEQCTFVPPESYFSSFHNKMN---TKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXX 280
            N+KE+  +V  +       + +N    + ++ LPD +   L   +              
Sbjct: 218 KNVKEKACYVSTDFAHDEDMSNLNPEKIRCQFKLPDGKDLILDKAR-------------- 263

Query: 281 XXXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPN 340
                 F  PE  F P+I  +    + +   E I+     +RP L ++I+  GG+     
Sbjct: 264 ------FRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFSSIILNGGSTMFRG 317

Query: 341 FHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLE 398
           F +RL  ELQ +       K+ +P E+  +   W           F+   +T+ E+ E
Sbjct: 318 FGDRLLKELQIRTGNKNLIKIIAPPERKYT--SWIGGSILTGLSTFKQLWMTKAEWQE 373

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 90.1 bits (222), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 93/370 (25%), Positives = 151/370 (40%), Gaps = 78/370 (21%)

Query: 6   LVIDNGSYEIKFGESGWDQP------------LRA-----LNCLTKDKYSRFHLSNQTKK 48
           +V+D G+  +K G +G + P            LRA     ++   KD      + ++  +
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKD----IMIGDEASE 62

Query: 49  MRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLM 108
           +R   Q  I  P E G + +W     +WDY F+N+            T    ++++E  M
Sbjct: 63  VRSYLQ--ISYPMENGIIKNWTDMELLWDYAFFNQMKLP-------TTSGGKVLLTEPPM 113

Query: 109 TIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLV 168
              +  + M +V+FE YDF  ++    A    + QG                      +V
Sbjct: 114 NPVKNRERMCEVMFERYDFGGVYVAIQAVLALYAQGLSSG------------------VV 155

Query: 169 IDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNI 226
           +DSG   T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYSFNRTADFETVRQI 215

Query: 227 KEQCTFVPPESYFSSFHNKMNTKV-----EYVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           KE+  +V   SY  +   K+  +      EY LPD      G + K G+E+         
Sbjct: 216 KEKVCYV---SYDLNLDTKLARETTTLVQEYELPD------GRIIKVGQER--------- 257

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
                F  PE  F P++  +  PG+ E +   I      VR  L   IV +GG+   P  
Sbjct: 258 -----FEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGL 312

Query: 342 HERLQTELQR 351
             RL+ EL++
Sbjct: 313 PSRLERELKQ 322

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score = 90.1 bits (222), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 101/427 (23%), Positives = 172/427 (40%), Gaps = 72/427 (16%)

Query: 2   SEPVLVIDNGSYEIKFGESGWDQP-LRALNCLTKDKYSRFH----------LSNQTKKMR 50
           ++PV V+DNGS  IK G SG +QP     + +   KY++            + N+ +KMR
Sbjct: 9   NQPV-VLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASDSQLIGNEAQKMR 67

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            + +  +  P E G +  W    ++W + FYN            + ++H ++++E  +  
Sbjct: 68  GLLK--LHYPLEHGVVQDWPGLEQLWTHVFYNSLKLA-------NIEEHPMLITEAPLNP 118

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
            +    M +++FE +   +++   +   +  Y G                  +    VID
Sbjct: 119 MKNRNKMCEMLFETFGSPAVYVS-IQAVLALYAGG-----------------RTTGCVID 160

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGR----FLTGLLQETISFRHYNVMEETILVNNI 226
            G  C  +VP+  G     AI+++D+ GR    FL  LL+++      +  E  I V  I
Sbjct: 161 CGDGCCQSVPVYDGFTLPSAIQRIDVAGRDITEFLQLLLRKSSGVTLSSSSEREI-VRMI 219

Query: 227 KEQCTFVPP----ESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXX 282
           KE+  FV      E       N    +  + LPD +   LG                   
Sbjct: 220 KEKACFVATDVGNEEQNYEGANSAELETRFKLPDGKILTLG------------------- 260

Query: 283 XXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFH 342
             E F  PE  F P +       I E   + I+     +R  L ++IV +GG+     F 
Sbjct: 261 -AEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSIVLSGGSTMFSGFG 319

Query: 343 ERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLD 402
           +RL +E+++    +   K+ +P E+  S   W      A    F    VTR E+ E+   
Sbjct: 320 DRLLSEIRKTSEPNTKIKIFAPPERKYST--WIGGSILAGLSTFEKLWVTRAEWQEN--P 375

Query: 403 WCTKNRF 409
            C  +RF
Sbjct: 376 QCIHSRF 382

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score = 89.7 bits (221), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 93/364 (25%), Positives = 144/364 (39%), Gaps = 66/364 (18%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRF-HLSNQTKKMRDI----------SQ 54
           +V+D G+  +K G +G + P      +      R    +N +  ++DI          S 
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEASQVRSY 66

Query: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
             I  P E G +  W     +WDY FY +            T    ++++E  M      
Sbjct: 67  LQISYPMENGIIRDWADMELLWDYAFYEQMKLP-------STSGGKVLLTEPPMNPLRNR 119

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           + M +V+FE+YDF  ++ G  A    + QG                      +V+DSG  
Sbjct: 120 EQMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSG------------------VVVDSGDG 161

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTF 232
            T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+  +
Sbjct: 162 VTHIVPVYESVVLNHLTRRLDVAGRDMTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCY 221

Query: 233 VPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVF 287
           V   SY      ++     T VE Y LPD      G V K G E+              F
Sbjct: 222 V---SYDLDLDTRLAQETTTLVEQYELPD------GRVIKVGSER--------------F 258

Query: 288 SVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQT 347
             PE  F P +  + +PGI E +   I      +   L   IV +GG+   P    RL+ 
Sbjct: 259 EAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAIVLSGGSSMYPGLPSRLEK 318

Query: 348 ELQR 351
           EL++
Sbjct: 319 ELKQ 322

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 89.7 bits (221), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 98/384 (25%), Positives = 152/384 (39%), Gaps = 72/384 (18%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFH-LSNQTKKMRDI----------SQ 54
           +V+D G+  +K G +G + P      +      R    ++ T  ++DI          S 
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEASDVRSY 66

Query: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
             I  P E G + +W     +WDY FY +            T    ++++E  M      
Sbjct: 67  LQISYPMENGIIKNWADMELLWDYAFYEQMKLP-------STSGGKVLLTEPPMNPLRNR 119

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           + M +V+FE+YDF  ++    A    + QG                      +V+DSG  
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VVVDSGDG 161

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTF 232
            T  VP+ + V      K+LD+ GR +T  L + +S R Y  N   +   V  IKE+  +
Sbjct: 162 VTHIVPVYESVVLSHLTKRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCY 221

Query: 233 VPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVF 287
           V   SY      K+     T VE Y LPD      G V K G E+              F
Sbjct: 222 V---SYDLDLDTKLARETTTLVENYELPD------GRVIKVGSER--------------F 258

Query: 288 SVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQT 347
             PE  F P +  + +PG+ E +   +      VR  L   +V +GG+   P    RL+ 
Sbjct: 259 EAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAVVLSGGSSMYPGLPSRLEK 318

Query: 348 ELQRQCPIDWSCKV--HSPQEKDK 369
           EL++     W  +V  + P   DK
Sbjct: 319 ELKQL----WFTRVLRNDPSRLDK 338

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score = 89.4 bits (220), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 92/364 (25%), Positives = 148/364 (40%), Gaps = 66/364 (18%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFH-LSNQTKKMRDI----------SQ 54
           +V+D G+  +K G +G + P      +      R    +N T  ++DI          S 
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEASEVRSY 66

Query: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
             I  P E G + +W     +WDY F+ +            T +  ++++E  M   +  
Sbjct: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLP-------TTSNGKILLTEPPMNPTKNR 119

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           + M +V+FE+YDF  ++    A    + QG                      +V+DSG  
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VVVDSGDG 161

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTF 232
            T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+  +
Sbjct: 162 VTHIVPVYESVVLGHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221

Query: 233 VPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVF 287
           V   SY      K+     T VE Y LPD      G   K G+E+              F
Sbjct: 222 V---SYDLDLDTKLARETTTLVESYELPD------GRTIKVGQER--------------F 258

Query: 288 SVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQT 347
             PE  F P +  + +PG+ E + + +      VR  L   IV +GG+   P    RL+ 
Sbjct: 259 EAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAIVLSGGSSMYPGLPSRLEK 318

Query: 348 ELQR 351
           EL++
Sbjct: 319 ELKQ 322

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score = 88.6 bits (218), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 87/322 (27%), Positives = 132/322 (40%), Gaps = 61/322 (18%)

Query: 57  IRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKN 116
           I  P E G + +W     +WDY FY++            T    ++++E  M   +  + 
Sbjct: 15  ISYPMENGVIKNWSDMELLWDYAFYDQMQLP-------STSGGKVMLTEPPMNPVKNREQ 67

Query: 117 MDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCT 176
           M +V+FE+YDF  ++    A    + QG                      +V+DSG   T
Sbjct: 68  MCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VVVDSGDGVT 109

Query: 177 WAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTFVP 234
             VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+ ++V 
Sbjct: 110 HIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYV- 168

Query: 235 PESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSV 289
             SY      K+     T VE Y LPD      G V K G E+              F  
Sbjct: 169 --SYDLDLDTKLARETTTLVENYELPD------GRVIKVGSER--------------FEA 206

Query: 290 PETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTEL 349
           PE  F P +  + +PG+ E +   I      VR  L   IV +GG+   P    RL+ EL
Sbjct: 207 PECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRSALYRAIVLSGGSSMYPGLPSRLEKEL 266

Query: 350 QRQCPIDWSCKV--HSPQEKDK 369
           ++     W  +V  + P   DK
Sbjct: 267 KQL----WFTRVLHNDPSRLDK 284

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 100/386 (25%), Positives = 156/386 (40%), Gaps = 76/386 (19%)

Query: 6   LVIDNGSYEIKFGESGWDQP------------LRALNCLTKDK-YSRFHLSNQTKKMRDI 52
           +V+D G+  +K G +G + P            LRA    T +K      + ++   +R  
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEASDVRSY 66

Query: 53  SQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPE 112
            Q  I  P E G + +W     +WDY F+N+            T    ++++E  M   +
Sbjct: 67  LQ--ISYPMENGIIKNWTDMELLWDYAFFNQMQLP-------TTSGGKILLTEPPMNPVK 117

Query: 113 LSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSG 172
             + M +V+FE+YDF  ++    A    + QG                      +V+DSG
Sbjct: 118 NREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VVVDSG 159

Query: 173 FNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQC 230
              T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+ 
Sbjct: 160 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 219

Query: 231 TFVPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXE 285
            +V   SY      K+     T VE Y LPD      G + K G+E+             
Sbjct: 220 CYV---SYDLDLDTKLARETTTLVENYELPD------GRIIKVGQER------------- 257

Query: 286 VFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERL 345
            F  PE  F P +  + + GI E +   I      VR  L   IV +GG+   P    RL
Sbjct: 258 -FEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGLPSRL 316

Query: 346 QTELQRQCPIDWSCKV--HSPQEKDK 369
           + EL++     W  +V  + P   DK
Sbjct: 317 EKELKQL----WFTRVLNNDPTRLDK 338

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 91/364 (25%), Positives = 148/364 (40%), Gaps = 66/364 (18%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFH-LSNQTKKMRDI----------SQ 54
           +V+D G+  +K G +G + P      +      R    +N +  ++DI          S 
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEASDVRSY 66

Query: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
             I  P E G + +W     +WDY F+++            T +  ++++E  M   +  
Sbjct: 67  LQISYPMENGIIKNWTDMELLWDYAFFDQMKLP-------TTSNGKILLTEPPMNPVKNR 119

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           + M +V+FE+YDF  ++    A    + QG                      +V+DSG  
Sbjct: 120 EQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VVVDSGDG 161

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTF 232
            T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+  +
Sbjct: 162 VTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKVCY 221

Query: 233 VPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVF 287
           V   SY      K+     T VE Y LPD      G V K G+E+              F
Sbjct: 222 V---SYDLDLDTKLARETTTLVENYELPD------GRVIKVGQER--------------F 258

Query: 288 SVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQT 347
             PE  F P +  + + G+ E +   I      +R  L   IV +GG+   P    RL+ 
Sbjct: 259 EAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAIVLSGGSSMYPGLPSRLEK 318

Query: 348 ELQR 351
           EL++
Sbjct: 319 ELKQ 322

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 96/415 (23%), Positives = 172/415 (41%), Gaps = 66/415 (15%)

Query: 2   SEPVLVIDNGSYEIKFGESGWDQPL----------RALNCLTKDKYSRFHLSNQTKKMRD 51
           ++PV V+DNGS  +K G SG + P           R    +T     R  + N+ +++R 
Sbjct: 11  NQPV-VLDNGSAILKAGFSGDETPAILEYTMAGKPRYKKVMTTGLEDRTFVGNEAQRLRG 69

Query: 52  ISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIP 111
           +     RRP   G++ +W+    +W + FY++         ++   DH L+++E  +   
Sbjct: 70  LLAL--RRPISRGEVTNWDDMELLWSHIFYSKLQLGQG---NSQIGDHPLLITEAPLNST 124

Query: 112 ELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDS 171
           +  + M ++++E ++F +++    A    +  GQ                      V++ 
Sbjct: 125 KNRETMCEILYETFNFDALYVAHPAVLSLYATGQTTG------------------CVLEC 166

Query: 172 GFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQ----ETISFRHYNVMEETILVNNIK 227
           G   + + P+ +G     +I+++DIGGR +T  LQ    ++     ++  E+ I V  IK
Sbjct: 167 GEGYSASTPVYQGFALPSSIRRIDIGGRDITQELQFYIRKSTGLSLFSNSEQEI-VRTIK 225

Query: 228 EQCTFVPPESYFSS----FHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXX 283
           E+  +V  +  F       H + NT     LPD Q    G  K                 
Sbjct: 226 EKANYVALDYKFEEEKFFIHERENTST-VKLPDGQELTFGKGK----------------- 267

Query: 284 XEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHE 343
              +   E  F P++       + E +LE IN     +R  L+ NIV +GG   +  F +
Sbjct: 268 ---YRTSEILFQPQLIGSECVSVPEMLLESINKVDMDLRTQLLENIVLSGGTTMLKGFDQ 324

Query: 344 RLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLE 398
           R  +E ++  P     K+ S  E  +S   W      +    FR+  +TRE Y E
Sbjct: 325 RTMSETKKMLPKHTKVKIRSLAE--RSYIAWIGGSILSGLYGFRNLWLTREMYEE 377

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 87.4 bits (215), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 95/384 (24%), Positives = 154/384 (40%), Gaps = 72/384 (18%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFH-LSNQTKKMRDI----------SQ 54
           +V+D G+  +K G +G + P      +      R    ++ T  ++DI          S 
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66

Query: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
             I  P E G + +W     +WDY F+ +            T +  ++++E  M   +  
Sbjct: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLQ-------STSNGKILLTEPPMNPLKNR 119

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           + M +V+FE+YDF  ++    A    + QG                      +V+DSG  
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VVVDSGDG 161

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTF 232
            T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+  +
Sbjct: 162 VTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221

Query: 233 VPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVF 287
           V   SY      K+     T VE Y LPD      G   K G+E+              F
Sbjct: 222 V---SYDLDLDTKLARETTTLVESYELPD------GRTIKVGQER--------------F 258

Query: 288 SVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQT 347
             PE  F P +  + +PG+ E +   +      +R  L   IV +GG+   P    RL+ 
Sbjct: 259 EAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEK 318

Query: 348 ELQRQCPIDWSCKV--HSPQEKDK 369
           EL++     W  +V  + P   DK
Sbjct: 319 ELKQL----WFSRVLHNDPSRLDK 338

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score = 86.3 bits (212), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 98/386 (25%), Positives = 155/386 (40%), Gaps = 74/386 (19%)

Query: 6   LVIDNGSYEIKFGESGWDQP------------LRALNCLTKDKYSRFHLSNQTKKMRDIS 53
           +V+D G+  +K G +G + P            LRA      D  +        ++  D+ 
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGEEASDVR 66

Query: 54  QAL-IRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPE 112
             L I  P E G +  W     +WD+ F+ +            T    ++++E  M   +
Sbjct: 67  SYLQISYPMENGIIKHWTDMELLWDHAFFEKMKL-------PSTSGGKILLTEPPMNPLK 119

Query: 113 LSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSG 172
             + M QV+FE+YDF  ++    A    + QG                      +V+DSG
Sbjct: 120 NREMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VVVDSG 161

Query: 173 FNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQC 230
              T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+ 
Sbjct: 162 DGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKL 221

Query: 231 TFVPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXE 285
           ++V   SY   F  K+     T VE Y LPD      G + K G+E+             
Sbjct: 222 SYV---SYDLDFDTKLARETTTLVENYELPD------GRIIKVGQER------------- 259

Query: 286 VFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERL 345
            F  PE  F P +  + +PG+ E +   I      +R  L   IV +GG+   P    RL
Sbjct: 260 -FEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYKAIVLSGGSSMYPGLPSRL 318

Query: 346 QTELQRQCPIDWSCKV--HSPQEKDK 369
           + EL++     W  +V  + P   DK
Sbjct: 319 EKELKQL----WFTRVLKNDPSRLDK 340

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 85/341 (24%), Positives = 133/341 (39%), Gaps = 80/341 (23%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLT--------------KDKYSRFHLSNQTKKMR 50
            LVIDNGS   K G +G D P      +               KD Y    + ++ +  R
Sbjct: 7   ALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSY----VGDEAQSKR 62

Query: 51  DISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTI 110
            I    +R P E G + +W+   ++W + FYNE             ++H ++++E  M  
Sbjct: 63  GI--LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVA--------PEEHPVLLTEAPMNP 112

Query: 111 PELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVID 170
               + M Q++FE ++  + +   +   +  Y                 SS +   +V+D
Sbjct: 113 KSNREKMTQIMFETFNVPAFYVS-IQAVLSLY-----------------SSGRTTGIVLD 154

Query: 171 SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKE 228
           SG   T  VPI  G      I ++D+ GR LT  L + +S R Y  +   E  +V +IKE
Sbjct: 155 SGDGVTHVVPIYAGFSMPHGILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKE 214

Query: 229 QCTFVPPESYFSSFHNKMNTKVE-------YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           +  +V  +     F  +M T  +       Y LPD Q   +G                  
Sbjct: 215 KLCYVALD-----FEQEMQTAAQSSSIEKSYELPDGQVITIG------------------ 251

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVR 322
              E F  PE  FHP +  +   GI +T    I  C   VR
Sbjct: 252 --NERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVR 290

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 92/384 (23%), Positives = 152/384 (39%), Gaps = 72/384 (18%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFH-LSNQTKKMRDI----------SQ 54
           +V+D G+  +K G +G + P      +      R    ++ T  ++DI          S 
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66

Query: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
             I  P E G + +W     +WDY F+ +            T +  ++++E  M   +  
Sbjct: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKL-------PSTSNGKILLTEPPMNPLKNR 119

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           + M +V+FE+YDF  ++    A    + QG                      +V+DSG  
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VVVDSGDG 161

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTF 232
            T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+  +
Sbjct: 162 VTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221

Query: 233 VPPESYFSSFHNKMNTKV-----EYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVF 287
           V   SY      K+  +       Y LPD      G   K G+E+              F
Sbjct: 222 V---SYDLDLDTKLARETTALVESYELPD------GRTIKVGQER--------------F 258

Query: 288 SVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQT 347
             PE  F P +  + +PG+ E +   +      +R  L   IV +GG+   P    RL+ 
Sbjct: 259 EAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEK 318

Query: 348 ELQRQCPIDWSCKV--HSPQEKDK 369
           EL++     W  +V  + P   DK
Sbjct: 319 ELKQL----WFSRVLHNDPSRLDK 338

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 91/364 (25%), Positives = 144/364 (39%), Gaps = 66/364 (18%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFH-LSNQTKKMRDI----------SQ 54
           +V+D G+  +K G +G + P      +      R     + +  ++DI          S 
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEASEVRSY 66

Query: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
             I  P E G + +W     +WDY F+ +            T    ++++E  M   +  
Sbjct: 67  LQISYPMENGIIRNWADMELLWDYAFFEQMKL-------PTTSGGKVLLTEPPMNPIKNR 119

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           + M +V+FE+YDF   +    A    + QG                      +V+DSG  
Sbjct: 120 EQMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSG------------------VVVDSGDG 161

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTF 232
            T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+  +
Sbjct: 162 VTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221

Query: 233 VPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVF 287
           V   SY      K+     T VE Y LPD      G V K G E+              F
Sbjct: 222 V---SYDLDLDTKLARETTTLVESYELPD------GRVIKVGPER--------------F 258

Query: 288 SVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQT 347
             PE  F P +  + +PG+ E +   I      +R  L   IV +GG+   P    RL+ 
Sbjct: 259 EAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAIVLSGGSSMYPGLPSRLEK 318

