Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F19041g8.257ON76376335500.0
SAKL0H17160g8.257ON73974725400.0
KLTH0G13794g8.257ON72574724890.0
Kwal_56.236078.257ON72574924800.0
TDEL0F038408.257ON72674824250.0
ZYRO0C01782g8.257ON73075423210.0
Suva_2.2698.257ON72555820380.0
YDR109C8.257ON71551720310.0
Smik_4.3558.257ON70452420230.0
Skud_4.3708.257ON71453919860.0
Kpol_392.98.257ON59452217940.0
NDAI0J014008.257ON58852417810.0
Ecym_43138.257ON59751717760.0
TBLA0E044008.257ON58952217030.0
NCAS0B038708.257ON59651717010.0
KNAG0H032608.257ON58055516710.0
KAFR0B055608.257ON60551916650.0
CAGL0B01727g8.257ON57751616370.0
AGR092W8.257ON59653515580.0
TPHA0B032408.257ON58551715200.0
Suva_14.931.111ON5435305146e-56
Skud_14.891.111ON5695264762e-50
Smik_14.861.111ON5435284636e-49
YNL249C (MPA43)1.111ON5425234565e-48
Kwal_33.135301.111ON5345504161e-42
KLTH0F03080g1.111ON5335244053e-41
SAKL0C03432g1.111ON5475264063e-41
ZYRO0F16016g1.111ON5424714028e-41
KNAG0F006601.111ON5355264028e-41
TDEL0C059001.111ON5435344002e-40
KLLA0C02937g1.111ON5164952822e-25
NCAS0A007801.111ON5495191734e-12
Suva_4.3143.297ON353123830.20
NCAS0C059004.9ON703188840.22
NDAI0H002204.9ON810147800.70
KLLA0E00595g4.9ON661157725.8
NDAI0B03840singletonON136368726.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F19041g
         (763 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...  1372   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   983   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   963   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   959   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   938   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   898   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   789   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   786   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   783   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   769   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   695   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   690   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   688   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   660   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    659   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   648   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   645   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   635   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   604   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   590   0.0  
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   202   6e-56
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   187   2e-50
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   182   6e-49
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   180   5e-48
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   164   1e-42
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   160   3e-41
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   160   3e-41
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   159   8e-41
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   159   8e-41
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   158   2e-40
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   113   2e-25
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    71   4e-12
Suva_4.314 Chr4 (557178..558239) [1062 bp, 353 aa] {ON} YBR076W ...    37   0.20 
NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4...    37   0.22 
NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}...    35   0.70 
KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON...    32   5.8  
NDAI0B03840 Chr2 complement(965694..969785) [4092 bp, 1363 aa] {...    32   6.7  

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score = 1372 bits (3550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/763 (88%), Positives = 673/763 (88%)

Query: 1   MFGXXXXXXXXXXXXXXXXXXXMSGLSLQNERKMVYYVGVDVGTGSARACVIDNLGNILS 60
           MFG                   MSGLSLQNERKMVYYVGVDVGTGSARACVIDNLGNILS
Sbjct: 1   MFGSRKSHSSLSISQQRLLSHSMSGLSLQNERKMVYYVGVDVGTGSARACVIDNLGNILS 60

Query: 61  LAERPIQRHELKPNYITQSSQEIWNAICYCVKNVVRDSGVDPRTIHGIGFDATCSLXXXX 120
           LAERPIQRHELKPNYITQSSQEIWNAICYCVKNVVRDSGVDPRTIHGIGFDATCSL    
Sbjct: 61  LAERPIQRHELKPNYITQSSQEIWNAICYCVKNVVRDSGVDPRTIHGIGFDATCSLVVVD 120

Query: 121 XXXXXXXXXPDFTDNLQNIILWMDHRAIEETEEINATGDKCLKYVGGQMSVEMEIPKIKW 180
                    PDFTDNLQNIILWMDHRAIEETEEINATGDKCLKYVGGQMSVEMEIPKIKW
Sbjct: 121 NNNEDVGVGPDFTDNLQNIILWMDHRAIEETEEINATGDKCLKYVGGQMSVEMEIPKIKW 180

Query: 181 LKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFL 240
           LKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFL
Sbjct: 181 LKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFL 240

Query: 241 QEIGLEELIADDFAKLGGSVTETTFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYA 300
           QEIGLEELIADDFAKLGGSVTETTFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYA
Sbjct: 241 QEIGLEELIADDFAKLGGSVTETTFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYA 300

Query: 301 GWVGTVAARTDVEIPALVKSDEVKHGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGP 360
           GWVGTVAARTDVEIPALVKSDEVKHGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGP
Sbjct: 301 GWVGTVAARTDVEIPALVKSDEVKHGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGP 360

Query: 361 YRDVMAPGFWLAEGGQSCTGALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQ 420
           YRDVMAPGFWLAEGGQSCTGALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQ
Sbjct: 361 YRDVMAPGFWLAEGGQSCTGALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQ 420

Query: 421 QRKASSVVALAKHLFFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIA 480
           QRKASSVVALAKHLFFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIA
Sbjct: 421 QRKASSVVALAKHLFFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIA 480

Query: 481 QQTRQIVEQMCNSGHELAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSAL 540
           QQTRQIVEQMCNSGHELAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSAL
Sbjct: 481 QQTRQIVEQMCNSGHELAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSAL 540

Query: 541 LGAVASESFNACAKLEETASDPATTSNKDVSIRRKSSLSRKDAXXXXXXXXXXXXXXXXX 600
           LGAVASESFNACAKLEETASDPATTSNKDVSIRRKSSLSRKDA                 
Sbjct: 541 LGAVASESFNACAKLEETASDPATTSNKDVSIRRKSSLSRKDAGIIGDGSRSRSGSAASG 600

Query: 601 XXXXXXNTLKPLTSFAKAQKKTNDLKFADMXXXXXXXXXXXXXXXXXXXGGYPFPVMASX 660
                 NTLKPLTSFAKAQKKTNDLKFADM                   GGYPFPVMAS 
Sbjct: 601 LGHGGGNTLKPLTSFAKAQKKTNDLKFADMPSPYTAPSATSSTAQISTTGGYPFPVMASN 660

Query: 661 XXXXXXXXXXXXXXXSLLTFDAKTEKSKEAATSAANHNNAKVLRDVTKDKLWEVMYNMTG 720
                          SLLTFDAKTEKSKEAATSAANHNNAKVLRDVTKDKLWEVMYNMTG
Sbjct: 661 EEAIIDEMEEENEDESLLTFDAKTEKSKEAATSAANHNNAKVLRDVTKDKLWEVMYNMTG 720

Query: 721 GGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763
           GGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK
Sbjct: 721 GGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  983 bits (2540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/747 (67%), Positives = 552/747 (73%), Gaps = 46/747 (6%)

Query: 23  MSGLSLQNERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQE 82
           MS LS++ + KM YYVGVDVGTGSARAC+IDN+GNILSLAERPIQR ELKP+YITQSSQE
Sbjct: 22  MSALSME-QNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQE 80

Query: 83  IWNAICYCVKNVVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIIL 141
           IW AICYCVK+VV+DSGV P  IHGIGFDATCSL              PDF +  QNIIL
Sbjct: 81  IWLAICYCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIIL 140

Query: 142 WMDHRAIEETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADY 201
           WMDHRAI+ET+EINAT DKCLKYVGGQMSVEMEIPKIKWLKNN+P +KF +CKFFDLADY
Sbjct: 141 WMDHRAIDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADY 200

Query: 202 LTFKATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVT 261
           LTFKATG E RSYCSTVCKQGLLP+GVE SK GWSKEFL  IGLE+L  DDF KLGGS+ 
Sbjct: 201 LTFKATGLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIK 260

Query: 262 E-----TTFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPA 316
                 +TFLSAGECIG+L   +A ELGL  HCVVGSGVIDAYAGWVGTVAARTDV+IP 
Sbjct: 261 SDGSGGSTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPE 320