Query: 348 ELQR 351
           EL++
Sbjct: 319 ELKQ 322

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 92/386 (23%), Positives = 152/386 (39%), Gaps = 76/386 (19%)

Query: 6   LVIDNGSYEIKFGESGWDQP------------LRAL-NCLTKDKYSRFHLSNQTKKMRDI 52
           +V+D G+  +K G +G + P            LRA              + ++  ++R  
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRSY 66

Query: 53  SQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPE 112
            Q  I  P E G + +W     +WDY F+ +            T +  ++++E  M   +
Sbjct: 67  LQ--ISYPMENGIIKNWTDMELLWDYAFFEQMKL-------PSTSNGKILLTEPPMNPLK 117

Query: 113 LSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSG 172
             + M +V+FE+YDF  ++    A    + QG                      +V+DSG
Sbjct: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VVVDSG 159

Query: 173 FNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQC 230
              T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+ 
Sbjct: 160 DGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219

Query: 231 TFVPPESYFSSFHNKMNTKV-----EYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXE 285
            +V   SY      K+  +       Y LPD      G   K G+E+             
Sbjct: 220 CYV---SYDLDLDTKLARETTALVESYELPD------GRTIKVGQER------------- 257

Query: 286 VFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERL 345
            F  PE  F P +  + +PG+ E +   +      +R  L   IV +GG+   P    RL
Sbjct: 258 -FEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRL 316

Query: 346 QTELQRQCPIDWSCKV--HSPQEKDK 369
           + EL++     W  +V  + P   DK
Sbjct: 317 EKELKQL----WFSRVLHNDPSRLDK 338

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score = 83.6 bits (205), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 80/302 (26%), Positives = 124/302 (41%), Gaps = 55/302 (18%)

Query: 57  IRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKN 116
           I  P E G + +W     +WDY FY +           DT +  ++++E  M   +  + 
Sbjct: 15  ISYPMENGIIKNWTDMELLWDYAFYEQMKLP-------DTSNGKILLTEPPMNPIKNREK 67

Query: 117 MDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCT 176
           M +V+FE+Y+F  ++    A    + QG                      +V+DSG   T
Sbjct: 68  MCEVMFEKYNFGGVYVAIQAVLALYAQGLSSG------------------VVVDSGDGVT 109

Query: 177 WAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTFVP 234
             VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+  +V 
Sbjct: 110 HIVPVYESVVLNHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTADFETVRQIKEKLCYV- 168

Query: 235 PESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSV 289
             SY      K+     T VE Y LPD      G V K G E+              F  
Sbjct: 169 --SYDLDLDTKLARETTTLVESYELPD------GRVIKVGSER--------------FEA 206

Query: 290 PETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTEL 349
           PE  F P +  + + G+ E +   I      +R  L   IV +GG+   P    RL+ EL
Sbjct: 207 PECLFQPNLVDVEQAGVGELLFNTIQSADVDIRSTLFKAIVLSGGSSMYPGLPSRLEKEL 266

Query: 350 QR 351
           ++
Sbjct: 267 KQ 268

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 93/370 (25%), Positives = 149/370 (40%), Gaps = 78/370 (21%)

Query: 6   LVIDNGSYEIKFGESGWDQP------------LRA-----LNCLTKDKYSRFHLSNQTKK 48
           +V+D G+  +K G +G + P            LRA     ++   KD      + ++  +
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKD----IMIGDEASE 62

Query: 49  MRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLM 108
           +R   Q  I  P E G + +W     +WDY FY +            T    ++++E  M
Sbjct: 63  VRSYLQ--ISYPMENGIIKNWTDMELLWDYAFYEQMKLP-------STSGGKVLLTEPPM 113

Query: 109 TIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLV 168
              +  + M +V+FE+YDF  ++    A    + QG                      +V
Sbjct: 114 NPLKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VV 155

Query: 169 IDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNI 226
           +DSG   T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  I
Sbjct: 156 VDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215

Query: 227 KEQCTFVPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           KE+  +V   SY      ++     T VE Y LPD      G + K G+E+         
Sbjct: 216 KEKLCYV---SYDLDLDTRLARETTTLVEKYELPD------GRIIKVGQER--------- 257

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
                F  PE  F P +  +   G+ E +   I      VR  L   IV +GG+   P  
Sbjct: 258 -----FEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAIVLSGGSSMYPGL 312

Query: 342 HERLQTELQR 351
             RL+ EL++
Sbjct: 313 PSRLEKELKQ 322

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score = 83.6 bits (205), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 86/364 (23%), Positives = 144/364 (39%), Gaps = 66/364 (18%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFH-LSNQTKKMRDI----------SQ 54
           +V+D G+  +K G +G + P      +      R    ++    ++DI          S 
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASDVRSY 66

Query: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
             I  P E G + +W     +WDY F+ +            T +  ++++E  M   +  
Sbjct: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLP-------STSNGKILLTEPPMNPLKNR 119

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           + M +V+FE+YDF  ++    A    + QG                      +V+DSG  
Sbjct: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VVVDSGDG 161

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTF 232
            T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+  +
Sbjct: 162 VTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221

Query: 233 VPPESYFSSFHNKMNTKV-----EYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVF 287
           V   SY      K+  +       Y LPD      G   K G+E+              F
Sbjct: 222 V---SYDLDLDTKLARETTVLVESYELPD------GRTIKVGQER--------------F 258

Query: 288 SVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQT 347
             PE  F P +  + +PG+ E +   +      +R  L   IV +GG+   P    RL+ 
Sbjct: 259 EAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAIVLSGGSSMYPGLPSRLEK 318

Query: 348 ELQR 351
           EL++
Sbjct: 319 ELKQ 322

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 92/416 (22%), Positives = 180/416 (43%), Gaps = 72/416 (17%)

Query: 2   SEPVLVIDNGSYEIKFGESGWDQP-LRALNCLTKDKYSR---------FHLSNQTKKMRD 51
           ++PV VIDNG+  +K G  G D+P     N +   K+ +          ++ N+ ++ R 
Sbjct: 8   NQPV-VIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKFDKVMIGGLDDNMYIGNKAQENRG 66

Query: 52  ISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIP 111
           + +  +R P E G++  W+    VW +   ++     N+ H    ++H ++++E  +   
Sbjct: 67  LLR--LRHPMEHGEVKHWDEMEAVWKHTLLHD----LNIQH---IEEHPILITEAPLNSS 117

Query: 112 ELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDS 171
           +  ++M +++FE ++  ++                ++ A+ A      S  +    VID 
Sbjct: 118 KNREHMCEILFESFNIPAI--------------HVENPAVLAL----YSGGRTTGCVIDC 159

Query: 172 GFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQ----ETISFRHYNVMEETILVNNIK 227
           G     AVPI +G     +I+++DIGGR +T  LQ    +++    ++  E+ I V  IK
Sbjct: 160 GEGYCSAVPIYEGFALTPSIRRIDIGGREITEQLQFQIRKSVGMSLFSSNEKEI-VRTIK 218

Query: 228 EQCTFVP----PESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXX 283
           E+  +V      E +     ++ N+  ++ LPD ++  +G V+                 
Sbjct: 219 ERACYVADDISKEEHKYILDSESNSS-KFKLPDGKSLSIGNVR----------------- 260

Query: 284 XEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHE 343
              F   E  F+P +       + E + + ++     +RP+L  ++V  GG   +P F  
Sbjct: 261 ---FRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGFGN 317

Query: 344 RLQTELQRQCPIDWSCK-VHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLE 398
           R+  ELQ     D   + + SP+ K  +   W      A    F+   VT+  + E
Sbjct: 318 RILKELQILTKQDTKLRIIASPERKYTT---WIGGSILAGLSTFQKILVTKSNWNE 370

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score = 81.6 bits (200), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 100/390 (25%), Positives = 153/390 (39%), Gaps = 84/390 (21%)

Query: 6   LVIDNGSYEIKFGESGWDQP------------LRA-----LNCLTKDKYSRFHLSNQTKK 48
           +V+D G+  +K G +G + P            LRA     LN   KD      +  +   
Sbjct: 7   IVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKD----VMIGEEASA 62

Query: 49  MRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLM 108
           +R   Q  I  P E G + +W     +WDY FY +            T    ++++E  +
Sbjct: 63  VRSYLQ--ISYPMENGIIKNWTDMELLWDYAFYEQMKLP-------STSGGKVLLTEPPL 113

Query: 109 TIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLV 168
              +  + M +V+FE+YDF  ++    A    + QG                      +V
Sbjct: 114 NPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSG------------------VV 155

Query: 169 IDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNI 226
           IDSG   T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  I
Sbjct: 156 IDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215

Query: 227 KEQCTFVPPESYFSSFHNKM----NTKVE-YVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           KE+  +V   SY      K+     T VE Y LPD      G V K G+E+         
Sbjct: 216 KEKLCYV---SYDLELDTKLARETTTLVENYELPD------GRVIKVGQER--------- 257

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
                F   E  F P +  +   G+ E +   I      VR  L   IV +GG+   P  
Sbjct: 258 -----FEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAIVLSGGSSMYPGL 312

Query: 342 HERLQTELQRQCPIDWSCKV--HSPQEKDK 369
             R++ EL++     W  +V  + P   DK
Sbjct: 313 PSRIEKELKQL----WYTRVLNNDPARLDK 338

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 81.3 bits (199), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 100/425 (23%), Positives = 177/425 (41%), Gaps = 77/425 (18%)

Query: 6   LVIDNGSYEIKFGESGWDQP-LRALNCLTKDKYSRFHLSN--QTKKMRDISQAL-----I 57
           +V+DNGS  +K G  G D+P     + +   KY +  +    + K + +++Q       +
Sbjct: 14  IVLDNGSALLKAGFGGDDKPKCFEYSLIGTPKYDKVMVGGVEKGKFVGNLAQEYRGLLKL 73

Query: 58  RRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNM 117
           R P + G + +WE    VWD+ F +           ++  +H LVV+E  +      + M
Sbjct: 74  RYPMDHGIIENWEHMETVWDHIFKD-------CLKVSNLGEHPLVVTEAPLNPKPNREKM 126

Query: 118 DQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTW 177
            + +FE ++  +++   +A   P     Y     T               V+++G     
Sbjct: 127 CETLFESFNIPALY---IAN--PAVLSLYASGRTTGC-------------VVEAGDGYCS 168

Query: 178 AVPIIKGVPYYKAIKKLDIGGRFLTGLLQ----ETISFRHYNVMEETILVNNIKEQCTFV 233
           +VPI +G     +I+++DIGGR +T  LQ    ++     Y+  E+ I V  IKE     
Sbjct: 169 SVPIYEGFALTPSIRRIDIGGRDITKHLQLQLRKSTGMWLYSSSEQEI-VRLIKENGC-- 225

Query: 234 PPESYFSSFHNKMNTK---------VEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXX 284
               Y  S H K   K         + + LPD +   +G    PG+              
Sbjct: 226 ----YICSNHKKEEEKFLLDQEKKSISFKLPDGKNLVIG----PGR-------------- 263

Query: 285 EVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHER 344
             F  PE  F+P +       + + I++ I+     +R  L+ NI  +GG+     F +R
Sbjct: 264 --FRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNNITLSGGSTMFQGFCDR 321

Query: 345 LQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWC 404
           L TEL          ++ +P E+  S     S+   AN   FR+  VT++++   G +  
Sbjct: 322 LITELDFSVDKTTKVRILAPPERKYSAFIGGSI--LANLSTFRNMWVTKDQW--EGDNRI 377

Query: 405 TKNRF 409
            +N+F
Sbjct: 378 IENKF 382

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 93/418 (22%), Positives = 163/418 (38%), Gaps = 74/418 (17%)

Query: 2   SEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDK-YSRFHLS---------NQTKKMRD 51
           ++PV VIDNGS  +K G  G ++P      L  D  Y++  +          N+ +++R 
Sbjct: 9   NQPV-VIDNGSAVVKAGFCGEEKPRCMEYSLIGDANYNKIMVGGLECDSFVGNKAQRLRG 67

Query: 52  ISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIP 111
           + +  ++ P E G +  W+    +W +  ++       +       +H L+++E  +   
Sbjct: 68  LLK--LKHPMERGVVSDWDDMELLWSHILFDSLQLTSGM-------EHPLLITEAPLNPE 118

Query: 112 ELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDS 171
              + M +V FE ++  +     +   IP     Y     T               V+D 
Sbjct: 119 SNKEKMLEVFFETFNIPA-----ICVSIPGVLSLYASGRTTGC-------------VVDC 160

Query: 172 GFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVM-----EETILVNNI 226
           G     +VP+ +G     +IK++++GG  +T  LQ     R  + +      E  LV  +
Sbjct: 161 GEGYCSSVPVCEGYTLASSIKRINLGGIDVTKQLQ--FQLRKESGVWLFSSGERELVRTM 218

Query: 227 KEQCTFVP-----PESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           KE+  +V       E  F+    KMNT   + LPD     L   +               
Sbjct: 219 KEKSCYVSLNQLKDEEKFTFEPGKMNTN--FKLPDGNMLTLSKSR--------------- 261

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
                F  PE  F P+I    +P + E  L+ I      +RP L++ I  +GG      F
Sbjct: 262 -----FRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRITLSGGTTMFRGF 316

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEH 399
            +R   ELQ       + ++ +P E+  +   W      A    FR    T+ ++ EH
Sbjct: 317 GDRFLQELQISTCKKSNIRILAPPERKYT--AWIGGSMLAGLTTFRKMLTTKSDWREH 372

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 94/416 (22%), Positives = 165/416 (39%), Gaps = 73/416 (17%)

Query: 2   SEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRF---------HLSNQTKKMRDI 52
           S+PV V+DNGS  +K G SG D+P    + +       +          + N  ++ R I
Sbjct: 10  SQPV-VLDNGSAILKAGYSGEDRPKFLEHSIVGSPRHGYVNDSSKDDTFVGNLAQERRSI 68

Query: 53  SQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPE 112
            Q  +R P + G + +W     +WDY F ++           D  +H ++++E  +    
Sbjct: 69  LQ--LRHPVDHGVVKNWNDMELIWDYMFKDKLKL-------KDVDEHPVLITEAPLNPVS 119

Query: 113 LSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSG 172
               M  ++FE +  ++++    A    +  G+                      V+D G
Sbjct: 120 NRDEMCDLLFESFGVQALYVANPAVLSLYASGKISG------------------CVLDCG 161

Query: 173 FNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETI-----LVNNIK 227
              + +VP+ +G     AIK++D+GGR LT  LQ  +  R    +  T      LV  IK
Sbjct: 162 DGYSCSVPVYQGYTLKSAIKRIDLGGRDLTEQLQ--LQLRKSTGLSLTTSGEMELVRMIK 219

Query: 228 EQCTFVPPESYFSSFHNKMN-----TKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXX 282
           E+  +V  +        K N       +++ LPD +  F+   K                
Sbjct: 220 EKSCYVAVD--LDIEEEKCNYEGDQVGLKFKLPDGK--FITLSK---------------- 259

Query: 283 XXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFH 342
             + F VPE  F P +       I E I + ++     +RP + ++I+ +GG   +  F 
Sbjct: 260 --DRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDLRPQMWSDILLSGGTTMLKGFG 317

Query: 343 ERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLE 398
            RL  EL +        K+ +P E+  +   W      A    F+   VT+ ++ E
Sbjct: 318 NRLVQELDKLNQAQSRVKIWAPPERKYT--SWIGGSILAELSTFQKIIVTKSQWQE 371

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 77.4 bits (189), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 99/413 (23%), Positives = 171/413 (41%), Gaps = 71/413 (17%)

Query: 6   LVIDNGSYEIKFGESGWDQPLR-ALNCLTKDKYSRF----HLSNQTKKMRDISQAL---- 56
           +VIDNGS  IK G S  D+P     N     KY +      L N  K + + +Q++    
Sbjct: 12  IVIDNGSCIIKSGFSRQDKPAGFEYNLTGMPKYDKIMITGQLENLDKYIGNRAQSIRGLL 71

Query: 57  -IRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSK 115
            ++ P   G + +W+    +W + F +  +         + ++H L+++E  +TI +   
Sbjct: 72  RLQHPMNRGVVDNWDDMELLWWHIFNDTLNVQ-------NIEEHPLLITEAPLTIEKQRH 124

Query: 116 NMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNC 175
            M + +FE ++  S++   VA   P     Y     T               V+D G   
Sbjct: 125 IMCERLFETFNIPSLY---VAN--PSVLSLYASGNTTGC-------------VVDCGDGY 166

Query: 176 TWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQ----ETISFRHYNVMEETILVNNIKEQCT 231
             + PI +G     +I+K+++GGR +T  LQ    ++     Y+  E+ I V  IKE+  
Sbjct: 167 CSSTPIYEGFVLPASIRKMEVGGRDITEHLQFQIRKSSGISLYSSNEKEI-VRTIKEKVC 225

Query: 232 FVPP------ESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXE 285
           ++        ESY+    ++M+ K  + LPD            GKE             E
Sbjct: 226 YISEDFNKSEESYYLR-QDEMSCK--FKLPD------------GKE--------LTLNKE 262

Query: 286 VFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERL 345
            F  PE  F+P++  +    +     E I+     +RP L +NI+ TGG+     F  RL
Sbjct: 263 RFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSNILLTGGSTLFKGFGSRL 322

Query: 346 QTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLE 398
             +LQ         K+ +P E+  +   W           F++  VT+ ++ E
Sbjct: 323 LGDLQELTNNRAKIKILAPPERKYT--SWIGGSILTGLSTFKNLWVTKSDWEE 373

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 88/386 (22%), Positives = 161/386 (41%), Gaps = 72/386 (18%)

Query: 2   SEPVLVIDNGSYEIKFGESGWDQPLRALNCLTKD-KYSRFHL---------SNQTKKMRD 51
           ++PV VIDNGS  IK G SG ++P     CL  + KY +  L          N  +K+R 
Sbjct: 12  NQPV-VIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRG 70

Query: 52  ISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIP 111
           + +  +R P + G +  W+    +W Y   NE      +    +  +H L+++E  M   
Sbjct: 71  LLK--LRYPIKHGVVEDWDSMELIWSYVL-NE------VLQLQNIGEHPLLITEAPMNPL 121

Query: 112 ELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDS 171
           +  + M QV+FE +D  +++    A  +  Y                 +S +    V+D 
Sbjct: 122 KNREQMAQVLFETFDVSALYVSNPA-VLSLY-----------------ASGRTTGCVVDC 163

Query: 172 GFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQ----ETISFRHYNVMEETILVNNIK 227
           G      VPI  G     ++ ++DIGG  +T  LQ    ++     ++  E  I V  +K
Sbjct: 164 GEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREI-VRTMK 222

Query: 228 EQCTFVPP------ESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXX 281
           E+  ++        E Y     + ++T   + LPD      G   + G ++         
Sbjct: 223 EKVCYLAKNIKKEEEKYLQGTQDLIST---FKLPD------GRCIEVGNDR--------- 264

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNF 341
                +  PE  F P+I  +   G+ +  ++ I      +R  L+++I+ +GG   +  F
Sbjct: 265 -----YRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGF 319

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEK 367
            +R+  +L+         K+ +P E+
Sbjct: 320 GDRMLWDLEALTKGTSKIKIIAPSER 345

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 88/385 (22%), Positives = 159/385 (41%), Gaps = 77/385 (20%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRAL--NCLTKDKYSRFHL---------SNQTKKMRDISQ 54
           +VIDNGS  IK G SG ++P +AL  + +   KY +  L          N+ +K+R + +
Sbjct: 15  IVIDNGSGIIKVGFSGEERP-KALEYSLVGHVKYEKVMLEGLQGDTFVGNKAQKLRGLLR 73

Query: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
             +R P   G +  W+    +W Y   NE      +    + ++H L+++E  M   +  
Sbjct: 74  --LRYPMTHGVVEDWDSMELIWSYML-NE------VLQLQNIEEHPLLITEAPMNPLKNR 124

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           + M QV+FE ++  +++    A  +  Y                 +S +    V+D G  
Sbjct: 125 EVMAQVLFETFNLPALYISNPA-VLSLY-----------------ASGRTTGCVVDCGEG 166

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQ------ETISFRHYNVMEETILVNNIKE 228
               VPI  G     +I ++DIGGR +T  LQ        IS    + +E   +V  IKE
Sbjct: 167 YCSTVPIYDGFALPASIMRMDIGGRDITEQLQFQLRKSAGISLFSSSELE---VVRMIKE 223

Query: 229 QCTFVPP------ESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXX 282
           +  ++        + Y    H+  +    + LPD +   +G                   
Sbjct: 224 KVCYLAKNIKKEEDRYLQGHHDLGSV---FKLPDGKCIEIG------------------- 261

Query: 283 XXEVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFH 342
             + +  PE  F P+I      G+ +  ++ I      +R  L+++I+ +GG   +  F 
Sbjct: 262 -NDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSIILSGGTTTLRGFG 320

Query: 343 ERLQTELQRQCPIDWSCKVHSPQEK 367
           ER+  +L+         K+ +P E+
Sbjct: 321 ERMLHDLEALSKGTCKIKIIAPPER 345

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 88/384 (22%), Positives = 149/384 (38%), Gaps = 61/384 (15%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P   GQ+ +W+     W+        F +  T   + +DH
Sbjct: 102 FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSI-----FKYLRT---EPEDH 153

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKT 159
             +++E  +  PE  + + ++ FE ++   +       YI          + T++   K 
Sbjct: 154 FFLLTEPPLNPPENRQQVAEIFFESFNCAGL-------YIAVQAVLALAASWTSS---KV 203

Query: 160 SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEE 219
           +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q  +  R     + 
Sbjct: 204 TDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEQDA 261

Query: 220 TI-LVNNIKEQCTFVPPE--SYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXX 276
           ++     IK++  +V P+    F+ F        ++++               + K    
Sbjct: 262 SLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFIV---------------ENKERTT 306

Query: 277 XXXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILECINMCPEVVRPLLVANIVCTGG 334
                   E F  PE FF+PEIA    L P  V  + E I  CP  VR  L  NIV +GG
Sbjct: 307 KKVVDVGYERFLAPEIFFNPEIASSDFLTPLPV-VVDETIQACPIDVRKGLYNNIVLSGG 365

Query: 335 NFNIPNFHERLQTELQ----------------RQCPIDWSCKVHSPQEKDKSLHGWESMK 378
           +    +F  RLQ +L+                R   +D S   H  Q        W    
Sbjct: 366 STMFKDFGRRLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAV----WFGGS 421

Query: 379 DFANSDQFRSARVTREEYLEHGLD 402
             A + +F+S   T+++Y E+G D
Sbjct: 422 LLAQTGEFKSYCHTKQDYEEYGPD 445

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 89/384 (23%), Positives = 152/384 (39%), Gaps = 65/384 (16%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+       +   +  P   GQ+ +W+     W+        F +  T   + +DH
Sbjct: 107 FYIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSI-----FKYLRT---EPEDH 158

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAE--DK 157
             +++E  +  PE  + + ++ FE ++   +       YI          + T+++  D+
Sbjct: 159 FFLLTEPPLNPPENREQVAEIFFESFNCAGL-------YIAVQAVLALAASWTSSKVVDR 211

Query: 158 KTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVM 217
             +       VIDSG   T  +P+ +G     A+K + I GR +T  +Q  +  R   V 
Sbjct: 212 SLTG-----TVIDSGDGVTHVIPVAEGYVIGSALKNIPIAGRDITQFIQSLLRERG-EVD 265

Query: 218 EETILVNNIKEQCTFVPPE--SYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXX 275
                   IK++  +V P+    F+ F        +YV+ + Q      V   G E+   
Sbjct: 266 TSLRTAERIKQEYCYVCPDIVKEFNKFDRDAEKFAQYVVEN-QDKTRQKVVDIGYER--- 321

Query: 276 XXXXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETIL-ECINMCPEVVRPLLVANIVCT 332
                      F  PE FF+PEIA    L P  + T+L + I  CP  VR  L  NIV +
Sbjct: 322 -----------FLAPEIFFNPEIASSDFLTP--LPTVLDQTIQACPIDVRKGLYNNIVLS 368

Query: 333 GGNFNIPNFHERLQTELQ----------------RQCPIDWSCKVHSPQEKDKSLHGWES 376
           GG+    +F  RLQ +L+                R   +D     H  Q        W  
Sbjct: 369 GGSTMFKDFGRRLQRDLKSIVNNRIAETERLSGARSTGVDVQVISHRKQRNAV----WFG 424

Query: 377 MKDFANSDQFRSARVTREEYLEHG 400
               A + +F+    T+++Y E+G
Sbjct: 425 GSLLAQTPEFKGYCHTKKDYEEYG 448

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 84/381 (22%), Positives = 152/381 (39%), Gaps = 68/381 (17%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRAL--NCLTKDKYSRFH----------LSNQTKKMRDIS 53
           +VIDNG+  IK G +G  +P R L  + +   KY +            + N+ +K R I 
Sbjct: 15  IVIDNGTNVIKGGFTGETKP-RCLEYSIVGTPKYDKIMQSNGIESDSFIGNKAQKYRGIL 73

Query: 54  QALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPEL 113
           +  +R P   G + +W+    +W Y F  +D  +       +  +H ++++E  +     
Sbjct: 74  K--LRHPMLRGVVQNWDDMETIWQYVF--DDTLYLE-----NLNEHPILITEPPLNNMAN 124

Query: 114 SKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGF 173
            + M + +FE + F +++   V+  +  Y                 +S +     +D G 
Sbjct: 125 RQKMCEALFEIFGFPAVYIS-VSPVLSLY-----------------ASGQTTGCAVDCGD 166

Query: 174 NCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETI----SFRHYNVMEETILVNNIKEQ 229
               ++P+  G     ++KK+DIGG  +T  LQ +I        Y+  E  I V  IKE+
Sbjct: 167 GYCTSIPVYNGFSLASSVKKIDIGGCDITEQLQFSILKNTGLFMYSSSEREI-VRTIKEK 225

Query: 230 CTFVPPESYFSS---FHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEV 286
             ++  +    +     N+     ++ LPD +   +   K                    
Sbjct: 226 VCYIATDYNLETEKYLFNEEKMASQFKLPDGKMLNISQGK-------------------- 265

Query: 287 FSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQ 346
           ++  E  F PE+       + E   + I      +R  L +NIV +GG    P F  RL 
Sbjct: 266 YTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIVLSGGTTMCPGFGSRLL 325

Query: 347 TELQRQCPIDWSCKVHSPQEK 367
            ELQ     D   ++ +P E+
Sbjct: 326 KELQTLTGYDTKIRIIAPPER 346

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 82/383 (21%), Positives = 161/383 (42%), Gaps = 73/383 (19%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRAL--NCLTKDKYSRFHL---------SNQTKKMRDISQ 54
           +VIDNGS  IK G SG ++P +AL  + +   KY +  L          N+ +K+R + +
Sbjct: 15  IVIDNGSGIIKAGFSGEERP-KALEYSLVGHTKYDKVMLEGLQGDTFVGNKAQKLRGLLR 73

Query: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
             +R P + G +  W+    +W Y   NE      +    + ++H L+++E  M   +  
Sbjct: 74  --LRYPMKHGVVEDWDSMELIWSYVL-NE------VLQLQNIEEHPLLITEAPMNPLKNR 124

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           + + QV+FE ++  +++    A  +  Y                 +S +    V+D G  
Sbjct: 125 EMIAQVMFETFNLSAIYVSDPA-VLSLY-----------------ASGRTTGCVVDCGEG 166

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQ----ETISFRHYNVMEETILVNNIKEQC 230
              +VPI  G     +I ++DIGG  +T  LQ    ++     ++  E  I V  IKE+ 
Sbjct: 167 YCSSVPIYDGFALPASIMRMDIGGGDITEQLQFQIRKSAGVSLFSSSEREI-VRTIKEKV 225

Query: 231 TFVPPES------YFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXX 284
            ++  ++      Y     + ++    + LPD ++  +G                     
Sbjct: 226 CYLAKDAKKEEDKYLQGTQDLISA---FKLPDGKSIEVG--------------------N 262

Query: 285 EVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHER 344
           + +  PE  F P+I      G+    ++ I      +R  L+++++ +GG   +  F +R
Sbjct: 263 DRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVILSGGTTTLKGFGDR 322

Query: 345 LQTELQRQCPIDWSCKVHSPQEK 367
           +  +L+         K+ +P E+
Sbjct: 323 MLHDLEALTKGTSKIKIIAPPER 345

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 85/381 (22%), Positives = 150/381 (39%), Gaps = 59/381 (15%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P   GQ+ +W+     W+        F +  T   + +DH
Sbjct: 102 FYIGNEALAASRGPSYSLSYPIRHGQVENWDHMERFWENSI-----FKYLRT---EPEDH 153

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKT 159
             +++E  +  PE  + + ++ FE ++   +       YI          + T++   K 
Sbjct: 154 FFLLTEPPLNPPENREQVAEIFFESFNCAGL-------YIAVQAVLALAASWTSS---KV 203

Query: 160 SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEE 219
           +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q  +  R   V   
Sbjct: 204 TDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERG-EVDTS 262

Query: 220 TILVNNIKEQCTFVPPE--SYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXX 277
                 IK++  +V P+    F+ F        ++++ + +++         K+K     
Sbjct: 263 LRTAERIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIVENSEST---------KKK----- 308

Query: 278 XXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILECINMCPEVVRPLLVANIVCTGGN 335
                  E F  PE FF+PEIA    L P +   + + I  CP  VR  L  NIV +GG+
Sbjct: 309 -IVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGS 366

Query: 336 FNIPNFHERLQTELQ----------------RQCPIDWSCKVHSPQEKDKSLHGWESMKD 379
               +F  RLQ +L+                +   +D     H  Q        W     
Sbjct: 367 TMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAV----WFGGSL 422

Query: 380 FANSDQFRSARVTREEYLEHG 400
            A + +F+S   T+++Y E+G
Sbjct: 423 LAQTAEFKSYCHTKQDYEEYG 443

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 90/385 (23%), Positives = 156/385 (40%), Gaps = 67/385 (17%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+       +   +  P   GQ+ +W+     W+        F +  T   + +DH
Sbjct: 99  FYIGNEALIASQGASYSLSYPIRHGQVENWDHMERFWENSI-----FKYLRT---EPEDH 150

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAE--DK 157
             +++E  +  PE  + + ++ FE ++   +       YI          + T+++  D+
Sbjct: 151 FFLLTEPPLNPPENREQIAEIFFESFNCAGL-------YIAVQAVLALAASWTSSKVVDR 203

Query: 158 KTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVM 217
             +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q  +  R     
Sbjct: 204 SLTG-----TVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITQFIQTLL--RERGEA 256

Query: 218 EETI-LVNNIKEQCTFVPPE--SYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXX 274
           + ++     IK++  +V P+    F+ F        +YV+ + Q      V   G E+  
Sbjct: 257 DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDPEKFAQYVVEN-QEKTQKKVVDVGYER-- 313

Query: 275 XXXXXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETIL-ECINMCPEVVRPLLVANIVC 331
                       F  PE FF+PEIA    L P  + TI+ + I  CP  VR  L  NIV 
Sbjct: 314 ------------FLAPEIFFNPEIASSDFLTP--LPTIVDQTIQACPIDVRKGLYNNIVL 359

Query: 332 TGGNFNIPNFHERLQTELQ----------------RQCPIDWSCKVHSPQEKDKSLHGWE 375
           +GG+    +F  RLQ +L+                +   +D S   H  Q        W 
Sbjct: 360 SGGSTMFKDFGRRLQRDLKSIVNNRIAQNELLSGTKSTGVDVSVISHRKQRNAV----WF 415

Query: 376 SMKDFANSDQFRSARVTREEYLEHG 400
                A + +F+S   T+++Y E+G
Sbjct: 416 GGSLLAQTAEFKSYCHTKKDYEEYG 440

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 85/383 (22%), Positives = 149/383 (38%), Gaps = 63/383 (16%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P   GQ+ +W+     W+        F +  T   + +DH
Sbjct: 100 FYIGNEALAAAQGQSYSLSYPIRHGQVENWDHMERFWENSI-----FKYLRT---EPEDH 151

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKT 159
             +++E  +  PE  + + ++ FE ++   +       YI          + T+    K 
Sbjct: 152 FFLLTEPPLNPPENREQVAEIFFESFNCAGL-------YIAVQAVLALAASWTSP---KV 201

Query: 160 SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEE 219
           +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q+ +  R     ++
Sbjct: 202 TDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQQLLRERG---EQD 258

Query: 220 TIL--VNNIKEQCTFVPPE--SYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXX 275
           T L     IK++  +V P+    F+ F    +   ++V+               + +   
Sbjct: 259 TSLKTAERIKQEYCYVCPDIVKEFNKFDRDASKFAQFVV---------------ESQEKT 303

Query: 276 XXXXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILECINMCPEVVRPLLVANIVCTG 333
                    E F  PE FF+PEIA    L P +   + E I  CP  VR  L  NIV +G
Sbjct: 304 RKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNIVLSG 362

Query: 334 GNFNIPNFHERLQTELQ----------------RQCPIDWSCKVHSPQEKDKSLHGWESM 377
           G+    +F  RLQ +++                +   +D     H  Q        W   
Sbjct: 363 GSTMFKDFGRRLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRNAV----WFGG 418

Query: 378 KDFANSDQFRSARVTREEYLEHG 400
              A + +F+S   T+++Y E+G
Sbjct: 419 SLLAQTAEFKSYCHTKKDYDEYG 441

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 86/387 (22%), Positives = 143/387 (36%), Gaps = 71/387 (18%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P   GQ+ +W+     W+        F +  T   + +DH
Sbjct: 95  FYIGNEALAAAQGPSYSLSYPIRHGQIENWDHMERFWENSI-----FKYLRT---EPEDH 146

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKT 159
             +++E  +  PE  + + ++ FE ++   +       YI          + T++   K 
Sbjct: 147 FFLLTEPPLNPPENREQVAEIFFESFNCAGL-------YIAVQAVLALAASWTSS---KV 196

Query: 160 SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEE 219
           +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q  +  R       
Sbjct: 197 TDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGETDTSL 256

Query: 220 TILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGK-------EK 272
                  +E C                     YV PD    F  + + P K        +
Sbjct: 257 RTAERIKQEYC---------------------YVCPDIVKEFNKFDRNPDKFAQFIVENQ 295

Query: 273 XXXXXXXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILE-CINMCPEVVRPLLVANI 329
                       E F  PE FF+PEIA    L P  + TI++  I  CP  VR  L  NI
Sbjct: 296 EKTQKKIVDVGYERFLAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYNNI 353

Query: 330 VCTGGNFNIPNFHERLQTELQ----------------RQCPIDWSCKVHSPQEKDKSLHG 373
           V +GG+    +F  RLQ +++                +   +D +   H  Q        
Sbjct: 354 VLSGGSTMFKDFGRRLQRDIKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRNAV---- 409

Query: 374 WESMKDFANSDQFRSARVTREEYLEHG 400
           W      A + +F+S   T+++Y E+G
Sbjct: 410 WFGGSLLAQTAEFKSYCHTKKDYEEYG 436

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score = 68.6 bits (166), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 86/386 (22%), Positives = 140/386 (36%), Gaps = 69/386 (17%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P   GQ+ +W+     W+        F +  T   + +DH
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSI-----FKYLRT---EPEDH 146

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKT 159
             +++E  +  PE  + + ++ FE ++   +       YI          + T++   K 
Sbjct: 147 FFLLTEPPLNPPENREQVAEIFFESFNCAGL-------YIAVQAVLALAASWTSS---KV 196

Query: 160 SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEE 219
           +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q  +  R       
Sbjct: 197 TDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEADTSL 256

Query: 220 TILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGK-------EK 272
                  +E C                     YV PD    F  + K P K        +
Sbjct: 257 RTAEKIKQEYC---------------------YVCPDIVKEFNKFDKDPSKFAQFVVENQ 295

Query: 273 XXXXXXXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILECINMCPEVVRPLLVANIV 330
                       E F  PE FF+PEIA    L P +   + + I  CP  VR  L  NIV
Sbjct: 296 EKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIV 354

Query: 331 CTGGNFNIPNFHERLQTELQ----------------RQCPIDWSCKVHSPQEKDKSLHGW 374
            +GG+    +F  RLQ +L+                +   +D S   H  Q        W
Sbjct: 355 LSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAV----W 410

Query: 375 ESMKDFANSDQFRSARVTREEYLEHG 400
                 A + +F+    T+++Y E+G
Sbjct: 411 FGGSLLAQTAEFKGYCHTKKDYEEYG 436

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 87/382 (22%), Positives = 150/382 (39%), Gaps = 61/382 (15%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P + GQ+ +W      W+        F +  T   + +DH
Sbjct: 104 FYIGNEALTAAQGPAYSLSYPIKHGQVENWNHMERFWENSI-----FKYLRT---EPEDH 155

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKT 159
             +++E  +  PE  + + ++ FE ++   +       YI          + T++   K 
Sbjct: 156 FFLLTEPPLNPPENREQVAEIFFESFNCAGL-------YIAVQAVLALAASWTSS---KV 205

Query: 160 SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEE 219
           +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q  +  R   V   
Sbjct: 206 TDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERG-EVDTS 264

Query: 220 TILVNNIKEQCTFVPPE--SYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXX 277
                 IK++  +V P+    F+ F   +    +++           ++  GK +     
Sbjct: 265 LKTAERIKQEYCYVCPDIVKEFNKFDRDVGKFSQFI-----------IENQGKTQ----K 309

Query: 278 XXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILE-CINMCPEVVRPLLVANIVCTGG 334
                  E F  PE FF+PEIA    L P  + TI++  I  CP  VR  L +NIV +GG
Sbjct: 310 KIVDVGYERFLAPEIFFNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYSNIVLSGG 367

Query: 335 NFNIPNFHERLQTELQ----------------RQCPIDWSCKVHSPQEKDKSLHGWESMK 378
           +    +F  RLQ +L+                +   +D     H  Q        W    
Sbjct: 368 STMFKDFGRRLQRDLRSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRNAV----WFGGS 423

Query: 379 DFANSDQFRSARVTREEYLEHG 400
             A + +F+S   T+ +Y E+G
Sbjct: 424 LLAQTAEFKSYCHTKRDYEEYG 445

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 85/386 (22%), Positives = 140/386 (36%), Gaps = 69/386 (17%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P   GQ+ +W+     W+        F +  T   + +DH
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSI-----FKYLRT---EPEDH 146

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKT 159
             +++E  +  PE  + + ++ FE ++   +       YI          + T++   K 
Sbjct: 147 FFLLTEPPLNPPENREQVAEIFFESFNCAGL-------YIAVQAVLALAASWTSS---KV 196

Query: 160 SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEE 219
           +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q  +  R       
Sbjct: 197 TDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEADTSL 256

Query: 220 TILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGK-------EK 272
                  +E C                     YV PD    F  + + P K        +
Sbjct: 257 RTAEKIKQEYC---------------------YVCPDIVKEFNKFDRDPSKFAQFVVENQ 295

Query: 273 XXXXXXXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILECINMCPEVVRPLLVANIV 330
                       E F  PE FF+PEIA    L P +   + + I  CP  VR  L  NIV
Sbjct: 296 EKTRRKAVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIV 354

Query: 331 CTGGNFNIPNFHERLQTELQ----------------RQCPIDWSCKVHSPQEKDKSLHGW 374
            +GG+    +F  RLQ +L+                +   +D S   H  Q        W
Sbjct: 355 LSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAV----W 410

Query: 375 ESMKDFANSDQFRSARVTREEYLEHG 400
                 A + +F+    T+++Y E+G
Sbjct: 411 FGGSLLAQTAEFKGYCHTKKDYEEYG 436

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 85/386 (22%), Positives = 140/386 (36%), Gaps = 69/386 (17%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P   GQ+ +W+     W+        F +  T   + +DH
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSI-----FKYLRT---EPEDH 146

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKT 159
             +++E  +  PE  + + ++ FE ++   +       YI          + T++   K 
Sbjct: 147 FFLLTEPPLNPPENREQVAEIFFESFNCAGL-------YIAVQAVLALAASWTSS---KV 196

Query: 160 SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEE 219
           +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q  +  R       
Sbjct: 197 TDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEADTSL 256

Query: 220 TILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGK-------EK 272
                  +E C                     YV PD    F  + + P K        +
Sbjct: 257 RTAEKIKQEYC---------------------YVCPDIVKEFNKFDRDPSKFAQFVVENQ 295

Query: 273 XXXXXXXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILECINMCPEVVRPLLVANIV 330
                       E F  PE FF+PEIA    L P +   + + I  CP  VR  L  NIV
Sbjct: 296 EKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIV 354

Query: 331 CTGGNFNIPNFHERLQTELQ----------------RQCPIDWSCKVHSPQEKDKSLHGW 374
            +GG+    +F  RLQ +L+                +   +D S   H  Q        W
Sbjct: 355 LSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAV----W 410

Query: 375 ESMKDFANSDQFRSARVTREEYLEHG 400
                 A + +F+    T+++Y E+G
Sbjct: 411 FGGSLLAQTAEFKGYCHTKKDYEEYG 436