Query: 317 LVKSDEVKHGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQ 376
           LV++D  K GID ATGRLAAVAGTSTCHIAMSKDPIFV GVWGPYRDVMAPGFW AEGGQ
Sbjct: 321 LVEADNEKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQ 380

Query: 377 SCTGALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFF 436
           SCTGALLAHVLT HPAY ELS LSDAA+VSKFDYLNSRLE+L QQR A SVVALAKHLFF
Sbjct: 381 SCTGALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFF 440

Query: 437 YGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHE 496
           YGDYHGNRSPIADPSMRAA+IGQSMDNSIDDL+IMYLGACEFIAQQTRQIVE+M  SGH 
Sbjct: 441 YGDYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHR 500

Query: 497 LAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNACAKLE 556
           +AAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFN   K  
Sbjct: 501 IAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHK-- 558

Query: 557 ETASDPATTSNKDVSIRRKSSLSRKDAXXXXXXXXXXXXXXXXXXXXXXXNTLKPLTSFA 616
                     +  +S RRKSSLS K                         +   P T+  
Sbjct: 559 ----------SGSLSRRRKSSLSGKYEEFKDSMEIPKKNFLSKLGGTASGDLPSPYTA-P 607

Query: 617 KAQKKTNDLKFADMXXXXXXXXXXXXXXXXXXXGGYPFPVMASXXXXXXXXXXXXXXXXS 676
            A   T+ +                        GG+PFPV +                 +
Sbjct: 608 SATASTSQI--------------------ASTVGGFPFPVTSDDSVAIIEEDDPEEANAA 647

Query: 677 LLTFDAKTEKSKEAATSAANHNNAKVLRDVTKDKLWEVMYNMTGGGKVVWPTEEDAPDRL 736
           L     K    ++ A       + K       D LW+VMYNMTGGGKVV P+ +D PDR+
Sbjct: 648 LSFGSKKATAQEQLALEKEKSASGK------GDALWDVMYNMTGGGKVVQPSSDDHPDRV 701

Query: 737 LLNAKYKIFLDMAATQQKYRKLVDEVK 763
           LL+AKYKIFLDMA TQ++YR+ VD+V+
Sbjct: 702 LLDAKYKIFLDMAETQRRYREAVDKVE 728

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  963 bits (2489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/747 (65%), Positives = 553/747 (74%), Gaps = 55/747 (7%)

Query: 23  MSGLSLQNERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQE 82
           M GLSL+ ++KM+YYVGVDVGTGSARAC+ID++GNILSLAERPIQR +LK N+ITQSSQE
Sbjct: 22  MVGLSLE-QQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQE 80

Query: 83  IWNAICYCVKNVVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIIL 141
           IW A+C+CVK+VVRDSGV    IHGIGFDATCSL              PDF++  QNIIL
Sbjct: 81  IWQAVCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIIL 140

Query: 142 WMDHRAIEETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADY 201
           WMDHRAIEET+ INATGDKCLKYVGGQMSVEMEIPKIKWLKN++PE KF +CKFFDLADY
Sbjct: 141 WMDHRAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADY 200

Query: 202 LTFKATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVT 261
           LTFKA+G E RS+CSTVCKQGLLP+GVEGS  GWS+EFL EIGLEELI DDF ++GGSV 
Sbjct: 201 LTFKASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVK 260

Query: 262 ET----TFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPAL 317
            +     FLSAGE IG +    A ELGLS HCVVGSGVIDAYAGWVGTVAARTDV IPAL
Sbjct: 261 NSDKGKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPAL 320

Query: 318 VKSDEVKHGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQS 377
           VK+D+ K G+DRATGRLAAVAGTSTCHIAMS+DPIFV GVWGPYRD +A  FW AEGGQS
Sbjct: 321 VKTDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQS 380

Query: 378 CTGALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFY 437
           CTGALLAHVLTTHPAY ELSQL+DAA+VSKFDYLNSRLE LAQQ+KA SVV LAKHLFFY
Sbjct: 381 CTGALLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFY 440

Query: 438 GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHEL 497
           GDYHGNRSPIADPSMRAAIIGQSMDNSIDDL++MYLGACEFIAQQTRQIV++MC SGH+L
Sbjct: 441 GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDL 500

Query: 498 AAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNACAKLEE 557
           +AIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESF+       
Sbjct: 501 SAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFD------- 553

Query: 558 TASDPATTSNKDVSIRRKSSLSRKDAXXXXXXXXXXXXXXXXXXXXXXXNTLKPLTSFAK 617
                 + ++  +S+ RKSS++ + A                       N  +P  S   
Sbjct: 554 -----LSGTHSALSVSRKSSIAGEPA-----------------------NAGQPKKS--- 582

Query: 618 AQKKTNDLKFADMXXXXXXXXXXXXXXXXXXXGGYPFPVMASXXXXXXXXXXXXXXXXSL 677
           A  K   L   D+                    G+PFP                    S 
Sbjct: 583 AVSKFGQLGGDDLPSPYTAPSATASTSQIASTIGFPFPTPEDAYAIDEHVEQEKDEGEST 642

Query: 678 -LTFDA--KTEKSKEAATSAANHNNAKVLRDVTKDKLWEVMYNMTGGGKVVWPTEEDAPD 734
            L F A  K +K  E      + +N         D +W VMYNMTGGGKVV P  E+  D
Sbjct: 643 ELNFKAHSKWKKDMEDRMKGRSSDNG--------DAMWNVMYNMTGGGKVVQPAAEENAD 694

Query: 735 RLLLNAKYKIFLDMAATQQKYRKLVDE 761
           R+LLNAKYKIFLDMA TQ+KYR +VD+
Sbjct: 695 RVLLNAKYKIFLDMAETQRKYRTIVDD 721

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  959 bits (2480), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/749 (65%), Positives = 551/749 (73%), Gaps = 55/749 (7%)

Query: 23  MSGLSLQNERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQE 82
           M+GLSL+ ++KM+YY+GVDVGTGSARAC+ID++GNILSLAERPIQR +LKPN+ITQSSQE
Sbjct: 22  MTGLSLE-QQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQE 80

Query: 83  IWNAICYCVKNVVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIIL 141
           IW A+C+CVK+VVRDSGV    IHGIGFDATCSL              PDF +  QNIIL
Sbjct: 81  IWQAVCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIIL 140

Query: 142 WMDHRAIEETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADY 201
           WMDHRAIEETE+INATGDKCLKYVGGQMSVEMEIPKIKWLKN++P  KF +CKFFDLADY
Sbjct: 141 WMDHRAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADY 200

Query: 202 LTFKATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVT 261
           LTFKA+G E RS+CSTVCKQGLLP+GVEGSK GWS+EFL EIGLE+ I DDF K+GGSV 
Sbjct: 201 LTFKASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVK 260

Query: 262 ET----TFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPAL 317
            +     FLSAGE +G +    A ELGLS HCVVGSGVIDAYAGWVGTVAARTDV IPAL
Sbjct: 261 NSDKGKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPAL 320

Query: 318 VKSDEVKHGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQS 377
           VK D+ K G+DRATGRLAAVAGTSTCHIAMS+DPIFV GVWGPYRD +A  FW AEGGQS
Sbjct: 321 VKIDQEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQS 380

Query: 378 CTGALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFY 437
           CTGALLAHV+TTHPAY ELSQL+DAA+VSKFDYLNSRLE LAQQ+K+ SVV LA+HLFFY
Sbjct: 381 CTGALLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFY 440

Query: 438 GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHEL 497
           GDYHGNRSPIADPSMRAAIIGQSMDNSIDDL++MYLGACEFIAQQTRQIVE+M  SGH++
Sbjct: 441 GDYHGNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDM 500

Query: 498 AAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNACAKLEE 557
           AAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESF+       
Sbjct: 501 AAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLS----- 555

Query: 558 TASDPATTSNKDVSIRRKSSLSRKDAXXXXXXXXXXXXXXXXXXXXXXXNTLKPLTSFAK 617
                 TTS  ++S+ RKSS++                           +  +P  S   
Sbjct: 556 -----GTTS--ELSVSRKSSIA-----------------------GHPTDGSQPKKS--- 582