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 75/316 (23%), Positives = 131/316 (41%), Gaps = 41/316 (12%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P   GQ+ +W+     W+        F +  T   + +DH
Sbjct: 100 FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSI-----FKYLRT---EPEDH 151

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKT 159
             +++E  +  PE  + + ++ FE ++   +       YI          + T++   K 
Sbjct: 152 FFLLTEPPLNPPENREQIAEIFFESFNCAGL-------YIAVQAVLALAASWTSS---KV 201

Query: 160 SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEE 219
           +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q  +  R     + 
Sbjct: 202 TDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLL--RERGEADT 259

Query: 220 TI-LVNNIKEQCTFVPPE--SYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXX 276
           ++     IK++  +V P+    F+ F        ++V+ + Q S    +   G E+    
Sbjct: 260 SLRTAERIKQEYCYVCPDIVKEFNKFDRDGEKFAQFVVEN-QESTRKKIVDVGYER---- 314

Query: 277 XXXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILECINMCPEVVRPLLVANIVCTGG 334
                     F  PE FF+PEIA    L P +   + + I  CP  VR  L  NIV +GG
Sbjct: 315 ----------FLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGG 363

Query: 335 NFNIPNFHERLQTELQ 350
           +    +F  RLQ +L+
Sbjct: 364 STMFKDFGRRLQRDLK 379

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 85/386 (22%), Positives = 140/386 (36%), Gaps = 69/386 (17%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P   GQ+ +W+     W+        F +  T   + +DH
Sbjct: 95  FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSI-----FKYLRT---EPEDH 146

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKT 159
             +++E  +  PE  + + ++ FE ++   +       YI          + T++   K 
Sbjct: 147 FFLLTEPPLNPPENREQVAEIFFESFNCAGL-------YIAVQAVLALAASWTSS---KV 196

Query: 160 SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEE 219
           +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q  +  R       
Sbjct: 197 TDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEADTSL 256

Query: 220 TILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGK-------EK 272
                  +E C                     YV PD    F  + + P K        +
Sbjct: 257 RTAEKIKQEYC---------------------YVCPDIVKEFNKFDRDPSKFAQFVVENQ 295

Query: 273 XXXXXXXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILECINMCPEVVRPLLVANIV 330
                       E F  PE FF+PEIA    L P +   + + I  CP  VR  L  NIV
Sbjct: 296 EKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVRKGLYNNIV 354

Query: 331 CTGGNFNIPNFHERLQTELQ----------------RQCPIDWSCKVHSPQEKDKSLHGW 374
            +GG+    +F  RLQ +L+                +   +D S   H  Q        W
Sbjct: 355 LSGGSTMFKDFGRRLQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAV----W 410

Query: 375 ESMKDFANSDQFRSARVTREEYLEHG 400
                 A + +F+    T+++Y E+G
Sbjct: 411 FGGSLLAQTAEFKGYCHTKKDYEEYG 436

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 86/381 (22%), Positives = 148/381 (38%), Gaps = 59/381 (15%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P   GQ+ +W+     W+        F +  T   + +DH
Sbjct: 108 FYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSI-----FKYLRT---EPEDH 159

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKT 159
             +++E  +  PE  + + ++ FE ++   +       YI          + T++   K 
Sbjct: 160 FFLLTEPPLNPPENREQIAEIFFESFNCAGL-------YIAVQAVLALAASWTSS---KV 209

Query: 160 SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEE 219
           +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q  +  R   V   
Sbjct: 210 TDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERG-EVDTS 268

Query: 220 TILVNNIKEQCTFVPPE--SYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXX 277
                 IK++  +V P+    F+ F    +   ++++ + Q      V   G E+     
Sbjct: 269 LKTAERIKQEYCYVCPDIVKEFNKFDRDGSKFAQFIVEN-QEQTRKKVVDVGYER----- 322

Query: 278 XXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILECINMCPEVVRPLLVANIVCTGGN 335
                    F  PE FF+PEIA    L P +   +   I  CP  VR  L  NIV +GG+
Sbjct: 323 ---------FLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDVRKGLYNNIVLSGGS 372

Query: 336 FNIPNFHERLQTELQ----------------RQCPIDWSCKVHSPQEKDKSLHGWESMKD 379
               +F  RLQ +L+                +   +D     H  Q        W     
Sbjct: 373 TMFKDFGRRLQRDLKSIVSNRIAQSERLSGTKSTGVDVQVISHRKQRNAV----WFGGSL 428

Query: 380 FANSDQFRSARVTREEYLEHG 400
            A + +F+S   T+++Y E+G
Sbjct: 429 LAQTAEFKSYCHTKKDYEEYG 449

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 73/315 (23%), Positives = 123/315 (39%), Gaps = 39/315 (12%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P   GQ+  W      W+        F +  T   + +DH
Sbjct: 101 FYIGNEALAAAQGPSYSLSYPIRHGQVEDWNHMERFWENSI-----FKYLRT---EPEDH 152

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKT 159
             +++E  +  PE  + + ++ FE ++   +       YI          + T++   K 
Sbjct: 153 FFLLTEPPLNPPENREQVAEIFFESFNCAGL-------YIAVQAVLALAASWTSS---KV 202

Query: 160 SSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEE 219
           +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q  +  R   V   
Sbjct: 203 TDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGRDITLFIQSLLRERG-EVDTS 261

Query: 220 TILVNNIKEQCTFVPPE--SYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXX 277
                 IK++  +V P+    F+ F        ++++               + K     
Sbjct: 262 LRTAERIKQEYCYVCPDIVKEFNKFDRDATKFAQFIV---------------ENKEKTQK 306

Query: 278 XXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILECINMCPEVVRPLLVANIVCTGGN 335
                  E F  PE FF+PEIA    L P +   + + I  CP  VR  L  NIV +GG+
Sbjct: 307 KVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGGS 365

Query: 336 FNIPNFHERLQTELQ 350
               +F  RLQ +L+
Sbjct: 366 TMFKDFGRRLQRDLR 380

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 83/384 (21%), Positives = 150/384 (39%), Gaps = 65/384 (16%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P   GQ+ +W+     W+   +             + +DH
Sbjct: 104 FYIGNEALVASQGPAYSLSYPIRHGQVENWDHMERFWENSIFK--------YLRAEPEDH 155

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAE--DK 157
             +++E  +  PE  + + ++ FE ++   +       YI          + T+A+  D+
Sbjct: 156 FFLLTEPPLNPPENREQVAEIFFESFNCAGL-------YIAVQAVLALAASWTSAQVTDR 208

Query: 158 KTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVM 217
             +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q  +  R     
Sbjct: 209 SLTG-----TVIDSGDGVTHVIPVAEGYVVGSAIKNIPIAGRDITLFIQSLL--RERGEA 261

Query: 218 EETI-LVNNIKEQCTFVPPE--SYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXX 274
           + ++     IK++  +V P+    F+ F  +     ++++ + Q      V   G E+  
Sbjct: 262 DSSLKTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQFIIEN-QDKTTKKVIDIGYER-- 318

Query: 275 XXXXXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILECINMCPEVVRPLLVANIVCT 332
                       F  PE FF+PEIA    L P +   + + I  CP  VR  L  NIV +
Sbjct: 319 ------------FLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLS 365

Query: 333 GGNFNIPNFHERLQTELQ----------------RQCPIDWSCKVHSPQEKDKSLHGWES 376
           GG+    +F  RLQ +++                +   +D     H  Q        W  
Sbjct: 366 GGSTMFKDFSRRLQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAV----WFG 421

Query: 377 MKDFANSDQFRSARVTREEYLEHG 400
               A + +F+    T+++Y EHG
Sbjct: 422 GSLLAQTAEFKGYCHTKKDYEEHG 445

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 81/401 (20%), Positives = 165/401 (41%), Gaps = 70/401 (17%)

Query: 1   MSEPVLVIDNGSYEIKFGESGWDQP-LRALNCLTKDKYSRFHLSNQTKKMRDISQALIRR 59
           +++PV ++DNGS  IK G +G  QP +     +      R  ++   K+    + A  RR
Sbjct: 9   LNQPV-ILDNGSSVIKAGFAGSQQPDVLEYAWIGNPLAERSMVTVSNKETYIGNSAYERR 67

Query: 60  -------PHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPE 112
                  P+    ++SW+   ++WDY   N+ +           ++H +V++ ++ T  +
Sbjct: 68  ATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIE-------QLQEHPVVLTNSMSTSKK 120

Query: 113 LSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSG 172
             + M +V+FE++   +++               +D  M+     +T+        +  G
Sbjct: 121 EEEKMCEVLFEKFSIPAIYCS-------------RDPIMSLYGLGRTTGCS-----VSCG 162

Query: 173 FNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH---YNVMEETILVNNIKEQ 229
                   +I G+    + +  + GG  +T  + + +   H    N      L+ +IKE+
Sbjct: 163 HRGIGITTVIDGMIVGGSSQISNTGGSAVTNTMLDLLRHNHPKLENGQNGIELIRSIKER 222

Query: 230 CTFVPPESY-----FSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXX 284
           C  +  + Y     +    +K +   +Y LPD      G + + G E+            
Sbjct: 223 CCVLSKDFYNEIRAYELITSKTSNN-KYRLPD------GNIIEIGSER------------ 263

Query: 285 EVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHER 344
             F  PE  F+P+     +  + + I+  I+    + R  L+ +IV +GG+  I  F ER
Sbjct: 264 --FEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESIVLSGGSSLIKGFGER 321

Query: 345 LQTELQRQCPIDWSCKVHSPQEK-------DKSLHGWESMK 378
           L  E++++   +    +++P E+          L G  +MK
Sbjct: 322 LTKEIRKEIDGNQKIMLNAPHERRFLPWIGGSVLSGLSTMK 362

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 82/383 (21%), Positives = 160/383 (41%), Gaps = 73/383 (19%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRAL--NCLTKDKYSRFHL---------SNQTKKMRDISQ 54
           +VIDNGS  IK G SG ++P ++L  + +   KY +  L          N+ +++R + +
Sbjct: 15  IVIDNGSGIIKAGFSGEEKP-KSLEYSLVGHAKYDKVMLEGLQGDTFVGNKAQRLRGLLR 73

Query: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
             ++ P E G +  W+    +W +   NE      +    + ++H L+++E  M   +  
Sbjct: 74  --LQYPIEHGVVEDWDSMELIWAHIL-NE------VLQLQNIEEHPLLITEAPMNPLKNR 124

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           + M QV+FE ++  +++    A  +  Y                 +S +    VID G  
Sbjct: 125 EVMAQVLFETFNLPALYVSNPA-VLSLY-----------------ASGRTTGCVIDCGEG 166

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQ----ETISFRHYNVMEETILVNNIKEQC 230
               VPI  G     ++ ++DIGGR +T  LQ    ++     ++  E  I V  IKE+ 
Sbjct: 167 YCSTVPIYDGFALPASMMRMDIGGRDITKQLQFQLRKSAGVSLFSSSEREI-VRTIKEKV 225

Query: 231 TFVPPE------SYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXX 284
            ++  +      +Y     +  +    + LPD +   +G                     
Sbjct: 226 CYLATDIKKEENTYMQESQDLTSV---FKLPDGKCIEIG--------------------N 262

Query: 285 EVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHER 344
           + +  PE  F P+I      G+ +  ++ I      +R  L+++I+ +GG   +  F +R
Sbjct: 263 DRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSIILSGGTTTLRGFGDR 322

Query: 345 LQTELQRQCPIDWSCKVHSPQEK 367
           +  +L+         K+ +P E+
Sbjct: 323 MLHDLEAFTKGTSKIKIIAPPER 345

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score = 65.9 bits (159), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 73/322 (22%), Positives = 124/322 (38%), Gaps = 53/322 (16%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P   GQ+ +W+     W+        F +  T   + +DH
Sbjct: 104 FYIGNEALVAAQSPSYSLSYPIRHGQVENWDHMERFWENSI-----FKYLRT---EPEDH 155

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAE--DK 157
           + +++E  +  PE  + + ++ FE ++   +       YI          + T+++  D+
Sbjct: 156 YFLLTEPPLNPPENREQVAEIFFESFNCAGL-------YIAVQAVLALAASWTSSKVIDR 208

Query: 158 KTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVM 217
             +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q  +  R     
Sbjct: 209 SLTG-----TVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITEFIQSLLRERGEADT 263

Query: 218 EETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGK------- 270
                    +E C                     YV PD    F  + ++P K       
Sbjct: 264 SLRTAERIKQEYC---------------------YVCPDIVKEFNKFDRQPEKFAQFIVE 302

Query: 271 EKXXXXXXXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILECINMCPEVVRPLLVAN 328
            +            E F  PE FF+PEIA    L P +   + + I  CP  VR  L  N
Sbjct: 303 SQEKTKQKVVDVGYERFLAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDVRKGLYNN 361

Query: 329 IVCTGGNFNIPNFHERLQTELQ 350
           IV +GG+    +F  RLQ +++
Sbjct: 362 IVLSGGSTMFKDFSRRLQRDMK 383

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 130/300 (43%), Gaps = 49/300 (16%)

Query: 60  PHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119
           P   GQ+ +W+     W+        F +  T   + +DH  +++E  +  PE  + + +
Sbjct: 127 PIRHGQVENWDHMERFWENSI-----FKYLRT---EPEDHCFLLTEPPLNPPENREQVAE 178

Query: 120 VIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAE--DKKTSSYKDFQLVIDSGFNCTW 177
           + FE ++   +       YI          + T+++  D+  +       VIDSG   T 
Sbjct: 179 IFFESFNCAGL-------YIAVQAVLALAASWTSSKVIDRSLTG-----TVIDSGDGVTH 226

Query: 178 AVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETIL--VNNIKEQCTFVPP 235
            +P+ +G     AIK + I GR +T  +Q+ +  R     E+T L     IK++  +V P
Sbjct: 227 VIPVAEGYVIGSAIKNIPIAGRDITLFIQQLLRERG---EEDTSLRTAERIKQEYCYVCP 283

Query: 236 E--SYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSVPETF 293
           +    F+ F        ++V+ + Q      V   G E+              F  PE F
Sbjct: 284 DIVKEFNKFDRDSEKFAQFVV-ESQEKTRRKVVDVGCER--------------FMAPEIF 328

Query: 294 FHPEIAQ--ILKPGIVETILE-CINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQ 350
           F+PEIA    L P  + TI++  I  CP  VR  L  NIV +GG+    +F  RLQ +L+
Sbjct: 329 FNPEIASSDFLTP--LPTIVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLK 386

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 83/390 (21%), Positives = 143/390 (36%), Gaps = 77/390 (19%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P   GQ+ +W+     W+   +             + +DH
Sbjct: 106 FYIGNEALIASQGPSYSLSYPIRHGQIENWDHMERFWENSIFK--------YLRAEPEDH 157

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMF---KGPVAQYIPFYQGQYQDDAMTAAED 156
             +++E  +  PE  + + ++ FE ++   ++   +  +A    +   Q  D ++T    
Sbjct: 158 FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSQVTDRSLTGT-- 215

Query: 157 KKTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNV 216
                      VIDSG   T  +P+ +G     AIK + I GR +T  +Q  +  R    
Sbjct: 216 -----------VIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEAD 264

Query: 217 MEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGK------ 270
                     +E C                     YV PD    F  + ++P K      
Sbjct: 265 TSLRTAERIKQEYC---------------------YVCPDIVKEFNKFDRQPEKFAQFII 303

Query: 271 -EKXXXXXXXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILE-CINMCPEVVRPLLV 326
             +            E F  PE FF+PEIA    L P  + T+++  I  CP  VR  L 
Sbjct: 304 ENQDKTKQKVVDIGYERFLAPEIFFNPEIASSDFLTP--LPTVVDHTIQACPIDVRKGLY 361

Query: 327 ANIVCTGGNFNIPNFHERLQTELQ----------------RQCPIDWSCKVHSPQEKDKS 370
            NIV +GG+    +F  RLQ +++                +   +D     H  Q     
Sbjct: 362 NNIVLSGGSTMFKDFSRRLQRDIKSIVNSRIIQNEAVTGVKSTGVDVQVISHRKQRNAV- 420

Query: 371 LHGWESMKDFANSDQFRSARVTREEYLEHG 400
              W      A + +F+S   T+++Y E+G
Sbjct: 421 ---WFGGSLLAQTAEFKSYCHTKKDYEEYG 447

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 61/134 (45%), Gaps = 10/134 (7%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVE----TILECINMCP---EVVRPLLVANIVCTGGNFN 337
           E   VPE  F P IA   + GI E     +L+     P         +V N+  TGGN  
Sbjct: 613 ERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSAASSRMVNNVWITGGNAR 672

Query: 338 IPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSD-QFRSARVTREEY 396
           IP    R+  E     P      VH  +  D SL  W+ M   AN++  +++  VTR+EY
Sbjct: 673 IPGIKNRIVKEFTEFLPAGTPLSVHMSE--DPSLDAWKGMAKLANNETDYKNTAVTRKEY 730

Query: 397 LEHGLDWCTKNRFG 410
            E+G D+  +++ G
Sbjct: 731 EEYGPDYIKEHKLG 744

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 52/241 (21%), Positives = 101/241 (41%), Gaps = 36/241 (14%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNC-LTKDKYSRFH-----LSNQTKKMRDISQALIRR 59
           + ID GSY I+ G +  + P       LTK +  +       + N T   + I ++  + 
Sbjct: 39  IAIDFGSYNIRAGYTNQNTPSYIFPTRLTKHRDRKLQKTFTFIGNDTLLDQTI-RSQSKS 97

Query: 60  PHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119
           P +   L +W+   ++ +Y F+     H  ++ +N    + L+++E L  +     +  Q
Sbjct: 98  PFDGTLLTNWDYVEDMLEYTFH-----HLGVSGNNGVS-NPLIINERLACLQSQRNSWYQ 151

Query: 120 VIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAV 179
           ++FE +D   +  G +     FY                 +S K+  LVI+ G   T  +
Sbjct: 152 LLFETFDLPEVSFG-IDSLFSFY----------------GNSTKEDGLVINCGNEETDVI 194

Query: 180 PIIKGVPYYKAIKKLDIGG----RFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVPP 235
           PI+ G       K+++ GG     FL+ LL  T+ + ++     T+    + E   +  P
Sbjct: 195 PIVGGRGILSECKRINWGGSQSTNFLSSLL--TLKYPYFPAKLSTLQYTQMYEDYCYTSP 252

Query: 236 E 236
           +
Sbjct: 253 D 253

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 63/142 (44%), Gaps = 27/142 (19%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVE---TIL-------------ECINMCPEVVRPLLVAN 328
           E    PE  F P +  + + GI E    IL             +C++M          +N
Sbjct: 611 ERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCLDMA---------SN 661

Query: 329 IVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRS 388
           I  TGGN  IPN  ER+  E     P++    V+  Q  + SL  W+ M  FA SD + S
Sbjct: 662 IFITGGNTKIPNLRERIVNEFTGFLPVNTPLNVNYAQ--NVSLDAWKGMAKFARSDTYSS 719

Query: 389 ARVTREEYLEHGLDWCTKNRFG 410
             VT+ EY E G ++  +++ G
Sbjct: 720 TCVTKVEYEEFGPNYIKEHKLG 741

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 50/224 (22%), Positives = 84/224 (37%), Gaps = 49/224 (21%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALI-------- 57
           + +D GSYE++ G +  D P          K  R+       K R I +AL         
Sbjct: 42  IALDFGSYEVRAGFTSQDTPSHVFPT----KIVRY-------KERKIQKALTFIGNDCSL 90

Query: 58  --------RRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMT 109
                   R P++   + +WE   ++  Y F      H      ND   + ++++E + T
Sbjct: 91  DNAVRSHSRSPYDGSLITNWEYMEDMLSYTF------HHLGVQPNDGISNPMILTEKMAT 144

Query: 110 IPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVI 169
           +     N  Q++FE Y    +  G +     FY     D                  L+I
Sbjct: 145 VQAQRSNWYQLLFECYGIPQVTFG-IDGLFSFYANNSPDST---------------GLII 188

Query: 170 DSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
           +SG   T  +P+IKG       K++D GG      L+  +S ++
Sbjct: 189 NSGHEDTNIIPVIKGKGILSEAKRIDWGGNQSIDYLKSLLSLKY 232

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 128/300 (42%), Gaps = 49/300 (16%)

Query: 60  PHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119
           P   GQ+ +W+     W+        F +  T   + +DH+ +++E  +  PE  + + +
Sbjct: 111 PIRHGQVENWDHMERFWENSI-----FKYLRT---EPEDHYFLLTEPPLNPPENREQVAE 162

Query: 120 VIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAE--DKKTSSYKDFQLVIDSGFNCTW 177
           + FE ++   +       YI          + T+++  D+  +       VIDSG   T 
Sbjct: 163 IFFESFNCAGL-------YIAVQAVLALAASWTSSKVVDRSLTG-----TVIDSGDGVTH 210