Query: 618 AQKKTNDLKFADMXXXXXXXXXXXXXXXXXXXGGYPFPVMASXXXX-XXXXXXXXXXXXS 676
           A  K       D+                    G+PFP                     S
Sbjct: 583 AVSKLGQFGSDDLPSPYTAPSATASTSQIASTVGFPFPTPDDPYALGEQTEPDADNDNSS 642

Query: 677 LLTFDA--KTEKSKEAATSAANHNNAKVLRDVTKDKLWEVMYNMTGGGKVVWPTEEDAPD 734
            L F A  K +K  E      + +N         D +W VMYNMTGGGKVV P  ED PD
Sbjct: 643 ELNFKAHSKWKKDMEDRMKGRSSDNG--------DAMWNVMYNMTGGGKVVQPCPEDNPD 694

Query: 735 RLLLNAKYKIFLDMAATQQKYRKLVDEVK 763
           R LL+ KYKIFLDMA TQ+KYR LV+EV+
Sbjct: 695 RKLLDVKYKIFLDMAETQRKYRNLVNEVE 723

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  938 bits (2425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/748 (62%), Positives = 540/748 (72%), Gaps = 56/748 (7%)

Query: 23  MSGLSLQNERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQE 82
           M+ +SL  E+ M+YYVGVDVGTGSARAC+IDN GNILSLAE+PIQR ELKPNYITQSSQE
Sbjct: 23  MAAISL--EQAMIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQE 80

Query: 83  IWNAICYCVKNVVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXXPDFTDNLQNIILW 142
           IW +IC+CVK+VVRDSGV    IHGIGFDATCSL             P F +N QNI+LW
Sbjct: 81  IWQSICHCVKSVVRDSGVPVERIHGIGFDATCSLVVVDDEDKEVGVGPVFANNDQNIVLW 140

Query: 143 MDHRAIEETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYL 202
           MDHRAI ET EINAT DKCLKYVGGQMSVEMEIPKIKWLKNN+P+++F +CKFFDLADYL
Sbjct: 141 MDHRAIAETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYL 200

Query: 203 TFKATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAK------- 255
           TFKAT  + RS+CSTVCKQGL+P+GVEGSK GWSK+FL  I L EL+ + F +       
Sbjct: 201 TFKATNKDTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATA 260

Query: 256 LGGSVTETTFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIP 315
                T  +FLSAGE +G L EE+A ELGL  HCVVGSGVIDAYAGWVGTVAA+TDVE+P
Sbjct: 261 TAADGTTHSFLSAGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELP 320

Query: 316 ALVKSDEVKHGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGG 375
            L ++D  K GIDRATGRLAAVAGTSTCHIA+S+DP+FV GVWGPYRDVMA GFW AEGG
Sbjct: 321 DLAEADRTKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGG 380

Query: 376 QSCTGALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLF 435
           QSCTGALLAHV++THPA+ ELS LSDAAN+SKFDYLNSRLE L QQR   SVVALAKHL+
Sbjct: 381 QSCTGALLAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLY 440

Query: 436 FYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGH 495
           FYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDL+IMYLGACEFIAQQTRQIVE+MC++GH
Sbjct: 441 FYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGH 500

Query: 496 ELAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNACAKL 555
           +++ IFMSGGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGAVASESFN     
Sbjct: 501 QISTIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFN----- 555

Query: 556 EETASDPATTSNKDVSIRRKSSLSRKDAXXXXXXXXXXXXXXXXXXXXXXXNTLKPLTSF 615
                  +  +  +++ RRKSSL+  D                            PL+  
Sbjct: 556 -------SHHAKSEITRRRKSSLTNLDPSSLPSASGKG-----------------PLSQL 591

Query: 616 AKAQKKTNDLKFADMXXXXXXXXXXXXXXXXXXXGGYPFPVMASXXXXXXXXXXXXXXXX 675
            K +    DL                        G +PFPV+                  
Sbjct: 592 GKMKP---DLP----SPYTAPHATSSTSQIAATSGSFPFPVVGESSEAITEEANDSEGPV 644

Query: 676 SLLTFDAKTEKSKEAATSAANHNNAKVLRDVTKDKLWEVMYNMTGGGKVVWPTEEDAPDR 735
           S   F      S+E   +    NN         D LW+VMY MTGGGKVV P+ ED PDR
Sbjct: 645 S---FKPTRATSQEGLATRNPPNNG--------DALWDVMYQMTGGGKVVRPSPEDDPDR 693

Query: 736 LLLNAKYKIFLDMAATQQKYRKLVDEVK 763
           +LLNAKYKIFLDMA +Q++YR+ +D+V+
Sbjct: 694 VLLNAKYKIFLDMADSQRRYREAIDKVE 721

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  898 bits (2321), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/754 (61%), Positives = 534/754 (70%), Gaps = 67/754 (8%)

Query: 23  MSGLSLQNERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQE 82
           M GLSL  E++M+YY+GVDVGTGSARAC+ID++GNI+SLAE+PIQR ELKP YITQSS+E
Sbjct: 22  MLGLSL--EQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKE 79

Query: 83  IWNAICYCVKNVVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIIL 141
           IW+AICYCVK VVRDSGVD   IHGIGFDATCSL              PDF +  QNIIL
Sbjct: 80  IWSAICYCVKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIIL 139

Query: 142 WMDHRAIEETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADY 201
           WMDHRA++ET EIN+T    LKYVGGQMS+EMEIPKIKWLKN++P +KF    FFDLAD+
Sbjct: 140 WMDHRAVQETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADF 199

Query: 202 LTFKATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVT 261
           LT+KATG   RS+ S+VCKQGLLPLGVEGS NGWS EFL  I L EL+A+DFAKLGGSV 
Sbjct: 200 LTYKATGLGTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVK 259

Query: 262 ------ETTFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIP 315
                  + FLSAG+ +G L+ E+AA+LGL+ HCVVGSGVIDAYAGWVGTVAA+TD EIP
Sbjct: 260 PKGDDHRSNFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIP 319

Query: 316 ALVKSDEVKHGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGG 375
            L K ++ K G+D+ATGRLAAVAGTSTCH+A+S+DPIFV GVWGPYRDVMAPGFW AEGG
Sbjct: 320 ELAKCEKGKLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGG 379

Query: 376 QSCTGALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLF 435
           QSCTGALLAHVL+THPAY +L  LS++A +SKFDYLNSRLE L   RK  SVVALAKHLF
Sbjct: 380 QSCTGALLAHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLF 439

Query: 436 FYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGH 495
           FYGDYHGNRSPIAD +MRAAIIGQSMDNS+DDL++ YLGACEFIAQQTRQIVE MC SGH
Sbjct: 440 FYGDYHGNRSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGH 499

Query: 496 ELAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNACAKL 555
            +++IFMSGGQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGAVASES+N     
Sbjct: 500 NISSIFMSGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYN----- 554

Query: 556 EETASDPATTSNKDVSIRRKSSLSRKDAXXXXXXXXXXXXXXXXXXXXXXXNTLKPLTSF 615
                  A  +  D+  RR SSL  KD                          L  L+  
Sbjct: 555 -------AHHTKTDLRKRRASSLGSKD----------------QAIAGLGKGGLSKLSEL 591

Query: 616 AKAQKKTNDLKFADMXXXXXXXXXXXXXXXXXXXGGYPFPVMASXXXXXXXXXXXXXXXX 675
              Q        A                     GG  FP++ S                
Sbjct: 592 QTDQPSPYTAPHA--------------TSSSHMGGGSYFPIVGSDAAANLSPGEAI---- 633

Query: 676 SLLTFDAKTEKSKEAAT-----SAANHNNA-KVLRDVTKDKLWEVMYNMTGGGKVVWPTE 729
                 A+TE  +E  T     S    N A K   +   ++LW+VMY+MTGGGKVV P  
Sbjct: 634 ------AETEDEEEPVTFKSVKSTTQENLAEKTDTNSNGEELWKVMYDMTGGGKVVRPNP 687