Query: 178 AVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETIL--VNNIKEQCTFVPP 235
            +P+ +G     AIK + I GR +T  +Q  +  R     E+T L     IK++  +V  
Sbjct: 211 VIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERG---EEDTTLRTAERIKQEYCYVCS 267

Query: 236 E--SYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXXXXEVFSVPETF 293
           +    F+ F        ++++ + + +    +                   E F  PE F
Sbjct: 268 DIVKEFNKFDRDSEKFAQFIVENSEKTRRKVID---------------VGYERFLAPEIF 312

Query: 294 FHPEIAQ--ILKPGIVETIL-ECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQ 350
           F+PEIA    L P  + TI+ + I  CP  VR  L  NIV +GG+    +F  RLQ +L+
Sbjct: 313 FNPEIASSDFLTP--LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLK 370

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 74/322 (22%), Positives = 125/322 (38%), Gaps = 53/322 (16%)

Query: 40  FHLSNQTKKMRDISQALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDH 99
           F++ N+           +  P   GQ+ +W+     W+        F +  T   + +DH
Sbjct: 97  FYIGNEALAASQGPSYSLSYPIRHGQVENWDHMERFWENSI-----FKYLRT---EPEDH 148

Query: 100 HLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAE--DK 157
             +++E  +  PE  + + ++ FE ++   +       YI          + T+++  D+
Sbjct: 149 FFLLTEPPLNPPENREQVAEIFFESFNCAGL-------YIAVQAVLALAASWTSSKVVDR 201

Query: 158 KTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVM 217
             +       VIDSG   T  +P+ +G     AIK + I GR +T  +Q           
Sbjct: 202 SLTG-----TVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQ----------- 245

Query: 218 EETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGK------- 270
             ++L    +E  T    E        ++  +  YV  D    F  + + P K       
Sbjct: 246 --SLLRERGEEDTTLRTAE--------RIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVE 295

Query: 271 EKXXXXXXXXXXXXEVFSVPETFFHPEIAQ--ILKPGIVETILECINMCPEVVRPLLVAN 328
                         E F  PE FF+PEIA    L P +   + + I  CP  VR  L  N
Sbjct: 296 NSEKTKRKVIDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNN 354

Query: 329 IVCTGGNFNIPNFHERLQTELQ 350
           IV +GG+    +F  RLQ +L+
Sbjct: 355 IVLSGGSTMFKDFGRRLQRDLK 376

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/139 (27%), Positives = 65/139 (46%), Gaps = 10/139 (7%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVE----TILECINMCPEVVRPL---LVANIVCTGGNFN 337
           E   VPE  F P I  + + G+VE     +L+  +     +      +  N+  TGGN  
Sbjct: 614 ERIRVPEVIFQPSIGGLDQAGVVELCETVLLKKFDSSRRALSATCEKMAKNVFITGGNTK 673

Query: 338 IPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANS-DQFRSARVTREEY 396
           +P   ER+  E     P+    KV     KD SL  W+ M  FA+    ++S+ +T+ EY
Sbjct: 674 LPGIRERIVREFTGFLPVGTELKVTLA--KDPSLSAWKGMAKFASDPTSYKSSILTKREY 731

Query: 397 LEHGLDWCTKNRFGYQQWL 415
            E+G ++  ++  G  +++
Sbjct: 732 EEYGPEYIKEHNLGNAKFM 750

 Score = 37.4 bits (85), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 49/211 (23%), Positives = 88/211 (41%), Gaps = 35/211 (16%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKM--RDIS-----QALIR 58
           + ID GSYE++ G     +P  AL   T+    R   +++T     RD       +   R
Sbjct: 43  IAIDFGSYEVRAGYVANKEP--ALVFPTRLARYRDRKASRTYTFVGRDTGLDASIRTQSR 100

Query: 59  RPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMD 118
            P +   + +W+   ++  Y F+     H  +        + +V++E L T+     N  
Sbjct: 101 SPFDGPMVTNWDYVDDMLAYTFH-----HLGVRGGGGVP-NAVVLTERLATLQSQRANWY 154

Query: 119 QVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWA 178
           ++++E Y+ + +  G +     FY            E    S+     LV+ SG   T  
Sbjct: 155 ELLYEAYNLQEVTFG-IDSLFSFY-----------GERGPGST----GLVVSSGNEDTCV 198

Query: 179 VPIIKGVPYYKAIKKLDIGGR----FLTGLL 205
           VP++ G       K+++ GG+    +LTGLL
Sbjct: 199 VPVVDGRGVVSEAKRINWGGQQAVDYLTGLL 229

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 65/137 (47%), Gaps = 16/137 (11%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVETILECINMCP--------EVVRPLLVANIVCTGGNF 336
           E   VPE  F P +  + + GI+E + E I M            V   +  N+  TGGN 
Sbjct: 610 ERIRVPEVIFQPPMGGLDQAGIIE-LSETIIMNKFGSSRRQLSSVSQEMANNVFLTGGNV 668

Query: 337 NIPNFHERLQTELQRQCPI--DWSCKVHSPQEKDKSLHGWESMKDFANSD-QFRSARVTR 393
            +P   +R+  E     P+   ++ KV S    D ++  W+ M  FA S   ++ + VT+
Sbjct: 669 RVPGLRDRIVREFTEFLPVGTKYNIKVAS----DPAIDAWKGMAKFAQSSTDYKGSYVTK 724

Query: 394 EEYLEHGLDWCTKNRFG 410
           +EY E+G D+  +++ G
Sbjct: 725 KEYEEYGPDYIKEHKLG 741

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 60.1 bits (144), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 62/134 (46%), Gaps = 10/134 (7%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVE----TILECINMCPEVVRPL---LVANIVCTGGNFN 337
           E   VPE FF P +    + G+ E     +L      P  +  +   +  N+  TGGN  
Sbjct: 612 ERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMAKNVWVTGGNAK 671

Query: 338 IPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFA-NSDQFRSARVTREEY 396
           IP   ER+  E     P++ S  V+     D SL  W  M  +A N   ++ + ++++EY
Sbjct: 672 IPGLRERIVKEFTGFLPVNTSFNVNI--SSDPSLDAWRGMAKYAQNETDYKKSFISKKEY 729

Query: 397 LEHGLDWCTKNRFG 410
            E+G D+  +++ G
Sbjct: 730 EEYGPDYIKEHKLG 743

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 58/135 (42%), Gaps = 12/135 (8%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVETILEC--------INMCPEVVRPLLVANIVCTGGNF 336
           E   VPE  F P +  + + GI+E I E                +   L +N+  TGGN 
Sbjct: 609 ERIRVPEVIFQPSMGGLDQAGIIE-ICETNFLKKFGSSRSELSSISRSLASNVFLTGGNM 667

Query: 337 NIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQ-FRSARVTREE 395
            +P   ER+  E +   PI     V      D +L  W  M   + +D  FR   VTR+E
Sbjct: 668 RLPGMRERVVREFRGLLPIGTELNVRMAN--DCALDAWRGMAKLSRTDSLFRDTYVTRQE 725

Query: 396 YLEHGLDWCTKNRFG 410
           Y E+G D+  ++  G
Sbjct: 726 YHEYGPDYIKEHNLG 740

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 50/245 (20%), Positives = 101/245 (41%), Gaps = 37/245 (15%)

Query: 3   EPVLVIDNGSYEIKFGESGWDQPLRAL-NCLTKDKYSRFH-----LSNQTKKMRDIS-QA 55
           E  + ID GS E++ G    ++P     N + + +  + +     + N T    D+S ++
Sbjct: 36  ETAIAIDFGSSEVRAGYGNQERPSHIFPNRIARWRDRKLNRNLTFIGNDTN--LDLSVRS 93

Query: 56  LIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSK 115
             R P++   + +W+   ++ +Y F      H       D   + ++++E L  +     
Sbjct: 94  QSRSPYDGALVTNWDYTEDIMEYTF------HHLGVKGTDGIPNPIIMTEKLGALHSQRD 147

Query: 116 NMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNC 175
           N  Q++FE +    +  G +     FY          A  D   S      LVI SG   
Sbjct: 148 NWYQLLFECFGAPQVTFG-LDSLFSFY----------ANNDASASG-----LVISSGNED 191

Query: 176 TWAVPIIKGVPYYKAIKKLDIGGR----FLTGLLQETISFRHYNVMEETILVNNIKEQCT 231
           T  +P++ G       K+++ GGR    +L+ LL   + + ++ +   T     + ++  
Sbjct: 192 THIIPVVDGKGVLGEAKRINWGGRQSVDYLSNLL--ALKYPYFPIKPSTHQFKALYDEFC 249

Query: 232 FVPPE 236
           +V P+
Sbjct: 250 YVSPD 254

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 58/134 (43%), Gaps = 10/134 (7%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVE----TILECINMCPEVVR---PLLVANIVCTGGNFN 337
           E   VPE  F P +A + + G+ E      L+        +      L AN+  TGGN  
Sbjct: 609 ERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGSTRSQLSEGSKKLAANVFLTGGNMR 668

Query: 338 IPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANS-DQFRSARVTREEY 396
           +P   ER+  E     P+  +  V      D ++  W  M   + +  Q++ + +TR+EY
Sbjct: 669 LPGVRERIVREFTGMLPMGSNLNVRMA--SDSAVDAWRGMAKLSQAGSQYKGSYITRKEY 726

Query: 397 LEHGLDWCTKNRFG 410
            E G D+  ++  G
Sbjct: 727 QELGADYIKEHNLG 740

 Score = 46.6 bits (109), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 96/213 (45%), Gaps = 39/213 (18%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMR--------DIS-QAL 56
           + ID GS E++ G    DQP    + +  ++ SR+    + + +         D+S ++ 
Sbjct: 39  IAIDFGSSEVRAGFGNQDQP----SHIFTNRISRWRDRRKNRNLTFIGNDTNLDLSVRSQ 94

Query: 57  IRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKN 116
            + P++   + +W+   E+ +Y F+     H  + + ND   + ++++E L T+    +N
Sbjct: 95  AKSPYDGAIVSNWDYTEEIMEYTFH-----HLGV-NGNDGVSNPILMTEKLATLQSQREN 148

Query: 117 MDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCT 176
             Q++FE +    +  G +     FY     +DA  +             LVI+SG   T
Sbjct: 149 WYQLLFECFGVPQVTFG-IDSLFSFYAN---NDATASG------------LVINSGNEDT 192

Query: 177 WAVPIIKGVPYYKAIKKLDIGGR----FLTGLL 205
             +P++ G       K+++ GGR    +L+ LL
Sbjct: 193 HVIPVMNGKGVLSEAKRINWGGRQSVEYLSNLL 225

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 64/139 (46%), Gaps = 10/139 (7%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVE----TILECINMCPEVVRPL---LVANIVCTGGNFN 337
           E   VPE  F P +    + GI E     +L+     P  +      +V N++ TGGN  
Sbjct: 617 ERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKLSQTSIDMVNNVLITGGNAK 676

Query: 338 IPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFA-NSDQFRSARVTREEY 396
           +P   ER+  E     P   +  V+     D SL  W+ M   A N +Q+R   ++++EY
Sbjct: 677 VPGLKERIVKEFTGFLPTGTNITVN--MSSDPSLDAWKGMAALARNEEQYRKTVISKKEY 734

Query: 397 LEHGLDWCTKNRFGYQQWL 415
            E+G ++  +++ G  ++ 
Sbjct: 735 EEYGPEYIKEHKLGNTKYF 753

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 82/213 (38%), Gaps = 26/213 (12%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRAL-NCLTKDKYSR----FHLSNQTKKMRDISQALIRRP 60
           + ID GS +++ G      P     N LTK +  +    F        +    ++  R P
Sbjct: 40  IAIDFGSSKLRAGFVNHATPTHIFPNALTKFRDRKLNKNFTFVGNDTLLDQAVRSQSRSP 99

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120
            +   + +W L  E+ DY F+     H  +  DN    + ++++E L T+     N  Q+
Sbjct: 100 FDGPFVTNWNLTEEILDYTFH-----HLGVVPDNGIP-NPILLTERLATVQSQRTNWYQI 153

Query: 121 IFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAVP 180
           +FE Y+   +  G +     FY                  S     LVI  G   T  +P
Sbjct: 154 LFETYNVPGVTFG-IDSLFSFYN--------------YNPSGNKTGLVISCGHEDTNVIP 198

Query: 181 IIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
           ++ G       K+++ GG      L + ++ ++
Sbjct: 199 VVDGAGILTDAKRINWGGHQAVDYLNDLMALKY 231

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 64/139 (46%), Gaps = 10/139 (7%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVE----TILECINMCPEVVRPL---LVANIVCTGGNFN 337
           E   VPE  F P +    + GI E     +L+     P  +      +V N+  TGGN  
Sbjct: 617 ERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKLSSTSLDMVNNVFITGGNSK 676

Query: 338 IPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFA-NSDQFRSARVTREEY 396
           +P   ER+  E     P+  +  V+     D SL  W+ M   A N ++++   ++++EY
Sbjct: 677 VPGLRERIVREFTEFLPVGTNFSVN--MSSDPSLDAWKGMAALAQNKEEYKKTVISKKEY 734

Query: 397 LEHGLDWCTKNRFGYQQWL 415
            E+G D+  +++ G  ++ 
Sbjct: 735 EEYGPDYIKEHKLGNMKYF 753

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 48/214 (22%), Positives = 93/214 (43%), Gaps = 28/214 (13%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRAL-NCLTKDKYSRFH-----LSNQTKKMRDISQALIRR 59
           + ID GS +++ G      P     N LTK +  + +     + N T  +    ++  R 
Sbjct: 40  IAIDFGSSKLRAGFVNQAAPTHIFPNVLTKFRDRKLNKNFTFVGNDTL-LDQAVRSQSRS 98

Query: 60  PHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119
           P +   + +W    E+ DY F+     H  ++ +N  + + ++++E + T+     N  Q
Sbjct: 99  PFDGPFVTNWNFTEEIMDYTFH-----HLGVSPNNGVR-NPILLTERMATVQSQRANWYQ 152

Query: 120 VIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAV 179
           ++FE Y+   +  G  + Y  FY             ++ TS  K   LVID G   T  +
Sbjct: 153 IMFETYNVPGVTFGIDSLY-GFY-------------NQNTSGNK-TGLVIDCGHEDTNVI 197

Query: 180 PIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
           P++ G       K+++ GGR     L + ++ ++
Sbjct: 198 PVVDGTGVLTDAKRINWGGRQAVDYLSDLMALKY 231

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 66/140 (47%), Gaps = 12/140 (8%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVE---TIL-----ECINMCPEVVRPLLVANIVCTGGNF 336
           E   VPE  F P I  + + GIVE   T+L            E+ + ++  NI  TGGN 
Sbjct: 609 ERIRVPEVIFQPSIGGLDQAGIVELCETLLLKKFGSNRRELSEISK-MMAKNIFITGGNA 667

Query: 337 NIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQ-FRSARVTREE 395
            +P   ER+  E     P+  +  V   +  D S+  W  M  FAN+   + ++ +T++E
Sbjct: 668 KLPGIRERVVREFTGFLPVGTNLNVKLAE--DPSMSAWRGMAKFANNTSLYETSIMTKKE 725

Query: 396 YLEHGLDWCTKNRFGYQQWL 415
           Y E G ++  ++  G  +++
Sbjct: 726 YEELGPEYIKEHNLGNAKFV 745

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 89/214 (41%), Gaps = 29/214 (13%)

Query: 6   LVIDNGSYEIKFGESGWDQP-LRALNCLTK---DKYSRFH--LSNQTKKMRDISQALIRR 59
           + ID GSYE++ G      P L   N L +    K SR +  + N T   + I +   + 
Sbjct: 39  IAIDFGSYEVRAGYVNQGDPALVFTNRLARYRDRKASRTYTFVGNDTNLDQSI-RTQSKS 97

Query: 60  PHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQ 119
           P +   + +W+   ++  Y F++ D         N    + ++++E +  +     N  +
Sbjct: 98  PFDGSMITNWDYVDDILAYTFHHLD------VRGNGGVPNPVLITERMAALQSQRSNWYE 151

Query: 120 VIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAV 179
           ++FE Y+ + +  G +     FY G++       A              I+SG   T  +
Sbjct: 152 LLFECYNLQKVTFG-IDSLFSFY-GEHPPGTTGIA--------------INSGNEDTSVI 195

Query: 180 PIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
           P++ G       K+++ GG+   G L   +S ++
Sbjct: 196 PVVNGKGILTEAKRINWGGQQSVGYLNGLLSLKY 229

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 71/327 (21%), Positives = 121/327 (37%), Gaps = 52/327 (15%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRAL-NCLTKDKYSRFHLSNQTKKMRDISQALIRRPHEL 63
            +VID GS+    G SG D P   L +C     Y ++    + +   + S  L R+ +E+
Sbjct: 16  AVVIDPGSFTTNIGYSGTDCPQAILPSC-----YGKYTEGEKDELFSEQSIGLPRKDYEI 70

Query: 64  ------GQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNM 117
                 G++V WE   + WD+   +E  F  N            +++E +    E  K  
Sbjct: 71  HNIVQNGEVVDWEKAEKQWDWAIRSELRFETN-------SGMPALLTEPIWNSEENRKKS 123

Query: 118 DQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTW 177
            +V+ E  DF + +  P A  + F  G                  +   LV+D G + T 
Sbjct: 124 LEVLLESMDFSACYLVPTATAVSFAMG------------------RPTCLVVDIGHDVTS 165

Query: 178 AVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH----YNVMEETILVNNIK------ 227
             P++ G+   K+  +  I G  L  L++  ++ R     + V +   +    K      
Sbjct: 166 VCPVVDGMTLSKSSMRSYIAGSLLNELIRSQLAPRKVIPLFQVAQRRPVFMERKFDYEIH 225

Query: 228 -EQCTFVPPESYFSSFHNKM----NTKVEYVLPDFQTSFLGYVKKPGKEKXXXXXXXXXX 282
                FV    +F  F   M     T +     + +T+    ++ P  E+          
Sbjct: 226 PSLQKFVNERQFFQEFKETMLQVAPTSISKFKSEIETTSKRSIEAPWGEELVYDSLQRLE 285

Query: 283 XXEVFSVPETFFHPEIAQILKPGIVET 309
             E    P+    PE   I K G+VET
Sbjct: 286 FAEQLFTPDLSQFPEDWPISKDGVVET 312

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 47/105 (44%)

Query: 305 GIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSP 364
           G+ + I   I      +R  L  N+V TGG  ++P   +R+  EL R  P      + S 
Sbjct: 374 GLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAELNRSLPALKFRMLTSG 433

Query: 365 QEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
           Q +++   GW      A+   F    V ++EY E G D   K+RF
Sbjct: 434 QLRERQYQGWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 478

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 59/136 (43%), Gaps = 14/136 (10%)

Query: 285 EVFSVPETFFHPEIA---QILKPGIVETILECINMCPEVVRPL------LVANIVCTGGN 335
           E   VPE  F P +    Q   P + ET+L  +       R L      +  N+  TGGN
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLL--LRKFGSTQRQLSDVSTSMAQNVWITGGN 668

Query: 336 FNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFA-NSDQFRSARVTRE 394
             +P   ER+  E     P      +   Q  D SL  W  M   A N++ F+   +T++
Sbjct: 669 AKLPGLRERIVKEFSEFLPSGSPFSIRKSQ--DPSLDAWRGMAKLAQNTEDFKHGYITKQ 726

Query: 395 EYLEHGLDWCTKNRFG 410
           EYLE+G ++  ++  G
Sbjct: 727 EYLEYGPEYIKEHNLG 742

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 35/142 (24%), Positives = 53/142 (37%), Gaps = 23/142 (16%)

Query: 76  WDYCFYNEDDFHWNLTH----DNDTKDHHLVVSETLMTIPELSKNMDQVIFEEYDFKSMF 131
           WDY    ED   +   H     N    + LV++E L TI     N  Q++FE +D   + 
Sbjct: 107 WDYV---EDTLEYTFNHLGVAANGGISNPLVINERLATIQSQRANWYQILFECFDVPGVT 163

Query: 132 KGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAI 191
            G +     FY                 S      LVI  G   T  +P++ G       
Sbjct: 164 FG-IDSLFGFYH---------------NSGPNSTGLVIGCGNEDTNVIPVVDGKGVLTES 207

Query: 192 KKLDIGGRFLTGLLQETISFRH 213
           K+++ GG   T  L   +S ++
Sbjct: 208 KRINWGGNQATEYLTNLMSLKY 229

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 49/106 (46%)

Query: 304 PGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHS 363
           PGIV+ I   I      +R  L  NIV TGG   IP F +RL  EL ++ P      + +
Sbjct: 395 PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKFRVLTT 454