Query: 730 EDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763
           +  PDR+LLNAKYKIFLDMA TQ++YR  +D V+
Sbjct: 688 DTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVE 721

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/558 (67%), Positives = 448/558 (80%), Gaps = 16/558 (2%)

Query: 27  SLQNERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNA 86
           SLQ+ ++  ++VGVDVGTGS RAC+ID  G ILSLAE+PI+R E++ N+ITQSS+EIW+A
Sbjct: 35  SLQDSQEK-FHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDA 93

Query: 87  ICYCVKNVVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIILWMDH 145
           +C+CVK V+++S VDP+ +HGIGFDATCSL              PDF++N QNIILWMDH
Sbjct: 94  VCHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDH 153

Query: 146 RAIEETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFK 205
           RA++ETEEIN+TGDKCLKYVGGQMSVEM+IPKIKWLKNN+  + F  CKFF+L DYLTFK
Sbjct: 154 RAMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFK 213

Query: 206 ATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTET-T 264
           ATG E RS+ S VCKQG LP GVE SK GWS+EFL  IGL EL  +DF +LGGS+ +   
Sbjct: 214 ATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKKN 273

Query: 265 FLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVK 324
           FLSAGEC+G L   SA ELGL+ HC+VGSG+IDAYAGWVGTVAA+    IP L +++  K
Sbjct: 274 FLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEK 333

Query: 325 HGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLA 384
           + I+ A GRLAAVAGTSTCHI +SKDPIFV GVWGPYRDV+A  FW AEGGQSCTGALLA
Sbjct: 334 NDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLA 393

Query: 385 HVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNR 444
           HV+ THPA+ ELSQL+DAA++S F+YLNS LE L Q+R   SVV+LAKH FFYGDYHGNR
Sbjct: 394 HVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNR 453

Query: 445 SPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSG 504
           SPIADP+MRA IIGQSMDNS++DL++ YLGACEFI+QQTRQI+E M  +GH + AIFMSG
Sbjct: 454 SPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSG 513

Query: 505 GQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNACAKLEETASDPAT 564
           GQCRNGLLMRLLADCTGLPI+IPRYIDAAVVFGSALLGA ASE           ASD A 
Sbjct: 514 GQCRNGLLMRLLADCTGLPIMIPRYIDAAVVFGSALLGAAASE-----------ASDLA- 561

Query: 565 TSNKDVSIRRKSSLSRKD 582
            + K +   R+SSLS+K+
Sbjct: 562 -NEKTICQTRRSSLSQKE 578

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 11/90 (12%)

Query: 685 EKSKEAATSAANHNN-----AKVLRDVTKDK------LWEVMYNMTGGGKVVWPTEEDAP 733
           E+      SA N N+     + V R + K++      LW+VM  +TG  KVV P ++  P
Sbjct: 628 ERQLHVVVSARNRNDKDTSTSTVTRGLQKERCNSGDLLWKVMQELTGEAKVVNPNDKTHP 687

Query: 734 DRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763
           DR+LL+ KY+IFLDMA  Q+KYR +VD V+
Sbjct: 688 DRILLDTKYQIFLDMAENQRKYRNMVDRVE 717

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/517 (70%), Positives = 425/517 (82%), Gaps = 2/517 (0%)

Query: 36  YYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVV 95
           +YVGVDVGTGSARACVID  GN+LSLAE+PI+R +L  N+ITQSS+EIWNA+CYCV+ VV
Sbjct: 39  FYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVV 98

Query: 96  RDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIILWMDHRAIEETEEI 154
            +SGVDP  + GIGFDATCSL              PDFT+N QNIILWMDHRA++ETEEI
Sbjct: 99  EESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEI 158

Query: 155 NATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSY 214
           N++GDKCLKYVGGQMSVEMEIPKIKWLKNN+    F  CKFFDL DYLTFKATG E RS+
Sbjct: 159 NSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSF 218

Query: 215 CSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTET-TFLSAGECIG 273
           CS VCKQG LP+GVEGS  GWSKEFL  IGL EL  +DF +LGGS+ E   FL+AGECI 
Sbjct: 219 CSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGECIS 278

Query: 274 TLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATGR 333
            L +++A +LGL+ HCVV SG+IDAYAGWVGTVAA+ +  +  L +++  K   + A GR
Sbjct: 279 PLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAIGR 338

Query: 334 LAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPAY 393
           LAAVAGTSTCHI +SK+PIFV GVWGPYRDV+A GFW AEGGQSCTG LL H++TTHPA+
Sbjct: 339 LAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHPAF 398

Query: 394 AELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPSMR 453
            ELS +++ A VSKF+YLN  LE L ++RK  SV++LAKHLFFYGDYHGNRSPIADP+MR
Sbjct: 399 TELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPNMR 458

Query: 454 AAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLLM 513
           A IIGQSMDNSI+DL++MYL ACEFI+QQTRQI+E M  SGHE+ AIFMSGGQCRN LLM
Sbjct: 459 ACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSLLM 518

Query: 514 RLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFN 550
           RLLADCTGLPIVIPRY+DAAVVFGSALLGA ASE F+
Sbjct: 519 RLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFD 555

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 42/53 (79%)

Query: 711 LWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763
           LW+VM  +TG  ++V P E+  PDR+LL+ KY+IFLDM  TQ+KYR++VD+V+
Sbjct: 658 LWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVE 710

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  783 bits (2023), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/524 (70%), Positives = 430/524 (82%), Gaps = 2/524 (0%)

Query: 29  QNERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAIC 88
           Q+E +  +YVGVDVGTGS RAC+ID  GNILSLAE+PI+R EL  N+ITQSS+EIWNA+C
Sbjct: 23  QHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVC 82

Query: 89  YCVKNVVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIILWMDHRA 147
           YCV+ V++++GVDP  IHGIGFDATCSL              PDFT+N QNIILWMDHRA
Sbjct: 83  YCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRA 142

Query: 148 IEETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKAT 207
           ++ETEEIN +G+ CLKYVGGQMSVEMEIPKIKWLKNN+    F  CKFFDL DYLTF+AT
Sbjct: 143 MKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRAT 202

Query: 208 GSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSV-TETTFL 266
           G E RS+ S VCKQG LP GVEGS  GWSK+FL  IGL EL  +DF KLGGS+  +  FL
Sbjct: 203 GKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNFL 262

Query: 267 SAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHG 326
           SAGECIG L  ++A +LGL+ +CVV SG+IDAYAGWVGTVAA+ + EI  L ++++ KH 
Sbjct: 263 SAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHD 322

Query: 327 IDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHV 386
            + A GRLAAVAGTSTCHI +SK  IFV G+WGPYRDV+A GFW AEGGQSCTG LL HV
Sbjct: 323 FNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHV 382

Query: 387 LTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSP 446
           +TTHPA+++LSQL+DAANVSKF+YLNS LE L ++RK  SV+ LAKHLFFYGDY GNRSP
Sbjct: 383 ITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSP 442

Query: 447 IADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQ 506
           IADP+MRA IIGQSMDNSIDDL+++YLGACEFI+QQTRQI+E M  SGH + A+FMSGGQ
Sbjct: 443 IADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQ 502

Query: 507 CRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFN 550
           CRNGLLMRLLADCTGLPIVIPRYID AVVFGSALLGA AS+ F+
Sbjct: 503 CRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFD 546

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 54/83 (65%)

Query: 681 DAKTEKSKEAATSAANHNNAKVLRDVTKDKLWEVMYNMTGGGKVVWPTEEDAPDRLLLNA 740
           D  ++KS +  +      N +  RD+ K+ LW+VM  +TG  KV+ P  +  PDR+LL+ 
Sbjct: 617 DMISDKSSKGISLDKGRENLEEERDIDKNILWKVMQELTGNAKVICPNTKTHPDRILLDT 676

Query: 741 KYKIFLDMAATQQKYRKLVDEVK 763
           KY+IFLDM  TQ+ YR++VD+V+
Sbjct: 677 KYQIFLDMVETQRNYRRMVDKVE 699

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/539 (67%), Positives = 434/539 (80%), Gaps = 3/539 (0%)

Query: 36  YYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVV 95
           +YVGVDVGTGSARAC+ID  GN+LSLAE+PI+R EL+PN+ITQSS+EIW+A+C+CVK V+
Sbjct: 39  FYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVI 98

Query: 96  RDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIILWMDHRAIEETEEI 154
           ++S VDP  +HG+GFDATCSL              PDFT N QNIILWMDHRA++ETEEI
Sbjct: 99  QESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEI 158

Query: 155 NATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSY 214
           N++ DKCLKYVGGQMSVEMEIPKIKWLKNN+  + F  CKFFDL DYLTFKATG E RS+
Sbjct: 159 NSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSF 218

Query: 215 CSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVT-ETTFLSAGECIG 273
            S VCKQG LP GVEGS  GWS+EFL  IGL ELI  DF KLGGS+  +  FLSAGECIG
Sbjct: 219 SSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKKNFLSAGECIG 278

Query: 274 TLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATGR 333
           +L  ++A ELGL+ +CVV SG+IDAYAGWVGTVAA+ +  I  L ++++  +  + A GR
Sbjct: 279 SLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAIGR 338

Query: 334 LAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPAY 393
           LAAVAGTSTCHI +SKDPIFV G+WGPYRDV+A GFW AEGGQSCTG LL HV+  HPAY
Sbjct: 339 LAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHPAY 398

Query: 394 AELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPSMR 453
            ELSQL++AA VSKF+YLNS LE + ++R   SV++LA+HLFFYGDYHGNRSPIAD +MR
Sbjct: 399 TELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSNMR 458

Query: 454 AAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLLM 513
           A IIGQSMDNS++DL+I YL ACEFI+QQTRQIVE M  SGH++ AIFMSGGQCRN LL 
Sbjct: 459 ACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDLLT 518

Query: 514 RLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNACAKLEETASDPATTSNKDVSI 572
           RLLADC+GLPIVIPRYID AVVFGSALLGA ASE+F+  AK   T +   ++S ++  I
Sbjct: 519 RLLADCSGLPIVIPRYIDGAVVFGSALLGAAASEAFD-LAKGRRTLTTKKSSSAQEFFI 576

 Score = 67.4 bits (163), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 39/53 (73%)

Query: 711 LWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763
           LW+VM  +TG  K V P +   PDR+LL+ KY+IFLDMA TQ++YR +VD ++
Sbjct: 657 LWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLE 709

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  695 bits (1794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/522 (62%), Positives = 404/522 (77%), Gaps = 6/522 (1%)

Query: 34  MVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKN 93
           M +Y+GVDVGTGS RACVI++ G ILSL  + I + ELKPNYITQSS+EIW  IC CV  
Sbjct: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60

Query: 94  VVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIILWMDHRAIEETE 152
           V+++S + P ++ GIGFDATCSL              P+F D+ +NIILWMDHRA++ET+
Sbjct: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120

Query: 153 EINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIR 212
           EINATGDKCLKYVGG+MSVEME+PKIKWLKNN+ +  F+ CKFFDL DYLT+KAT  ++R
Sbjct: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180

Query: 213 SYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSV----TETTFLSA 268
           S+ STVCKQGLLPLGVEGS  GWSKEF  +I L+EL +D+F+ +GGS+     E    S 
Sbjct: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV 240

Query: 269 GECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGID 328
           GE +G L+E SA ELGL T C+VGSG+IDAYAGWVGTVAA+ + EI  +   D+    +D
Sbjct: 241 GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVE-EIGTINNDDDASSKLD 299

Query: 329 RATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLT 388
            + G LA +AGTSTCHI +S  PIFV G+WGPYRDV++  FW AEGGQSCTGALL H+LT
Sbjct: 300 SSIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILT 359

Query: 389 THPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIA 448
           THPAY EL +  +  +V  F++LN+RL  L ++  A S+++L KH F YGDYHGNRSPI+
Sbjct: 360 THPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPIS 419

Query: 449 DPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCR 508
           D SMRAAIIGQSMD SID L+IMYL ACEFI+QQ+RQI+ ++  +GH +  I+MSGGQ R
Sbjct: 420 DESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQAR 479

Query: 509 NGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFN 550
           N LLMRLLADCTGLP+VIPRYIDA+V+FGSA+LGAVA +++N
Sbjct: 480 NQLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYN 521

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 39/53 (73%)

Query: 711 LWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763
           LW  M  +T  G V+ P   + PDR+LLNAKYKIFLDMA TQ+KYR+ +DE++
Sbjct: 537 LWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIE 589

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/524 (61%), Positives = 408/524 (77%), Gaps = 10/524 (1%)

Query: 31  ERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYC 90
           E+ + YY+GVDVGTGS RAC+ID+LG I S AE  I R ELK + ITQSSQEIW A+C+C
Sbjct: 2   EKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFC 61

Query: 91  VKNVVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIILWMDHRAIE 149
           VK VV + G     + GIGFDATCSL              PDF D+ Q+IILWMDHRA++
Sbjct: 62  VKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALK 121

Query: 150 ETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGS 209
           ET+EIN+T D+CLKYVGGQMS+EME+PKIKWLK ++ +  FA+C+F+DLADYLTFKATG 
Sbjct: 122 ETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGR 181

Query: 210 EIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTET---TFL 266
           + RS+CS VCKQG++P+GVEGSK GWSK+FL+ I LEEL  +D+AKLGGSV+ +    FL
Sbjct: 182 KTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFL 241

Query: 267 SAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHG 326
           +AGE I  L +++  EL LS  C+VGSG+IDAYAGW+GTV + T V++  L +      G
Sbjct: 242 TAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGT-VDLEQLFRV-----G 295

Query: 327 IDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHV 386
           +  A GRLAAVAGTSTCHI +SKDPIFV GVWGPY+D +  G+W  EGGQSCTGALL HV
Sbjct: 296 MANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHV 355

Query: 387 LTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSP 446
           L THP+Y EL ++S+   ++KFDYLN+RL  +A++    SV+ LAKH+FFYGD HGNRSP
Sbjct: 356 LQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSP 415

Query: 447 IADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQ 506
           +ADPSM+ AI+G SMD S+D+L+  YL ACEFIAQQ RQI+E MC++GHE++AI+MSGGQ
Sbjct: 416 LADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQ 475

Query: 507 CRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFN 550
           CRN LLM+LLADC+GL ++IP YID+AVVFG+A+LGA AS+ + 
Sbjct: 476 CRNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQ 519

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 40/57 (70%)

Query: 707 TKDKLWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763
           T++ LW  M  MT  G  + P  +D PDR+LL+AKYKIFLDMA  Q++YR +VD V+
Sbjct: 531 TENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVE 587

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/517 (62%), Positives = 407/517 (78%), Gaps = 11/517 (2%)

Query: 36  YYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVV 95
           +Y+GVDVGT S RACV+D  G ILSLA +PI R E++PNY+TQSS EIW AIC+C++ ++
Sbjct: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63

Query: 96  RDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIILWMDHRAIEETEEI 154
            DS V   +I GIGFDATCSL              P+F D  Q+IILWMDHRAI+E  EI
Sbjct: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123

Query: 155 NATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSY 214
           N+TG +CLKYVGG+MS+EM+IPKIKWLKNN+P+ KF +C+F+DL D+LT++ATG++ RS+
Sbjct: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183

Query: 215 CSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTET--TFLSAGECI 272
           CSTVCK GLLPLGV+GS  GW ++  ++IGL EL   +F+KLGG V+ T   FLSAG+ +
Sbjct: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGDYV 243