Query: 364 PQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
            Q +++    W      ++   F    V ++EY E G D   K+RF
Sbjct: 455 GQTRERQYQAWLGGSILSSLGTFHQLWVGKQEYEESGADRLLKDRF 500

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 47/229 (20%), Positives = 86/229 (37%), Gaps = 45/229 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQP------------LRALNCLTKDKYSRFHLSNQTKKMRDI 52
            +VID GS+    G SG D P            L+ +     ++      SN   K    
Sbjct: 16  AVVIDPGSFTTNIGYSGTDCPQAILPSYYGEISLKEVASEGNEEIEENSASNNKSKKIFG 75

Query: 53  SQAL--IRRPHEL------GQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVS 104
            Q++   R  +E+      G+++ W+   E WD+   N       L  ++++     +  
Sbjct: 76  EQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKNA------LYLESNSGIPAFLTE 129

Query: 105 ETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKD 164
               T+    K++ +V+ E   F++ +  P    I F  G+                   
Sbjct: 130 PIWNTVENRKKSL-EVLLEGLQFEACYLSPTPTCISFASGRPN----------------- 171

Query: 165 FQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
             LV+D G +     P+I G+   K+  +  I GRF+   ++E +  R 
Sbjct: 172 -CLVVDIGHDVASVSPVIDGMTLSKSSMRNFISGRFINEKIKEFLKPRE 219

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/212 (23%), Positives = 89/212 (41%), Gaps = 36/212 (16%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKM-RDISQALIRRPHEL 63
            +VID GSY    G SG D P   L  +    Y +      +KKM  + S  + R+ +EL
Sbjct: 16  AVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKLTADENSKKMFSEQSIGIPRKDYEL 71

Query: 64  ------GQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNM 117
                 G ++ W+   E W +   NE      L  D+++    L+      ++    K++
Sbjct: 72  KPIIENGLVIDWDTAQEQWQWALRNE------LYLDSNSGIPALLTEPVWNSMENRKKSL 125

Query: 118 DQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTW 177
            +V+ E   F++ +  P +  + F  G+                     LV+D G +   
Sbjct: 126 -EVLLEGMQFEACYLAPTSTCVSFAAGRPN------------------CLVVDIGHDTCS 166

Query: 178 AVPIIKGVPYYKAIKKLDIGGRFLTGLLQETI 209
             PI+ G+   K+ ++  I G+F+  L+Q+ +
Sbjct: 167 VSPIVDGMTLSKSTRRNFIAGKFINHLIQKAL 198

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 40/89 (44%)

Query: 321 VRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDF 380
           +R  L  N+V TGG  +IP   +RL TEL +  P      + +   +++    W      
Sbjct: 399 LRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTGHIRERQYQSWLGGSIL 458

Query: 381 ANSDQFRSARVTREEYLEHGLDWCTKNRF 409
            +   F    V ++EY E G++    +RF
Sbjct: 459 TSLGTFHQLWVGKQEYEEVGIERLLNDRF 487

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 62/140 (44%), Gaps = 12/140 (8%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVETILECINMCP--------EVVRPLLVANIVCTGGNF 336
           E   VPE  F P +    + GI E + E I M                +V NI+ TGGN 
Sbjct: 617 ERIRVPEVVFQPTMGGQDQAGICE-LSETILMKKFGSQRGKLSSTSLDMVNNILITGGNA 675

Query: 337 NIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFA-NSDQFRSARVTREE 395
            +P   ER+  E     P+  +  V+     + SL  W  M   A N  +++   +++EE
Sbjct: 676 KVPGLRERIVKEFTEFLPVGTNVAVNI--SSNPSLDAWRGMAALARNKAEYKKTVISKEE 733

Query: 396 YLEHGLDWCTKNRFGYQQWL 415
           Y E+G D+  +++ G  ++ 
Sbjct: 734 YEEYGPDYIKEHKLGNTKYF 753

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 81/213 (38%), Gaps = 26/213 (12%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRAL-NCLTKDKYSR----FHLSNQTKKMRDISQALIRRP 60
           + ID GS  ++ G      P     N LTK +  +    F        +    ++  R P
Sbjct: 40  IAIDFGSSRLRAGFVNQATPTHIFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQSRSP 99

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120
            +   + +W    E+ DY F+     H  +  +N    + ++++E + T+     N  Q+
Sbjct: 100 FDGPFVTNWNFTEEIMDYTFH-----HLGVLPNNGIS-NPILLTERMATVQSQRANWYQI 153

Query: 121 IFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAVP 180
           +FE Y+   +  G  + Y  FY                  S     LVID     T  VP
Sbjct: 154 LFETYNVPGVTFGIDSLY-SFYNN--------------NPSGNKTGLVIDCSHEDTSVVP 198

Query: 181 IIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
           I+ G       K+++ GG      L + ++ ++
Sbjct: 199 IVDGAGILTDAKRINWGGHQAVDYLNDLMALKY 231

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 63/139 (45%), Gaps = 10/139 (7%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVE----TILECINMCPEVVRPL---LVANIVCTGGNFN 337
           E   VPE  F P +    + GI E     +L+     P  +      +  N+  TGGN  
Sbjct: 617 ERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPGKLSQTSIDMANNVFITGGNAK 676

Query: 338 IPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFA-NSDQFRSARVTREEY 396
           +P   ER+  E     P+  +  ++     D SL  W+ M   A N ++++   ++R+EY
Sbjct: 677 VPGLKERIVKEFTGFLPVGTNININ--MSSDPSLDAWKGMAALAQNEEEYKRTIISRKEY 734

Query: 397 LEHGLDWCTKNRFGYQQWL 415
            E+G D+  +++ G  ++ 
Sbjct: 735 EEYGPDYIKEHKLGNTKYF 753

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 88/217 (40%), Gaps = 34/217 (15%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRAL-NCLTKDKYSRFH-----LSNQT---KKMRDISQAL 56
           + ID GS +++ G      P     N LTK +  + +     + N T   + +R  S++ 
Sbjct: 40  IAIDFGSSKLRAGFVNQSAPTHVFPNVLTKFRDRKLNKNFTFVGNDTLLDQAVRSQSKSP 99

Query: 57  IRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKN 116
              P     + +W    E+ DY F+     H  +  +N    + ++++E + T+     N
Sbjct: 100 FDGPF----VTNWNFTEEILDYTFH-----HLGIVPENGIS-NPILLTERMATVQSQRAN 149

Query: 117 MDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCT 176
             Q++FE Y+   +  G  + Y  FY                  S K   LVID G   T
Sbjct: 150 WYQILFETYNVPGVTFGIDSLY-GFYN--------------YYPSGKQTGLVIDCGHEDT 194

Query: 177 WAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
             +PI+ G       K+++ GG      L + ++ ++
Sbjct: 195 NVIPIVDGAGILTDAKRINWGGHQAVDYLNDLMALKY 231

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 88/220 (40%), Gaps = 41/220 (18%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLS------NQTKKMRDISQALIRR 59
           +VID GSY    G SG D P      +    Y ++  +       +TK   + S  L R 
Sbjct: 15  IVIDPGSYTTNIGYSGSDCP----ESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLARP 70

Query: 60  PHEL------GQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPEL 113
            +E+      G++  W+   E WD+   NE     N           ++++E +    E 
Sbjct: 71  DYEIKRIVENGEIADWDTAQEQWDWVLKNELFLKSN-------SGIPVLLTEPIWNSVEN 123

Query: 114 SKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGF 173
            K   +V+ E  DF++ +  PV+  + F  G+                     LV+D G 
Sbjct: 124 RKKSLEVLLEGMDFEACYLSPVSTCVSFAAGRPN------------------CLVVDIGH 165

Query: 174 NCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
           + T   P+I G+   K+  +  I GR++  L++  +  R 
Sbjct: 166 DTTSVSPVIDGMTLSKSSTRNFIAGRYINHLIETYLKPRE 205

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 44/105 (41%)

Query: 305 GIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSP 364
           GI + +   I      +R  L  N+V TGG   IP  ++RL  EL ++ P      + + 
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSKRLPALKFRILTTG 469

Query: 365 QEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
             ++K    W       +   F    V +EEY E G D    +RF
Sbjct: 470 HLREKQYQAWLGGSILTSLGTFHQLWVGKEEYKEVGADRLLVDRF 514

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 60/134 (44%), Gaps = 10/134 (7%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVET----ILECINMCPEVVRPL---LVANIVCTGGNFN 337
           E   VPE  F P I    + GI E      L   N  P  +  +   ++ N+  TGG+  
Sbjct: 622 ERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPRKLSSISERMLNNVWLTGGHAK 681

Query: 338 IPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFA-NSDQFRSARVTREEY 396
           +P   ER+  E     P+     ++     D SL  W+ M   A N+D  +  +VT+++Y
Sbjct: 682 LPGLKERIVKEYTEFLPVGTKMSINI--SNDPSLDTWKGMAKLASNTDYLKKIQVTKKDY 739

Query: 397 LEHGLDWCTKNRFG 410
            E+G ++  ++  G
Sbjct: 740 EEYGPEYMMEHNLG 753

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 92/217 (42%), Gaps = 32/217 (14%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMR------DISQAL--- 56
           + ID GSY +K G +    P         +K +R+      K M       ++ Q L   
Sbjct: 39  IAIDFGSYNVKAGYTNQSLPTHVFT----NKLTRYRDRKLAKTMTFIGNDTNLDQPLRIQ 94

Query: 57  IRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKN 116
            +RP++   + +WE   E++DY  +     H  +   N +  + ++++E +  +     N
Sbjct: 95  AKRPYDGLFIANWEYAEEIFDYTLH-----HLGVQTTNGSISNPIILTEKMACLQSQRAN 149

Query: 117 MDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCT 176
             Q++FE +D  S   G               D++ A  +   + ++   LVI+ G   T
Sbjct: 150 WYQLLFETFDVPSATFGL--------------DSLYAFYNNCANPFESDGLVINCGHEDT 195

Query: 177 WAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
             VPI++G       K+++ GGR  T  L   ++ ++
Sbjct: 196 NIVPIVQGKGILTEAKRINWGGRHSTEYLSSLLTLKY 232

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 62/139 (44%), Gaps = 10/139 (7%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVE----TILECINMCPEVVRPL---LVANIVCTGGNFN 337
           E   VPE  F P +  + + GI E     +L      P+ +  L   +  NI  TGGN  
Sbjct: 616 ERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELSLTMANNIWLTGGNSK 675

Query: 338 IPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFA-NSDQFRSARVTREEY 396
           IP   ER+  E +   P++    V+     D +   W  M   A N   ++   ++++EY
Sbjct: 676 IPGLRERIVKEFREFLPVNTQFNVN--MTSDPTFDAWNGMAKLAQNETDYKKTIISKKEY 733

Query: 397 LEHGLDWCTKNRFGYQQWL 415
            E+G ++  +++ G  ++ 
Sbjct: 734 EEYGPEYIKEHKLGNMKYF 752

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 57/142 (40%), Gaps = 21/142 (14%)

Query: 76  WDYCFYNEDDFHWNLTHDNDTKDHH----LVVSETLMTIPELSKNMDQVIFEEYDFKSMF 131
           WDY    ED   +   H     DH     ++++E L TI     N  Q++FE Y+     
Sbjct: 107 WDYV---EDILQYTFNHLGVVPDHGVQNPIIITEKLATIQSQRSNWYQLLFETYN----- 158

Query: 132 KGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAI 191
                  +P  +  +  D++ A  +    S     +VID     T  +PI+ G       
Sbjct: 159 -------VP--KATFGIDSLFAFYNNNNGSATSTGMVIDCSHEETNIIPIVDGQGILTDA 209

Query: 192 KKLDIGGRFLTGLLQETISFRH 213
           K+++ GGR     L   ++ ++
Sbjct: 210 KRINWGGRHAIDYLSNLLALKY 231

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 53/215 (24%), Positives = 89/215 (41%), Gaps = 42/215 (19%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCL----TKDKYSRFHLSNQTKKMRDISQALIRRP 60
            +VID GSY    G SG D P   L  +    T DK S+   S Q       S  + R+ 
Sbjct: 16  AVVIDPGSYTTNIGYSGSDFPQSILPSVYGKSTSDKDSKTIFSEQ-------SIGIPRKD 68

Query: 61  HEL------GQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
           +EL      G ++ W+   E W +   NE      L  D+++    L+ +E +    E  
Sbjct: 69  YELKPIIENGLVIDWDTAQEQWQWALKNE------LYLDSNSGIPALL-TEPVWNSTENR 121

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           K   +V+ E   F++ +  P +  + F  G+                     LV+D G +
Sbjct: 122 KKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPN------------------CLVVDIGHD 163

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETI 209
                PI+ G+   K+ ++  I G+F+  L+++ I
Sbjct: 164 TCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKAI 198

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%)

Query: 305 GIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSP 364
           G+ + +   I      +R  L  N+V TGG  +IP   +RL TEL +  P      + + 
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 365 QEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
             +++    W       +   F    V ++EY E G+D    +RF
Sbjct: 444 HTRERQYQSWLGGSILTSLGTFHQLWVGKQEYEEVGVDRLLNDRF 488

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 61/130 (46%), Gaps = 10/130 (7%)

Query: 289 VPETFFHPEIAQILKPGIVE----TILECINMCPEVVR---PLLVANIVCTGGNFNIPNF 341
           VPE  F P +    + GI+E     +L+     P  +      +  N+  TGG+  +P  
Sbjct: 622 VPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQLPGL 681

Query: 342 HERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSD-QFRSARVTREEYLEHG 400
             R+  E     P D    V+    K  SL  W+ M  F++ D  F+S+ ++++EY E+G
Sbjct: 682 KTRIVKEFTSFLPNDAKFSVNIS--KHPSLDAWKGMAKFSSDDADFKSSLISKKEYEEYG 739

Query: 401 LDWCTKNRFG 410
            ++  ++R G
Sbjct: 740 PEYIKEHRLG 749

 Score = 37.4 bits (85), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 88/217 (40%), Gaps = 35/217 (16%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDIS---------QAL 56
           + ID G+  +K G      P  A N  T+   +RF     ++ M  I          ++ 
Sbjct: 40  IAIDFGTCSVKAGYVNKADP--AFNFPTR--LTRFRDRKMSRTMTFIGNDTNLDYAVRSQ 95

Query: 57  IRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKN 116
            + P +   + +WE   ++ +Y F      H  +T  N    + L+++E L T+     N
Sbjct: 96  SKTPFDGPFVTNWEYAEDILEYTFK-----HLGVTA-NHGISNPLIMTEKLATLQSQRAN 149

Query: 117 MDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCT 176
             Q++FE ++  ++  G +     FY          A  DK +S      LV       T
Sbjct: 150 WYQLLFETFNTSNVSFG-IDNVFAFY----------ANTDKHSSG-----LVFGLNNQDT 193

Query: 177 WAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
             +PII G P     K+++ GG    G L + ++ ++
Sbjct: 194 NVIPIIDGKPVLTDTKRINWGGSQSVGYLSDLMTLKY 230

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 86/212 (40%), Gaps = 36/212 (16%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKM-RDISQALIRRPHEL 63
            +VID GSY    G SG D P   L  +    Y ++      KK+  + S  + R+ +EL
Sbjct: 16  AVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGNKKIFSEQSIGIPRKDYEL 71

Query: 64  ------GQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNM 117
                 G ++ W+   E W +   NE        + N       +++E +    E  K  
Sbjct: 72  KPIIENGLVIDWDTAQEQWQWALQNE-------LYLNSNSGIPALLTEPVWNSTENRKKS 124

Query: 118 DQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTW 177
            +V+ E   F++ +  P +  + F  G+                     LV+D G +   
Sbjct: 125 LEVLLEGMQFEACYLAPTSTCVSFAAGRPN------------------CLVVDIGHDTCS 166

Query: 178 AVPIIKGVPYYKAIKKLDIGGRFLTGLLQETI 209
             PI+ G+   K+ ++  I G+F+  L+++ +
Sbjct: 167 VSPIVDGMTLSKSTRRNFIAGKFINHLIKKAL 198

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 44/105 (41%)

Query: 305 GIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSP 364
           G+ + +   I      +R  L  N+V TGG  +IP   +RL TEL +  P      + + 
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 365 QEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
              ++    W       +   F    V ++EY E G++    +RF
Sbjct: 444 HTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 58/133 (43%), Gaps = 9/133 (6%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVE----TILECINMCPEVVRPL---LVANIVCTGGNFN 337
           E   VPE  F P +    + G+ E     +L+     P  +      +  NI  +GGN  
Sbjct: 613 ERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANNIWLSGGNAK 672

Query: 338 IPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYL 397
           +P    R+  E     P+    K+      D  L  W+ M  +A S+ +  + +T++EY 
Sbjct: 673 VPGLKNRIVKEFTSFLPV--GTKLSVNMSSDPLLDSWKGMAKWAKSEDYNKSFITKKEYE 730

Query: 398 EHGLDWCTKNRFG 410
           E+G ++  +++ G
Sbjct: 731 EYGPEYIKEHKMG 743

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 46/217 (21%), Positives = 82/217 (37%), Gaps = 35/217 (16%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKM----RDIS-----QAL 56
           + ID GS  +K G +  D P    + +   + +RF      + M     DIS     +A 
Sbjct: 40  IAIDFGSNTLKAGYTNQDVP----SLVFPTRLTRFRDRRLNRTMTFIGNDISLDQAVRAQ 95

Query: 57  IRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKN 116
            + P +   + +WE   E+ +Y F      H  +  DN    + L+ SE L  +      
Sbjct: 96  SKSPFDGSMVTNWEYIDEMLEYTFK-----HLGVLGDNGIS-NPLIFSEKLAVVQAQRSQ 149

Query: 117 MDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCT 176
             Q++FE ++      G   Q+  F                  +S     L+I      T
Sbjct: 150 WYQLLFETFNISKATFGIDNQFAFF----------------ANNSIDSTGLMIGCNNEDT 193

Query: 177 WAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
             +PI+ GV   +  K+++ GG      +   +S ++
Sbjct: 194 NVIPIVNGVASLQECKRINWGGNHAVSYMNNLLSLKY 230

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 47/105 (44%)

Query: 305 GIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSP 364
           G+ + I   I      +R  L  N+V TGG+ +IP   +R+  EL +  P      + S 
Sbjct: 375 GLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKFRMLTSG 434

Query: 365 QEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
           Q ++K    W      A+   F    V ++EY E G D   K+RF
Sbjct: 435 QAREKQYQSWLGGSILASLGTFHQLWVGKQEYAEVGADRLLKDRF 479

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 70/328 (21%), Positives = 118/328 (35%), Gaps = 53/328 (16%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRAL-NCLTKDKYSRFHLSNQTKKM-RDISQALIRRPHE 62
            ++ID GS+    G SG D P   L +C     Y ++    +   +  + S  L R+ +E
Sbjct: 16  AIIIDPGSFNTNIGYSGTDCPQAILPSC-----YGQYINDEEKPSLFNEQSIGLPRKDYE 70

Query: 63  L------GQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKN 116
           +      G++V W+   E W++   +   F  N       K    +++E +    +  K 
Sbjct: 71  IKEIVRSGEVVDWDKAQEQWEWAIKSVLLFESN-------KGLPALLTEPIWNSEDNRKK 123

Query: 117 MDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCT 176
             +V+ E  DF++ +  P A  + F  G                  +   LV+D G + T
Sbjct: 124 SLEVLLEGMDFEACYLTPTATAVSFAMG------------------RPTCLVVDIGHDIT 165

Query: 177 WAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY-----------NVMEETILVNN 225
              P+I G+   K+  +  I G  L  L++ ++  R               ++ +     
Sbjct: 166 SVSPVIDGMTLSKSSMRSFIAGGLLNELIRTSLKPREILPLFQVAKKRPEFVKRSFDYEI 225

Query: 226 IKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKK----PGKEKXXXXXXXXX 281
                 FV    +F  F   M       L  F++      K+    P  E          
Sbjct: 226 HPSLLNFVNERQFFQEFKETMLQVAPTSLTKFKSELEQLSKRSIEAPWGEDLVFDSETRF 285

Query: 282 XXXEVFSVPETFFHPEIAQILKPGIVET 309
              E    PET   PE   I K G+VET
Sbjct: 286 NIAEQLFRPETAKFPEDWPISKDGVVET 313

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 48/106 (45%)

Query: 304 PGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHS 363
           PGIV+ I   IN     +R  L  N+V TGG   IP   +R+  EL ++ P      + +
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKFRVLAN 456

Query: 364 PQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
            Q +++    W      ++   F    V ++EY E G D    +RF
Sbjct: 457 GQTRERQYQSWLGGSILSSLGTFHQLWVGKQEYEEIGADRLLTDRF 502

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 48/235 (20%), Positives = 90/235 (38%), Gaps = 51/235 (21%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRAL----NCLTK-----------DKYSRFHLSNQTK-K 48
            +VID GS+    G SG D P   L      +T+           D+ +  +  N +K K
Sbjct: 16  AVVIDPGSFTTNIGFSGSDYPQSILPSCYGAITEIEDQQADHNKPDESAANNTENASKIK 75

Query: 49  MRDI----SQALIRRPHEL------GQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKD 98
           +R +    S    R  +E+      G++V W+   E W +   NE     N       + 
Sbjct: 76  IRKVFNEQSVGYPRANYEIKPIVQNGEVVDWDAAQEQWSWALENELFLKSN-------EG 128

Query: 99  HHLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKK 158
              +++E +    E  K   +V+ E   F++ +       + F  G+             
Sbjct: 129 VPALLTEPIWNTVENRKKSLEVLLEGMGFEACYLSATPTCVSFAAGRSN----------- 177

Query: 159 TSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
                   LV+D G +     P++ G+ + K+ ++  I G++L  L+ + +  R 
Sbjct: 178 -------CLVVDIGHDIISVSPVVDGMTFSKSTRRNVISGKYLNVLINDFLKPRE 225

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 53/125 (42%), Gaps = 1/125 (0%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHER 344
           E   VP+     +I  I+ PGI + +   +N     +R  L  N++ TGG   IP   +R
Sbjct: 472 ENVDVPKKSDKKDIDNII-PGIADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLADR 530

Query: 345 LQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWC 404
           L  EL ++ P      + S   +++    W       +   F    V + EY E G D  
Sbjct: 531 LMYELNKKLPALKFRILSSGHRRERKYQAWLGGSILTSLGTFHQLWVGKREYEEVGPDRL 590

Query: 405 TKNRF 409
            K+RF
Sbjct: 591 LKDRF 595

 Score = 37.7 bits (86), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 32/157 (20%), Positives = 63/157 (40%), Gaps = 25/157 (15%)

Query: 57  IRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKN 116
           ++R  E G +  W++  E W +    +      L  D+      L+      T+    K+
Sbjct: 161 VKRIIENGMVADWDIAEEQWSWALREK------LYMDSFKGIPALLTEPVWNTVQNRKKS 214

Query: 117 MDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCT 176
           + +V+ E+ +F++ +   +   + F  G                  K   LV+D G +  
Sbjct: 215 L-EVLLEKMEFEACYLTTIPTNVSFAAG------------------KPNCLVVDVGHDTC 255

Query: 177 WAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
              P+I G+   K++++    GR+L  LL+  I  R 
Sbjct: 256 SVSPVIDGMTLTKSVRRNFFAGRYLNRLLENYIKPRE 292

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 47/105 (44%)

Query: 305 GIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSP 364
           GIV+ I + +      +R  L  N+V TGG   IP   +R+  EL +  P      + S 
Sbjct: 415 GIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKFRMLSSG 474

Query: 365 QEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
             +++   GW      A+   F    V REEY E G +   K+RF
Sbjct: 475 HLRERQYQGWLGGSILASLGTFHQLWVGREEYEEVGPERLLKDRF 519

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/216 (19%), Positives = 80/216 (37%), Gaps = 36/216 (16%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRPH--- 61
            +VID GS+    G SG D P      +    Y        TK++ +    L  R     
Sbjct: 16  AIVIDPGSFVTNIGYSGTDCP----QSIMPSSYGNVETDGDTKRIFNEQPLLFPRAGMEI 71

Query: 62  ----ELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNM 117
               E   +V W+   E W+Y    +  F  N       K   ++++E +       K  
Sbjct: 72  KPIVENSTIVDWDRAQEQWEYALNTDLKFESN-------KGTPVLLTEPIWNSEASRKKS 124

Query: 118 DQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTW 177
            +++ E  +F++ +    +  + F  G                  +   LV+D G + + 
Sbjct: 125 LEILLESMEFEACYLAANSSAVSFAMG------------------RPTCLVVDIGHDVST 166

Query: 178 AVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
             P+I G+   K+  +  + G++L  L+ + +  R 
Sbjct: 167 VSPVIDGMTLSKSSTRNYVAGKYLNHLIAKNLKPRE 202

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 85/212 (40%), Gaps = 36/212 (16%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKM-RDISQALIRRPHEL 63
            +VID GSY    G SG D P   L  +    Y ++      K +  + S  + R+ +EL
Sbjct: 16  AVVIDPGSYTTNIGYSGSDFPQSILPSV----YGKYTADEGKKNIFSEQSIGIPRKDYEL 71

Query: 64  ------GQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNM 117
                 G ++ W+   E W +   NE        + N       +++E +    E  K  
Sbjct: 72  KPIVKDGLVIDWDTAQEQWQWALKNE-------LYLNSNSGTPALLTEPVWNSTENRKKS 124

Query: 118 DQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTW 177
            +V+ E   F++ +  P +  + F  G+                     LV+D G +   
Sbjct: 125 LEVLLEGMQFEACYLAPTSTCVSFAAGRPN------------------CLVVDIGHDTCS 166

Query: 178 AVPIIKGVPYYKAIKKLDIGGRFLTGLLQETI 209
             PI+ G+   K+ ++  + G+F+  L+++ +
Sbjct: 167 VSPIVDGMTLSKSTRRNFLAGKFINHLIKKAL 198

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 42/105 (40%)

Query: 305 GIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSP 364
           G+   +   I      +R  L  N+V TGG   IP   +RL TEL +  P      + + 
Sbjct: 384 GLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKILPSLKFRILTTG 443

Query: 365 QEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
              ++    W       +   F    V ++EY E G++    +RF
Sbjct: 444 HTMERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVGVERLLNDRF 488

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 61/136 (44%), Gaps = 14/136 (10%)

Query: 285 EVFSVPETFFHPEIAQILKPGI---VETILECINMCPEVVRPL------LVANIVCTGGN 335
           E   VPE  F P I    + GI    ETIL   N      R L      +  NI  TGG+
Sbjct: 614 ERIRVPEILFQPIIGGQDQAGISELCETILS--NKFGSKPRELSETSLGMAKNIWLTGGH 671

Query: 336 FNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFA-NSDQFRSARVTRE 394
             +P   ER+  E     P+    K+     K+ SL  W  M+  A N   ++ + ++++
Sbjct: 672 SKLPGLRERIVKEFTGFLPV--GTKLGVKMSKNPSLDAWYGMRKLAQNEADYKDSIISKK 729

Query: 395 EYLEHGLDWCTKNRFG 410
           +Y E+G ++  +++ G
Sbjct: 730 DYEEYGAEYIKEHKLG 745

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 40/216 (18%), Positives = 86/216 (39%), Gaps = 27/216 (12%)

Query: 3   EPVLVIDNGSYEIKFGESGWDQPLRAL-NCLTKDKYSR----FHLSNQTKKMRDISQALI 57
           E  + ID GSYE++ G +    P     N LT+ +  +    F        +    ++  
Sbjct: 36  ETPIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRHRDRKLSKTFTFIGNDVLLDQTVRSQS 95

Query: 58  RRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNM 117
           + P +   + +W+   ++  Y F      H  +  DN  + + L+++E L ++    KN 
Sbjct: 96  KSPFDGSFIANWDYVEDIMQYTFN-----HLGVVGDNSVR-NPLIINEPLGSLQSQRKNW 149

Query: 118 DQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTW 177
            +++FE +   ++  G    +  +   +   D                 +VI+     T 
Sbjct: 150 YELLFECFHLPNVSFGIDGMFGFYANNEGNQDG----------------IVINCSNEETD 193

Query: 178 AVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
            +P++ G       K+++ GGR     L + +S ++
Sbjct: 194 VIPVVDGRGVLTDAKRINWGGRQAVDYLSDLMSLKY 229

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 48/105 (45%)

Query: 305 GIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSP 364
           G+ + +   I      +R  L  N+V TGG+ +IP   +RL TEL ++ P      + S 
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNKKLPALKFRILTSG 435

Query: 365 QEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
             +++    W      ++   F    V R+EY E G +   K+RF
Sbjct: 436 HLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 91/245 (37%), Gaps = 44/245 (17%)

Query: 5   VLVIDNGSYEIKFGESGWDQP-LRALNCLTKDKYSRFHLSNQTKKMRDISQAL------- 56
            +VID GSY    G SG D P L   +C     Y ++    +  +     Q +       
Sbjct: 16  AVVIDPGSYSTNIGYSGTDSPQLNIPSC-----YGQYTAGGKEGQKSFNDQFMIMPRPDF 70

Query: 57  -IRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSK 115
            I+R  E G +V WE   E W +   +E  F          K     ++E +    E  K
Sbjct: 71  EIKRILENGCVVDWEAAQEQWAWAIRDELKFE-------SFKGTPAFLTEAIWNPEENRK 123

Query: 116 NMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNC 175
              +V+ E  +F++ +  P A    F  G                  +   LV+D G + 
Sbjct: 124 KSLEVLLEGMEFEACYIAPTATCTSFAMG------------------RPTCLVLDIGHDV 165

Query: 176 TWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEETILVNNIKEQCTFVPP 235
               P++ G+   K+  +  + G+ L  L++      H    E   L    +++  FVP 
Sbjct: 166 ASVCPVVDGMTLSKSSTRNFLAGKLLNKLIE-----NHLKPRELVPLYKVERKRPEFVPK 220

Query: 236 ESYFS 240
           +  F+
Sbjct: 221 KFEFT 225

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 83/217 (38%), Gaps = 37/217 (17%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQAL-------- 56
            +VID GSY    G SG D P   +N  +   Y ++    +  K     Q +        
Sbjct: 16  AVVIDPGSYSTNIGYSGTDSP--QINIPS--SYGQYTGGEKEGKKSFNDQFMGMARPDFE 71

Query: 57  IRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKN 116
           I+R  E G +V WE   E W +   +E  F          K     ++E +    E  K 
Sbjct: 72  IKRILEDGCVVDWEAAQEQWTWAIRDELKF-------GSFKGTPAFLTEAIWNSEENRKK 124

Query: 117 MDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCT 176
             +V+ E  +F++ +  P A  + F  G                  +   LV+D G +  
Sbjct: 125 SLEVLLEGMEFEACYIAPTATCVSFAMG------------------RPTCLVVDIGHDVA 166

Query: 177 WAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
              P++ G+   K+  +  + G+ L  L+++ +  R 
Sbjct: 167 SVCPVVDGMTLSKSSTRNFLAGKLLNKLIEKHLEPRE 203

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 52/112 (46%), Gaps = 8/112 (7%)

Query: 298 IAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDW 357
           +A ++   I+ET ++        +R  L  N+V TGG+ +I    +RL TEL ++ P   
Sbjct: 377 LANLVNTAIMETDVD--------LRATLAHNLVVTGGSSSILGLADRLMTELNKKLPALK 428

Query: 358 SCKVHSPQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
              + S   +++    W      ++   F    V R+EY E G +   K+RF
Sbjct: 429 FRILTSGHLRERQSRAWLGGSILSSLGTFHQLWVGRQEYEEVGAERLLKDRF 480

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/228 (20%), Positives = 84/228 (36%), Gaps = 48/228 (21%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQ---------TKKMRDI--S 53
            ++ID GSY    G +G D P   L       +   H + +         T+K R +   
Sbjct: 16  AVIIDPGSYTTNIGYAGTDCPQSIL----PSSFGEIHEAEESTSEDNTEKTRKTRKVFSE 71

Query: 54  QAL--------IRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSE 105
           Q++        ++R  E GQ+  W+   E W +   NE        H    +    +++E
Sbjct: 72  QSIPIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRNE-------LHIESNRGIPAMLTE 124

Query: 106 TLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDF 165
            L    E      +++ E  +F++ +    +  + F  G+                    
Sbjct: 125 PLWNSKENRSKSLEILLEGMEFEACYLTATSTAVSFATGRPN------------------ 166

Query: 166 QLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
            L++D G +     P+I G+   K+ +     GRFL  LL + +  R 
Sbjct: 167 SLIVDIGHDIASVTPVIDGMSLSKSTRCNHFAGRFLNKLLTDYLKPRE 214

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 47/106 (44%)

Query: 304 PGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHS 363
           PGIV+ I   I+ C   +R  L  N+V TGG+  IP   +R+  EL  + P      + +
Sbjct: 387 PGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKFRVLAT 446

Query: 364 PQEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
            Q  ++    W      ++   F    + ++EY E G +    +R 
Sbjct: 447 GQSIERQYQSWLGGSILSSLGTFHQLWIGKKEYEEVGSERLLHDRL 492

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/219 (20%), Positives = 87/219 (39%), Gaps = 35/219 (15%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRAL-NCLTKDKYSRFHLSNQTKKMRDISQALIRRPH-- 61
            ++ID GS+    G SG D P   L +     K +     + TK+ R  S++ I+ P   
Sbjct: 16  AVIIDPGSFSTNIGYSGTDYPQSILPSSYGTYKETTEGQESTTKRKRIFSESSIQIPRPD 75

Query: 62  -------ELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114
                  E G ++ W+   E W +   ++        H   T     +++E +    E  
Sbjct: 76  YEIKRIVENGSIMDWDAAQEQWSWALKSQ-------LHLQSTSGIPALLTEPIWNSVENR 128

Query: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
           K   +++ E  +F++ +   V   + F  G+                     LV+D G +
Sbjct: 129 KKSLEILLEGMNFEACYLSSVPTCVSFAAGRPN------------------CLVVDIGHD 170

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
            T   P++ G+   K+  +  I G+++  L+++ +  R 
Sbjct: 171 TTSVSPVVDGMTLSKSSMRNFIAGKYINTLIEKYLQPRE 209

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%)

Query: 305 GIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSP 364
           G+ + +   I      +R  L  N+V TGG+ +IP   +RL  EL R+ P      + + 
Sbjct: 392 GLADLVYSAIIKSDVDLRASLAHNVVLTGGSSSIPGLSDRLILELNRRLPALKFRILSTG 451

Query: 365 QEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
             K++    W       +   F    V + EY E G++    +RF
Sbjct: 452 HTKERQYQAWLGGSILTSLGTFHQLWVGKNEYNEVGVERLLMDRF 496

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/231 (19%), Positives = 88/231 (38%), Gaps = 51/231 (22%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQ-------------TKKMRD 51
            +VID GSY    G SG D P    + +   +Y  F  +N+             TK+   
Sbjct: 16  AVVIDPGSYSTNIGYSGTDCP----HSILPSRYGSFKKTNKDSGDEDTKSDESATKRAHI 71

Query: 52  ISQ---ALIRRPHEL------GQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLV 102
            S+    L R+ +E+      G +  W+   E W++   NE            TK    +
Sbjct: 72  FSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKNELFLE-------STKGIPAL 124

Query: 103 VSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSY 162
           ++E +    +  K   + + E  +F++ +  P +  + F  G+                 
Sbjct: 125 LTEPVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFATGRAN--------------- 169

Query: 163 KDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
               LV+D G +     P++ G+   K+ ++    G+++  L++  +  R 
Sbjct: 170 ---CLVVDIGHDTCSVSPVVDGMTLSKSTRRSFFAGKYINHLIENFLKPRE 217

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 42/105 (40%)

Query: 305 GIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSP 364
           G+ + +   I      +R  L  N+  TGG   IP   +RL  EL  + P      + + 
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELNARLPALKFRILTTG 459

Query: 365 QEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
            +K++    W       +   F    V R+EY E G D    +RF
Sbjct: 460 HKKEREYQSWLGGSVLTSLGTFHQLWVGRQEYEEVGADRLLNDRF 504

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 43/105 (40%)

Query: 305 GIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSP 364
           G+ + +   I      +R  L  N+V TGG   IP   +RL  EL  + P      + + 
Sbjct: 380 GVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELNSRLPALKFRMITTG 439

Query: 365 QEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
             +++    W       +   F    V +EEY + G+D    +RF
Sbjct: 440 HTRERQYQSWLGGSVLTSLGTFHQLWVGKEEYQDVGVDRLLADRF 484

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/213 (21%), Positives = 81/213 (38%), Gaps = 32/213 (15%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKM-RDISQALIRRPHEL 63
            +VID GSY    G SG D P   L     D  +      + KK+  + S  + R+ +E+
Sbjct: 16  AVVIDPGSYSTNIGYSGTDCPQAILPSCYGDYTNTDDPEGKKKKVFSEQSICIPRKDYEI 75

Query: 64  ------GQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNM 117
                 G ++ W+   E W +   N+     N            +++E +    E  K  
Sbjct: 76  KPIVENGVVIDWDAAQEQWSWALENQLYLRSN-------SGIPALLTEPIWNTVENRKKS 128

Query: 118 DQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTW 177
            +++ E  DF++ +       + F  G                  +   LV+D G +   
Sbjct: 129 LELLLEGMDFEACYLASTPTCVSFGTG------------------RSSCLVVDLGHDTCS 170

Query: 178 AVPIIKGVPYYKAIKKLDIGGRFLTGLLQETIS 210
             P++ G+   K+ K+    G +L  L++  IS
Sbjct: 171 VSPVVDGMTLSKSTKRNFFAGGYLNELIKNYIS 203

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%)

Query: 321 VRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDF 380
           +R  L  NIV TGG  +IP F +RL +EL ++ P      + +   +++    W      
Sbjct: 391 LRATLAHNIVLTGGTSSIPGFSDRLMSELNKKLPALKFRILTTGHLRERQYQAWLGGSIL 450

Query: 381 ANSDQFRSARVTREEYLEHGLDWCTKNRF 409
            +   F    V ++EY E G D    +RF
Sbjct: 451 TSLGSFHQLWVGKQEYEEVGPDRLLSDRF 479

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/211 (17%), Positives = 77/211 (36%), Gaps = 31/211 (14%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRPHEL- 63
            +VID GS+    G SG D P   L     ++ +    +   K   + S  + R  +E+ 
Sbjct: 16  AVVIDPGSFSTNIGFSGTDCPQAILPSCYGEQKAETEDNAPKKIFAEQSIGIPRPDYEIK 75

Query: 64  -----GQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMD 118
                  +V W+   E W +   +       + + N       +++E +    E      
Sbjct: 76  PIVQNSMVVDWDAAEEQWSWALKD-------ILYLNSNSGIPALLTEPIWNTLENKTKSL 128

Query: 119 QVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWA 178
           +++ E   F++ +       + F  G+                     LV+D G + T  
Sbjct: 129 EILLESLQFEACYLSSTPTCVSFASGRPN------------------CLVVDLGHDTTSV 170

Query: 179 VPIIKGVPYYKAIKKLDIGGRFLTGLLQETI 209
            P++ G+   K+  +  + G  +  L+++ +
Sbjct: 171 SPVVDGMTLSKSTMRNFLAGNCINELIKKPL 201

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 44/105 (41%)

Query: 305 GIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSP 364
           G+ + I   I      +R  L  N+V TGG  +IP   +R+  EL +  P      + S 
Sbjct: 392 GLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNKSLPALKFRMLTSG 451

Query: 365 QEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
             K++    W      ++   F    V ++EY E G     K+RF
Sbjct: 452 HLKERQYQSWLGGSILSSLGTFHQLWVGKQEYEEVGASRLLKDRF 496

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/226 (20%), Positives = 81/226 (35%), Gaps = 50/226 (22%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRF----------HLSNQTKKMR---- 50
            +VID GSY    G SG D P   L      +Y ++                +K++    
Sbjct: 16  AVVIDPGSYTTNIGYSGTDCPQVTL----PSRYGQYISEEEEKDEQEQQEDDRKLKQKVF 71

Query: 51  -DISQALIRRPHEL------GQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVV 103
            + S  L R  +++      G ++ W+   E W +   +E        H   TK     +
Sbjct: 72  SEQSIGLPRNNYQIKPIVRNGSVIDWDSAQEQWSWAIQHE-------LHFESTKGMPAFL 124

Query: 104 SETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYK 163
           +E +    E  K   +V+ E  +F++ F  P    + F  G                  +
Sbjct: 125 TEPIWNTEENRKKSLEVLLENMEFEACFLSPTPTCVSFAMG------------------R 166

Query: 164 DFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETI 209
              LV+D G +     P++ G+   K+     I G  L  LL + +
Sbjct: 167 PTCLVVDIGHDVCSVSPVVDGMTLSKSSTSNFIAGSLLNALLSKQL 212

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/219 (21%), Positives = 85/219 (38%), Gaps = 36/219 (16%)

Query: 5   VLVIDNGSYEIKFGESGWDQPLRAL-NCLTKDKYSRFHLSNQTKKMRDI--SQALI-RRP 60
            +VID GS+    G SG D P   L +C    K +     +  K    +   Q+L   RP
Sbjct: 16  AVVIDPGSFTTNIGYSGTDCPQAILPSCYGHHKTNENADGDDEKSKPKVFAEQSLTFPRP 75