Query: 273 GTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATG 332
           G L++E+AA+LGL+T C+V SG+IDAYAGWVGT+AA   + + +  +  E+      A+ 
Sbjct: 244 GHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAA--GITLGSDGQESEL------ASS 295

Query: 333 RLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPA 392
           RLA VAGTSTCHI +SK P F+ GVWGPYRD + PG+W+ EGGQSCTGALLAHVL +HPA
Sbjct: 296 RLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPA 355

Query: 393 YAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPSM 452
           Y  L +L+    +SKFD++N+RLE L ++R A SV AL KHLFFYGDYHGNRSPIADP+M
Sbjct: 356 YDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNM 415

Query: 453 RAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLL 512
           RA IIGQSMD S+DDL+IM LGACEFIAQQTRQIVE +  SGHE+ +I+MSGGQCRN +L
Sbjct: 416 RATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVL 475

Query: 513 MRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESF 549
           ++LLA+CT LPIV+P+YIDAAVVFGSALLG  ASE +
Sbjct: 476 IKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY 512

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 34/49 (69%)

Query: 711 LWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLV 759
           LW VM N+TG G+++ P+     +  LL+ KY+IFLDM  TQ++YR LV
Sbjct: 542 LWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLV 590

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/522 (60%), Positives = 391/522 (74%), Gaps = 8/522 (1%)

Query: 34  MVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKN 93
           M YY+GVDVGTGSARAC+ID  G+ILS+ E  I R ELKP YITQS+ +IWN IC C++N
Sbjct: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRN 60

Query: 94  VVRDSGVD--PRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIILWMDHRAIEE 150
           ++++S VD     I GIGFDATCSL              P+F DN QN+ILWMDHRA+ E
Sbjct: 61  ILQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120

Query: 151 TEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSE 210
           T EIN+T  KCLKYVGGQMSVEMEIPKIKWLKNN+    +  CKF DL D+LT+KATG+ 
Sbjct: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180

Query: 211 IRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTE-----TTF 265
           IRS+CS VCKQGLLPLGVEGS  GW++EFL  IGLE+L+ D+F KLGG V +      +F
Sbjct: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240

Query: 266 LSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKH 325
            +AGE IG L+++S+  +G+S+ C V SG+IDAYAGW+GT+AA T   I  L    +  +
Sbjct: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300

Query: 326 GIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAH 385
           G+  ++GRLA VAGTSTCHI+++  PIFV GVWGPYRDV+   FW AEGGQSCTGALL H
Sbjct: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360

Query: 386 VLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRS 445
           VL THPAY EL  +S   ++S F+ LN+++  L  QR     V L K+LFFYGD+HGNRS
Sbjct: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420

Query: 446 PIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGG 505
           P+AD +MR  IIG SMD+S++DL  MYLGACEFIAQQTR IV+ M  SG+ L +++MSGG
Sbjct: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480

Query: 506 QCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 547
           QCRN LLM+L+++C GLP+VIP+ ID AVVFGSAL+GA ASE
Sbjct: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASE 522

 Score = 54.3 bits (129), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%)

Query: 711 LWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVD 760
           LW+VM  MTG G VV P +  +    LL  KY+I+LDM ATQ++YR +V+
Sbjct: 538 LWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/517 (59%), Positives = 392/517 (75%), Gaps = 7/517 (1%)

Query: 36  YYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVV 95
           YYVG+DVGTGS RACV+D+ GN+LSL E+ I R ELKPN+ITQS++EIW A C+CVK  +
Sbjct: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75

Query: 96  RDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIILWMDHRAIEETEEI 154
               VD   + GIGFDATCSL              P+F +   N+ILWMDHRA++E  EI
Sbjct: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135

Query: 155 NATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSY 214
           NAT DKCLKYVGG MSVEM+IPKIKWLKNN+    F +C+FF+LADYLTFKATG   RS+
Sbjct: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195

Query: 215 CSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSV---TETTFLSAGEC 271
           CS VCKQG LP GVEGS  GWSKEFL  IGLE+L  + +  LGG++   ++  F S+G+C
Sbjct: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQSSGKC 255

Query: 272 IGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRAT 331
           +G L+ E+  ELGLS +CVVG+G+IDAYAG +GT+AA +  E    +K+D    G+  A 
Sbjct: 256 LGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATS--EGSHQIKNDS-SIGLQNAI 312

Query: 332 GRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHP 391
           GRLA+VAGTSTCH+ +SKDP+FV GVWGPYRDV+A G+W AEGGQ+CTG LL++VL+ HP
Sbjct: 313 GRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHP 372

Query: 392 AYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPS 451
           A+ EL   S  A + KF YLN+ L+ L  + K +S + LAKH+FFYGDY GNRSP ADP 
Sbjct: 373 AFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPM 432

Query: 452 MRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGL 511
           M AAIIGQSM++++++L++ YL ACEFIAQQTRQIVE +  +G  ++ I+MSGGQCRN L
Sbjct: 433 MSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKL 492

Query: 512 LMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 548
           LM+LL+DCTGLPI++P+Y+DAAVVFG+A+LGA A  S
Sbjct: 493 LMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADAS 529

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/52 (53%), Positives = 39/52 (75%)

Query: 711 LWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEV 762
           LWE M  MT  G ++ P + + PDR LL+ KY+IFLDMA TQ+KYR++VD++
Sbjct: 543 LWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDI 594

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/555 (56%), Positives = 395/555 (71%), Gaps = 26/555 (4%)

Query: 36  YYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVV 95
           YY+GVDVGTGSARA ++ + G  L+L E PI+R EL+ ++ITQSS EIW+A+C+CV+ VV
Sbjct: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65

Query: 96  RDSGVDPRTIHGIGFDATCSLXXXXXXXX-XXXXXPDFTDNLQNIILWMDHRAIEETEEI 154
             SGV+PR + GIGFDATCSL              P+F D+ QNIILWMDHRA  ET+ I
Sbjct: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125

Query: 155 NATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSY 214
           NATGD+CLKYVGGQMSVEME+PKIKWLK ++P  +F +CKFFDL DYLTF AT  + RS+
Sbjct: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185

Query: 215 CSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGG-SVTETTFLSAGECIG 273
           CS VCKQGLLP GV+GS+  WS EFL+ +GL ELI  +F +LGG S ++  FL+AG+ +G
Sbjct: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAGQPVG 245

Query: 274 TLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATGR 333
            LT E++ + GLST C+V SGVIDAYAGW+G+V A+ D              G+D A  R
Sbjct: 246 QLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFD--------QSHKSSGLDVAITR 297

Query: 334 LAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPAY 393
           LA +AGTSTCHI +SK P FV GVWGPYRDV+ PG+W AEGGQSCTGALLAH+L THPA+
Sbjct: 298 LALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAH 357

Query: 394 AELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPSMR 453
            EL +L+    VS F+YL   L+ L  +R+  +V+ L++  F YGD+HGNRSP+ADPSMR
Sbjct: 358 EELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMR 417

Query: 454 AAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLLM 513
           A +IGQSMD SI+ L++ YL ACEFIA QTRQIVE M  +GH +  ++MSGGQCRN LLM
Sbjct: 418 ATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLM 477

Query: 514 RLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNACAKLEE----------TASDPA 563
           +L+AD  G+P+V+P+Y D  VVFG+ALL   AS+    C  +E           TA  P 
Sbjct: 478 QLIADSVGVPVVLPKYTDCCVVFGAALLACCASK---GCDGIEADQSTRLWDIMTAMTPM 534

Query: 564 TT---SNKDVSIRRK 575
            T    N D S  RK
Sbjct: 535 GTRVLPNDDSSFERK 549

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%)

Query: 710 KLWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEV 762
           +LW++M  MT  G  V P ++ + +R  ++AKY IFLDM   Q+ YR  +D+V
Sbjct: 523 RLWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/519 (58%), Positives = 385/519 (74%), Gaps = 4/519 (0%)

Query: 36  YYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVV 95
           +++GVDVGTGS RACVID  G+IL+L ++PI R ELKP +ITQSS+EIW++IC+CV+ V+
Sbjct: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79

Query: 96  RDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIILWMDHRAIEETEEI 154
            D+ +    + GIGFDATCSL              P F+ N QNII+WMDHRA +ET+EI
Sbjct: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139

Query: 155 NATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSY 214
           N+  D  LKYVGG+MS+EME+PKIKWLKN++P + F +  FFDL DYLTFKATG + RS 
Sbjct: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199

Query: 215 CSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTET-TFLSAGECIG 273
           CS VCKQGLLP+GVEGS  GWS+ FL   GL ELI ++F ++GG    +  FLSAGE + 
Sbjct: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSRNFLSAGEYVS 259

Query: 274 TLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATGR 333
           TL++ S  +LGL+  CVVGSG+IDAYAG +GT+AAR D    A  + D     +  A GR
Sbjct: 260 TLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDES--ARTQDDANGQDLQNAIGR 317

Query: 334 LAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPAY 393
           LAAVAGTSTCHI +S  PIFV GVWGPY+D++A  +W AEGGQSCTG LL HV+TTHPAY
Sbjct: 318 LAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAY 377

Query: 394 AELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPSMR 453
            EL   +  + +  F+ LN  +  LA+Q+   +++ L K LF YGDYHGNRSPIADP MR
Sbjct: 378 EELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMR 437

Query: 454 AAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLLM 513
           A+IIGQSMD +++ L+++YL ACEFIA QTR I+ +M  +GH + +I+MSGGQCRN +LM
Sbjct: 438 ASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILM 497

Query: 514 RLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNAC 552
            LLAD TGLP+VIP+YIDAAVVFG+AL+GA A + FN C
Sbjct: 498 ELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQC 536

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (62%)

Query: 711 LWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDE 761
           LW  M  MTG G  + P       + LLN KYKI++DMA TQ+KYR L+D+
Sbjct: 550 LWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/516 (58%), Positives = 379/516 (73%), Gaps = 6/516 (1%)

Query: 34  MVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKN 93
           M YY+GVDVG+GS RACV+D+ G +LS+A R I + E  P ++TQSS EIW+A+CYCVK+
Sbjct: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60

Query: 94  VVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIILWMDHRAIEETE 152
            + +S V+   I GIGFDATCSL              P+F +N QNII+WMDHRAIEET+
Sbjct: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120

Query: 153 EINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIR 212
           EIN +GD CLKYVGGQMSVEMEIPKIKWLKN++  ++F +  F DL DYLTF A+G   R
Sbjct: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180

Query: 213 SYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTETTFLSAGECI 272
           SYCS VCKQG LP GVEGS  GWS EFL +IGLEE+   +F  LGG      F  AG  +
Sbjct: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESGNFTYAGNQL 240

Query: 273 GTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATG 332
            T++E       ++  C+VGSG+IDAYAGW+GTVA+ T +E+P    + EV   I+   G
Sbjct: 241 STVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASST-IEVP---NNKEVVD-IEECAG 295

Query: 333 RLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPA 392
           RLAAVAGTSTCHI +SK  IFV GVWGPYRDV+ P +W AEGGQS TGALLAH+L+ HP+
Sbjct: 296 RLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPS 355

Query: 393 YAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPSM 452
             ELS L    NV KF +LN+ +  L+++    + + L K  F YGDYHGNRSPIADP+M
Sbjct: 356 ANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNM 415

Query: 453 RAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLL 512
           RAAIIGQSMD S+DDL+  YL ACEFIA QT+ I++ + N+GH + AI+MSGGQCRN +L
Sbjct: 416 RAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNIL 475

Query: 513 MRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASES 548
           M+L+A+CTGLP++IP+YID+AVVFGSA+LGA+A  S
Sbjct: 476 MQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSS 511

 Score = 67.0 bits (162), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 30/52 (57%), Positives = 37/52 (71%)

Query: 709 DKLWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVD 760
           D LW  M NMT  G  V+P  ED+ +R L+N K+KIFLDMA TQQ YR+LV+
Sbjct: 522 DLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVE 573

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/535 (55%), Positives = 376/535 (70%), Gaps = 11/535 (2%)

Query: 36  YYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVV 95
           YYVGVDVGT  ARAC+ID  G IL+  + PI R + K ++ITQSS EIW A+C  V+  V
Sbjct: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68

Query: 96  RDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIILWMDHRAIEETEEI 154
            +S V    + GI FDATCSL              PDF+DN QN+ILWMDHRA+ E  EI
Sbjct: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128

Query: 155 NATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSY 214
           N+TG   L+YVGG+MSVEM++PKIKWL+ ++P  +FA+CKF+DL D+LT++ATG E RS+
Sbjct: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188

Query: 215 CSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTE--TTFLSAGECI 272
           CSTVCK GL+P GV+ S +GWS+EFL++IGLEEL  D F +LGG++ E  + F SAGE +
Sbjct: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGEPV 248

Query: 273 GTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATG 332
           G L+E +AA LGL+  CVVGSGVIDAYAGWVGTV A  D              G++   G
Sbjct: 249 GLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPD--------GARESGGVEELAG 300

Query: 333 RLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPA 392
           RLAAVAGTSTC I +S+ P FV+GVWGPYRDV+A G+W  EGGQSCTGALLAH L THPA
Sbjct: 301 RLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPA 360

Query: 393 YAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPSM 452
           Y EL Q +    ++ FDY+N RL+ L  +  A S+ ALAKH F YGDYHGNRSP+ADPSM
Sbjct: 361 YTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSM 420

Query: 453 RAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLL 512
           RAA++G SMD S DDL++  L A EFIA Q R I++ M  +G  +  +++SGGQ RN LL
Sbjct: 421 RAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLL 480

Query: 513 MRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNACAKLEETASDPATTSN 567
            +LLAD    P+V PR++ AAVVFGSALL A A E++ A      ++  P++ S 
Sbjct: 481 TQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASR 535

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 39/54 (72%)

Query: 710 KLWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763
           +LW++M  +T  G VV P+ +  PD  LL AKYK+FL+MA  Q+ YRKLVD+V+
Sbjct: 540 RLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVE 593

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/517 (55%), Positives = 372/517 (71%), Gaps = 5/517 (0%)

Query: 34  MVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKN 93
           M  Y+GVDVGTGSARAC+ +  G IL++  + I + EL+  +ITQSS EIW+AI   +K 
Sbjct: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60

Query: 94  VVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXX-PDFTDNLQNIILWMDHRAIEETE 152
           V+  S VDP +I GI FDATCSL              P+F D+ QNIILWMDHRA  ET+
Sbjct: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120

Query: 153 EINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIR 212
            IN+T DK LKYVGG+MSVE E+PKIKWLK+++  + F +C F DLAD+LT+KATG  + 
Sbjct: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180

Query: 213 SYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVT--ETTFLSAGE 270
           S+ S VCKQGLLP GVEGSK GWSKEFL++IGLEEL  ++F KLGGS+   E  FL  G+
Sbjct: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGD 240

Query: 271 CIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRA 330
            +G + ++ A    L  HCVVG+GVIDAY+GWVGTVA  +DV       S +  + I+ +
Sbjct: 241 LVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVA--SDVSDRVCSDSPQELNKIEGS 298

Query: 331 TGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTH 390
            GR+A V+GTSTCHI +SK P+F+ GVWGPYRDV+A   W  EGGQS TGALL +++ TH
Sbjct: 299 LGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETH 358

Query: 391 PAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADP 450
           PAY EL +++   N + F YL+ +LE L   RK  SV  L K++F YGDY+GNRSP+ADP
Sbjct: 359 PAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADP 418

Query: 451 SMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNG 510
            M   IIGQ+MD+SI+DL+I YL ACEFIA QTR I++ +   GH + AI+MSGG C+N 
Sbjct: 419 LMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNK 478

Query: 511 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 547
           LLM L+++C  LP+V+ +YID++VVFG+A+LG+VA++
Sbjct: 479 LLMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAK 515

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%)