Query: 61  H-------ELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPEL 113
                   E G +V W+   E WD+   N       + H    K    +++E++    E 
Sbjct: 76  DYEIKPIVENGLVVDWDAAQEQWDWALRN-------VLHLESNKGVPALMTESIWNTMEN 128

Query: 114 SKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGF 173
                +V+ E  DF++ +       + F  G+                     LV+D G 
Sbjct: 129 KTKSLEVLLETLDFEACYISSTPTCVSFATGRPN------------------CLVVDVGH 170

Query: 174 NCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFR 212
           +   + P++ G+   ++ ++  I G+F+  L+ + +  R
Sbjct: 171 DTASSSPVVDGMTLSRSTRRNFISGKFVDQLIGKYLQPR 209

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/105 (25%), Positives = 45/105 (42%)

Query: 305 GIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSP 364
           GI + +   I      +R  L  NIV TGG+ ++P F +RL  EL ++ P      + + 
Sbjct: 378 GISDLVHSSITSADVDLRATLAHNIVLTGGSSSVPGFSDRLMNELTKKLPALKFRVLTTG 437

Query: 365 QEKDKSLHGWESMKDFANSDQFRSARVTREEYLEHGLDWCTKNRF 409
             +++    W       +   F    V + EY E G +    +RF
Sbjct: 438 HLRERQYQSWLGGSILTSLGSFHQLWVGKREYEEVGAERLLNDRF 482

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 58/137 (42%), Gaps = 16/137 (11%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVETILECI----------NMCPEVVRPLLVANIVCTGG 334
           E   VPE  F P +    + GI E I E I          N+  + +   +  N+   GG
Sbjct: 617 ERIRVPEVMFQPILGGQDQAGITE-ICETIITKKFGSTPRNLSQQSLD--MAKNVWLVGG 673

Query: 335 NFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFANSDQ-FRSARVTR 393
           N  +P    R+  E     P D    V+  +    +L  W  M   AN+++ ++   VT 
Sbjct: 674 NAQVPGLKSRVVKEFTEFLPSDTKINVNISEA--PTLDVWNGMYRLANTEEDYQRTIVTS 731

Query: 394 EEYLEHGLDWCTKNRFG 410
           EEY E G+D+  +++  
Sbjct: 732 EEYDECGVDYLKEHKLS 748

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 44/213 (20%), Positives = 92/213 (43%), Gaps = 39/213 (18%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDI---------SQAL 56
           + ID GSYE++ G +   +P    + +  +++S++      K +  I         +++ 
Sbjct: 43  IAIDFGSYELRAGYTNISRP----SHIFPNRFSKYRDRKTNKYLPCIGYDTWLDQTTRSQ 98

Query: 57  IRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKN 116
            R P +   +V+W++  ++  Y F+     H  +  DN    + ++++E L  +     N
Sbjct: 99  ARSPFDGPLVVNWDMVEDILQYTFH-----HLGVQPDNGVT-NPIIINEKLACLQSQRSN 152

Query: 117 MDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCT 176
             Q +FE +    +    V   + FY             +  +S+     +VID G+  T
Sbjct: 153 WYQTLFESFGVPKVSMA-VEGMLAFY-----------GHNGGSST----GIVIDCGYEDT 196

Query: 177 WAVPIIKGVPYYKAIKKLDIGGR----FLTGLL 205
             +PI++G       K+++ GG     +L+ LL
Sbjct: 197 NVIPIVEGQGMMLDAKRINWGGHSSIDYLSNLL 229

>SAKL0F13772g Chr6 (1099703..1100971) [1269 bp, 422 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034W ARP7
           Actin-related protein involved in transcriptional
           regulation subunit of the chromatin remodeling Snf/Swi
           complex
          Length = 422

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 39/87 (44%), Gaps = 1/87 (1%)

Query: 317 CPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWES 376
            PE +   L+ NIV TG    +P   +R+  EL  Q P        +P   D+ L  W+ 
Sbjct: 332 TPEQIHAALLTNIVITGSTSLVPGVEQRIVNELSYQFPQYKLSSFANPMVLDRKLQSWQG 391

Query: 377 MKDFANSDQFRSAR-VTREEYLEHGLD 402
               +N   +     +TR+EY  +G++
Sbjct: 392 GVTMSNLPSWELGNWITRQEYDANGIN 418

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 52/120 (43%), Gaps = 14/120 (11%)

Query: 285 EVFSVPETFFHPEIAQILKPGIVE---TIL------ECINMCPEVVRPLLVANIVCTGGN 335
           E   VPE  F P +    + GI+E   TIL      E   + P  +   +  N+  TGGN
Sbjct: 614 ERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKLSPTAL--AMANNLWITGGN 671

Query: 336 FNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESMKDFA-NSDQFRSARVTRE 394
             +P   ER+  E     P+  +  V   Q  + SL  W  M     NS+ +++  ++++
Sbjct: 672 SKLPGMKERIVKEFTGFLPVGTAFNVK--QSYNPSLDAWNGMAKLTLNSEDYKNTIISKK 729

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 42/213 (19%), Positives = 87/213 (40%), Gaps = 27/213 (12%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRAL-NCLTKDKYSR----FHLSNQTKKMRDISQALIRRP 60
           + ID GS +I+ G +    P     N LT+ +  +    F        +    +   + P
Sbjct: 39  IAIDFGSSQIRAGYTNQSTPSHIFPNRLTRYRDRKINKTFTFIGNDVSLDQAIRTQSKSP 98

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQV 120
            +   + +W+   ++  Y F      H  +   N    + ++++E L T+     N  Q+
Sbjct: 99  FDGSIITNWDYVEDIMQYIFN-----HLGVVGHNGVS-NPILLTEKLATLQSQRSNWYQL 152

Query: 121 IFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAVP 180
           +FE +D   +  G +     FY             ++++S+     LVID G   T  +P
Sbjct: 153 LFECFDIPEVTLG-IDSMFAFY-----------GLNERSST----GLVIDCGNEETDVIP 196

Query: 181 IIKGVPYYKAIKKLDIGGRFLTGLLQETISFRH 213
           +++G       K+++ GGR     L + ++ ++
Sbjct: 197 VVEGAGMLTDAKRINWGGRQAVDYLNDLLTLKY 229

>CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034w ARP7
           Actin-like protein
          Length = 529

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 1/88 (1%)

Query: 315 NMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGW 374
           N+ PE V  LL+ N++ TGG   I    +R+  EL  + P        +P +  +SL  W
Sbjct: 433 NITPEHVYSLLLTNVIITGGTSLIDGMEQRIIRELSIRFPQYKLSTFTNPDQLQRSLQAW 492

Query: 375 ESMKDFANSDQFRSAR-VTREEYLEHGL 401
                 +N  ++   +  T+E++  H L
Sbjct: 493 NGAVSLSNLPKWGLTQWFTKEDFNNHKL 520

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/85 (25%), Positives = 39/85 (45%), Gaps = 1/85 (1%)

Query: 315 NMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGW 374
           +  PE +   L+ N+V  GG   +    +RL  +L  Q P        +P   D+ L  W
Sbjct: 313 SATPEQIHAALLTNVVIIGGTSLLQGLEQRLVNDLSLQFPQYKLSTYATPAHVDRQLQSW 372

Query: 375 ESMKDFANSDQFR-SARVTREEYLE 398
           +   +  +   ++  + VT++EYLE
Sbjct: 373 QGGVNMCHLPDWKLGSWVTKQEYLE 397

>Kwal_27.10552 s27 complement(390650..391705) [1056 bp, 351 aa] {ON}
           YPR034W (ARP7) - actin related protein, subunit of the
           chromatin remodeling Snf/Swi complex [contig 35] PARTIAL
          Length = 351

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 29/65 (44%)

Query: 318 PEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGWESM 377
           PE +   L+ NIV TG +  IP   +R+  +L  Q P        +P   D+ L  W+  
Sbjct: 263 PEQIHAALLTNIVITGSSSLIPGLEQRIVNDLSYQFPQYKLSSFANPLVLDRKLQSWQGG 322

Query: 378 KDFAN 382
              AN
Sbjct: 323 VTMAN 327

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 61/145 (42%), Gaps = 29/145 (20%)

Query: 68  SWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQVIFEEYDF 127
           +WE   + W+Y F        N       +++ LV+     TIP + K +D  + E+Y F
Sbjct: 83  NWEALEQQWNYLF--------NDVLRCSPEEYPLVI-----TIPSMKKEIDGEVLEKY-F 128

Query: 128 KSMF---KGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAVPIIKG 184
             +F   K PV Q I       +  A+T +  K +       LVID G +     PII G
Sbjct: 129 SLVFERFKFPVFQII------LEPLAITLSLGKSSG------LVIDMGSSGCRVTPIIDG 176

Query: 185 VPYYKAIKKLDIGGRFLTGLLQETI 209
                A+     GG FL   + ET+
Sbjct: 177 TVIKNAVLSSKYGGAFLDYQIIETL 201

>KLTH0C05324g Chr3 complement(458911..460110) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12406 Saccharomyces cerevisiae
           YPR034W ARP7 Actin-related protein involved in
           transcriptional regulation subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 399

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 56/269 (20%), Positives = 94/269 (34%), Gaps = 34/269 (12%)

Query: 139 IPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGG 198
           IP +Q   +  A+  +  + T+      LV+D G   +   PII G     A+ +    G
Sbjct: 116 IPVFQLVVEPLAVALSLGRNTA------LVVDVGAAKSTVTPIIDGTVVQTAVARSKFAG 169

Query: 199 RFLTGLLQETISFRHYNVMEETILVNNIKEQCTFV--PPESYFSSFHNKMNTKVEYVLPD 256
            FL   + E ++       EE    NN K+    +     ++   F   M       L D
Sbjct: 170 DFLDMQVNELLTKIAPIKDEEEGDPNNRKDPSLTLWRNSRTWIQEFKTYMLQVAPSRLQD 229

Query: 257 FQTSFL-----GYVKKPGKEKXXXXXXXXXXXXEVFSVPETFFHPE-IAQ--ILKPGIVE 308
             ++ L      Y+K    +K            E+    E  F P  ++Q  +   G+ E
Sbjct: 230 LDSAALDMMGLTYIKNFLLQKQKTISLTQKQCCEL---AEGLFQPRSVSQQFVAAEGLSE 286

Query: 309 TILECIN---------------MCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQC 353
            + + +                  PE     L+ NI+ TG +  I    +R+  +L  Q 
Sbjct: 287 IVAKSVKKAGASTATSSSATNVTTPEQTHAALLTNILITGSSSLISGLEQRIVNDLSYQF 346

Query: 354 PIDWSCKVHSPQEKDKSLHGWESMKDFAN 382
           P        +P   D+ L  W+     AN
Sbjct: 347 PQYKLSSFANPLVLDRKLQSWQGGVTMAN 375

>Suva_16.364 Chr16 (646188..647630) [1443 bp, 480 aa] {ON} YPR034W
           (REAL)
          Length = 480

 Score = 34.7 bits (78), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 30/68 (44%)

Query: 315 NMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGW 374
           N+ PE V  LL+ NI+ TG +  I    +R+  EL  + P        +    D+ + GW
Sbjct: 378 NISPEQVYSLLLTNIIITGSSSLIEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGW 437

Query: 375 ESMKDFAN 382
                 AN
Sbjct: 438 LGAVTMAN 445

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 54/113 (47%), Gaps = 18/113 (15%)

Query: 107 LMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQ 166
           ++TIP  +K++D++I ++Y F+  F+      +P  Q   +  A+  +  K +S      
Sbjct: 109 VITIPSANKDVDEIILKKY-FELAFE---TFNVPVLQIIIEPLAVALSLGKSSS------ 158

Query: 167 LVIDSGFNCTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHYNVMEE 219
           LV++ G +     PI+ G     A+ K   GG FL         F+  N+++E
Sbjct: 159 LVVNLGASGCNVTPIVDGTVIKHAVMKSKYGGDFL--------DFQIVNILQE 203

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 2/66 (3%)

Query: 4   PVLVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQALIRRPHEL 63
           P  +  NGS    FG+ G+D  L   +  T DKY+    +N+T    DI   +   P ++
Sbjct: 361 PANITTNGSSSSSFGQPGFD--LNTNHYATNDKYTDNSDNNKTNNYNDILPFISESPFDM 418

Query: 64  GQLVSW 69
            Q+ ++
Sbjct: 419 NQVTNF 424

>Smik_16.278 Chr16 (516276..517706) [1431 bp, 476 aa] {ON} YPR034W
           (REAL)
          Length = 476

 Score = 33.9 bits (76), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 29/68 (42%)

Query: 315 NMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGW 374
           N+ PE V  LL+ N++ TG    I    +R+  EL  + P        +    D+ + GW
Sbjct: 377 NISPEQVYSLLLTNVIITGSTSLIEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGW 436

Query: 375 ESMKDFAN 382
                 AN
Sbjct: 437 LGAVTMAN 444

>YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}
           ARP7Component of both the SWI/SNF and RSC chromatin
           remodeling complexes; actin-related protein involved in
           transcriptional regulation
          Length = 477

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 29/68 (42%)

Query: 315 NMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGW 374
           N+ PE V  LL+ N++ TG    I    +R+  EL  + P        +    D+ + GW
Sbjct: 378 NISPEQVYSLLLTNVIITGSTSLIEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGW 437

Query: 375 ESMKDFAN 382
                 AN
Sbjct: 438 LGALTMAN 445

>NCAS0D00820 Chr4 (146043..148061) [2019 bp, 672 aa] {ON} Anc_2.329
           YGL145W
          Length = 672

 Score = 33.9 bits (76), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 70/177 (39%), Gaps = 35/177 (19%)

Query: 105 ETLMTIP-ELSKNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAED------K 157
           ET+   P +LSK+ D       DF  + K       PFYQ +Y+       +       K
Sbjct: 352 ETITQNPVDLSKSAD-------DFNKILKKTYEYLEPFYQLEYEPLETYKLKTCSQIFMK 404

Query: 158 KTSSYKDFQLVIDSGFNCTWAVPIIKGVPYYKAIKKL---DIGGRFLTGLLQETISFRHY 214
            +SSY D+ L  DS           K    Y+ I KL   +I  R +  L +  +  R  
Sbjct: 405 LSSSYLDYVLTTDS-----LGEKRTKEKELYQTIIKLQCLNIVYRKIYELSENPVFIRLT 459

Query: 215 NVMEETILVNNIKEQCTFVPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKE 271
           N++ E             +   +YFS F N +N     ++ D Q S +  VKK  KE
Sbjct: 460 NMVNE-------------IEGSNYFSVFQNILNDYQTDMVDDIQNSIIHRVKKLIKE 503

>Skud_16.321 Chr16 (604148..605587) [1440 bp, 479 aa] {ON} YPR034W
           (REAL)
          Length = 479

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 29/68 (42%)

Query: 315 NMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQCPIDWSCKVHSPQEKDKSLHGW 374
           N+ PE V  LL+ N++ TG    I    +R+  EL  + P        +    D+ + GW
Sbjct: 377 NISPEQVYSLLLTNVIITGSTSLIEGMEQRIIKELSIRFPQYKLTTFANQVMMDRKIQGW 436

Query: 375 ESMKDFAN 382
                 AN
Sbjct: 437 LGAVTMAN 444

>SAKL0A08162g Chr1 complement(721932..724385) [2454 bp, 817 aa] {ON}
           highly similar to uniprot|P29496 Saccharomyces
           cerevisiae YLR274W CDC46 Component of the hexameric MCM
           complex which is important for priming origins of DNA
           replication in G1 and becomes an active ATP-dependent
           helicase that promotes DNA melting and elongation when
           activated by Cdc7p-Dbf4p in S-phase
          Length = 817

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 12/55 (21%)

Query: 333 GGNFNIPNFHERLQTELQRQCPIDWSC------------KVHSPQEKDKSLHGWE 375
           G N N+ N  +R++ EL+R+ PI WS             K HS    DK+L+  E
Sbjct: 744 GSNTNMANEVKRIENELKRRLPIGWSTSYQTLKREFIEGKGHSQAALDKALYVLE 798

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 63/147 (42%), Gaps = 32/147 (21%)

Query: 61  HELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPE-LSKNMD- 118
            +LG   +WE   + W+Y F  E     + T         L V   L+TIP  +SKN D 
Sbjct: 70  SQLGVPYNWEALEKQWEYIF--EKQLKCDPTE--------LPV---LITIPSSISKNEDI 116

Query: 119 -QVIFEEY---DFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174
              + E+Y    F+  FK      IP+ Q   +  +++    KKTS      LVID   +
Sbjct: 117 ENKVIEQYCKIAFEK-FK------IPYLQIVNESLSISLGLGKKTS------LVIDISGS 163

Query: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFL 201
            +   PI+ GV     I K   GG FL
Sbjct: 164 GSSVTPIVDGVIIKNGIVKSKYGGDFL 190

>KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly
           similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 797

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 304 PGIVETILECINMCPEVVRPLLVANIVCTGGNFNIP 339
           P  +E +L C N+  ++  P+++ N   T GN NIP
Sbjct: 627 PNSIEILLNCFNVAQQIESPIVLHNESVTIGNHNIP 662

>KAFR0D01030 Chr4 (212780..212792,212864..215043) [2193 bp, 730 aa]
           {ON} Anc_8.50 YLR054C
          Length = 730

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 31/47 (65%), Gaps = 2/47 (4%)

Query: 93  DNDTKDHHLVVSETLMTIPELSKNMDQVIFEEYDFKSMFKGPVAQYI 139
           ++D+    L + E++  IP++S N+  +I+EE+D++++ K P  + I
Sbjct: 212 ESDSSKMSLKIWESI--IPKISLNILSIIYEEFDYETLLKTPSTEAI 256

>TPHA0B01460 Chr2 complement(325847..327304) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 52/214 (24%), Positives = 80/214 (37%), Gaps = 50/214 (23%)

Query: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKY----------SRFHLSNQTKKMRDISQA 55
           +VI NG+     G S  + P     C+    Y            F + ++  K  D  + 
Sbjct: 7   VVIHNGTASTIAGFSCSESP----KCMIPSSYIQKANGDIVFGTFEMLDEAAKNEDNDEV 62

Query: 56  LIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSE----TLMTIP 111
                 + G   +WE   + W Y +                 + HL VS       +T+P
Sbjct: 63  FTIMDSKFGVPYNWEALEKQWRYIY-----------------EEHLKVSPDQLPLAITVP 105

Query: 112 E-LSKN--MDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLV 168
             L+KN  ++  I EEY   +  K      IP  +   +  A++ +  KK S      L+
Sbjct: 106 SILTKNVELETKIIEEYCKIAFLK----LGIPSLRVVNESLAISLSLGKKNS------LI 155

Query: 169 ID-SGFNCTWAVPIIKGVPYYKAIKKLDIGGRFL 201
           ID SG  C+   PI+ G+     I K   GG FL
Sbjct: 156 IDLSGSGCS-VTPILDGILIKNGILKSKFGGDFL 188

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 51/138 (36%), Gaps = 23/138 (16%)

Query: 64  GQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELSKNMDQVIFE 123
           G   +WE     W Y +  E           D ++  LV+S     +P     +D  + E
Sbjct: 68  GMPYNWEALEAQWRYLYEYELKV--------DPQELPLVIS-----VPATHSEIDPQVVE 114

Query: 124 EYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFNCTWAVPIIK 183
            Y   ++ K      +P  Q   +  A+  A  K ++      LVID G   T   PI+ 
Sbjct: 115 NYFDLALNK----LQVPALQIVVEPLAVALAMGKSSA------LVIDVGARGTTVTPIVD 164

Query: 184 GVPYYKAIKKLDIGGRFL 201
           G      + K   GG FL
Sbjct: 165 GTVVRSGVMKSRFGGDFL 182

>YGR271W Chr7 (1031791..1037694) [5904 bp, 1967 aa] {ON}
           SLH1Putative RNA helicase related to Ski2p, involved in
           translation inhibition of non-poly(A) mRNAs; required
           for repressing propagation of dsRNA viruses
          Length = 1967

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%)

Query: 15  IKFGESGWDQPLRALNCLTKDKYSRFHLSNQTKKMRDISQ 54
           IK  ES  +  L A + + KDKYSR  + N+ K M++I Q
Sbjct: 553 IKLAESNHEVDLFAPDPIEKDKYSRSLVKNRDKDMKEIFQ 592

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,348,663
Number of extensions: 2109834
Number of successful extensions: 5911
Number of sequences better than 10.0: 165
Number of HSP's gapped: 5630
Number of HSP's successfully gapped: 208
Length of query: 415
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 303
Effective length of database: 40,638,807
Effective search space: 12313558521
Effective search space used: 12313558521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)