Query: 709 DKLWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEV 762
           D LW  M  MT  G ++ P  E +  R  L AKY+++LDM  T  KYRK ++EV
Sbjct: 530 DVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  202 bits (514), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 156/530 (29%), Positives = 248/530 (46%), Gaps = 83/530 (15%)

Query: 38  VGVDVGTGSARACVIDNLGNIL-SLAERPIQRHELKPNYITQSSQEIW------NAICYC 90
           +G+D+G+ SAR  + D   ++L ++A+ P+        Y   SS++ W        I   
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPVP-------YYHDSSKKSWKFWQKSTEIIKA 61

Query: 91  VKNVVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXXPDFTDNLQNIILWMDHRAIEE 150
           ++N  ++  +    +   G  ATCSL             P    N  N+I WMD  A++E
Sbjct: 62  LQNCFQELKITQYNVRSCGVSATCSLAIFQKDLTNGNLIP--YPNEDNVIFWMDSSAVDE 119

Query: 151 TEEINATGDKC----LKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKA 206
            E +N   +KC    L Y+GG+   EM IPK+K+  N     +  Q   FDL  Y+ ++ 
Sbjct: 120 CEWLN---EKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYEL 176

Query: 207 TGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTETTFL 266
                 +      ++ +  +G +G  +GWS  F           +D  KL  +VT     
Sbjct: 177 GRLYRWNTDELSARENINGIGNDGEASGWSSSFY----------NDIMKLPSNVT----- 221

Query: 267 SAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHG 326
                IG     S      +T C      ID+YA W         V  P L  S      
Sbjct: 222 -----IGLTGLNSNNSSSTTTVC----SCIDSYASWFA-------VSSPNLEAS------ 259

Query: 327 IDRATGRLAAVAGTSTCHIAMSKDPIF---VKGVWGPYRDVMAPG--FWLAEGGQSCTGA 381
                  L  +AGTSTC+  M   P+    + GVWGP+  ++     + +   GQSCTG 
Sbjct: 260 -------LFMIAGTSTCY--MYGSPVTTTKIPGVWGPFDTILETNGNYSVYTAGQSCTGK 310

Query: 382 LLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYH 441
           L+ H+  +HPA  ++ +  +      ++ L + ++ + +++   S+  LAKH+FFYGDY 
Sbjct: 311 LIEHLFKSHPAARKIQRSGEDI----YEVLENSIQDI-EKKNRKSIHILAKHMFFYGDYE 365

Query: 442 GNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVE--QMCNSGHELAA 499
           GNR+P AD  MR + IG+S D SI +L+  Y+   EF++ QT+ I++  Q  NSG  +  
Sbjct: 366 GNRTPFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGARIEE 425

Query: 500 IFMSGGQCRNGLLMRLLADCT-GLPIVIP-RYIDAAVVFGSALLGAVASE 547
           + +SG Q +NG L+ L++    G+ I  P   ID   V G+ +LG  A+E
Sbjct: 426 LRVSGSQAKNGRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSANE 475

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (77%)

Query: 735 RLLLNAKYKIFLDMAATQQKYRKLVDE 761
           + LL+ KY+I LDMA  QQ+Y +LVDE
Sbjct: 511 KRLLSVKYRIHLDMAKQQQQYHRLVDE 537

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  187 bits (476), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 154/526 (29%), Positives = 243/526 (46%), Gaps = 75/526 (14%)

Query: 38  VGVDVGTGSARACVIDNLGN-ILSLAERPIQRHELKPNY---ITQSSQEIWNAICYCVKN 93
           +G+DVG+ SAR  + +   + +L +A+ P+  ++          Q S EI  A+  C++ 
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPVPYYQDSSRTSWKFWQRSTEIIKALQKCLQK 93

Query: 94  VVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXXPDFTDNLQNIILWMDHRAIEETEE 153
           +     +    +   G  ATCSL             P    N  N+I WMD  AI+E ++
Sbjct: 94  L----KITEYNVKSCGVSATCSLAIFEKDKRNGSLIP--YPNEDNVIFWMDSSAIDECKQ 147

Query: 154 INAT-GDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIR 212
           +NA    + L ++GG    EM IPK+K+  N     +  Q   FDL  Y+ ++   S + 
Sbjct: 148 LNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYEL--SHLY 205

Query: 213 SYCSTVC--KQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTETTFLSAGE 270
            + + V   ++    +GV+G  +GWS  F + I                      L +  
Sbjct: 206 QWNNEVLLKRENNKMVGVDGEASGWSPSFYENI--------------------MHLPSNV 245

Query: 271 CIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRA 330
            IG+     A    +++  +V S  ID+YA W         V  P L  S          
Sbjct: 246 IIGS---NGATCKKIASSAIVRS-CIDSYASWFA-------VSSPHLETS---------- 284

Query: 331 TGRLAAVAGTSTCHIAMSKDPIF---VKGVWGPYRDVMAPG--FWLAEGGQSCTGALLAH 385
              L  +AGTSTC+  M   PI    + GVWGP+  ++     F +   GQSCTG L+ H
Sbjct: 285 ---LFMIAGTSTCY--MYGTPITDIKIPGVWGPFDSILDSNSHFSVYAAGQSCTGKLIEH 339

Query: 386 VLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRS 445
           +  THP   E+  L   A++  +  L   +  + +Q    SV    K +FFYGDY GNR+
Sbjct: 340 LFVTHPCAKEI--LKRGADI--YQVLERTIHDIEKQ-NGQSVHVFTKDIFFYGDYEGNRT 394

Query: 446 PIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVE--QMCNSGHELAAIFMS 503
           P ADP M+ + IG++ D SI +L   Y+   EF++ QTR I++  +  N G  +  + +S
Sbjct: 395 PFADPRMKGSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCIQELRIS 454

Query: 504 GGQCRNGLLMRLLADC-TGLPIVIPR-YIDAAVVFGSALLGAVASE 547
           G Q +N  L+ L++    G+ I  P+  +D   V G+ LL   A+E
Sbjct: 455 GSQAKNKRLLSLISLVNNGITINKPKDNVDLMGVRGAYLLAKSANE 500

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/28 (67%), Positives = 22/28 (78%)

Query: 735 RLLLNAKYKIFLDMAATQQKYRKLVDEV 762
           R LL AKY+I LDMA  QQ+Y KL+DEV
Sbjct: 536 RRLLWAKYRIHLDMAKQQQRYHKLIDEV 563

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  182 bits (463), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 148/528 (28%), Positives = 244/528 (46%), Gaps = 79/528 (14%)

Query: 38  VGVDVGTGSARACVIDNLGN-ILSLAERPI---QRHELKPNYITQSSQEIWNAICYCVKN 93
           +G+D+G+ SAR  +     + +L +A+ P+   Q    K     Q S EI  A+  C + 
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQDFTKKSWKFWQKSTEIIEALQKCFQK 68

Query: 94  VVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXXPDFTDNLQNIILWMDHRAIEETEE 153
           +     +    +   G  ATCSL             P   +N  N+I WMD  A +E E 
Sbjct: 69  L----KITEYNVKSCGVSATCSLAIFERVHTSEALIPYPNEN--NVIFWMDSSATDECEW 122

Query: 154 INATGDK-CLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIR 212
           +NA   K  L Y+GG+   EM IPK+K+  N    ++  +   FDL  Y+ ++       
Sbjct: 123 LNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELGRLYQW 182

Query: 213 SYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTETTFLSAGECI 272
           +    +  + +  +G +G  +GWS  F + I                      + +   I
Sbjct: 183 NIDGLLRGENINGIGNDGEASGWSSSFYKNI--------------------MNIPSNVII 222

Query: 273 GTLTEESAAELGLSTHCVVGSGV----IDAYAGWVGTVAARTDVEIPALVKSDEVKHGID 328
           G +        GL +  V+ + V    ID+YA W         V  P L +S        
Sbjct: 223 GPV--------GLVSKKVISTTVVRSCIDSYASWFA-------VSPPFLERS-------- 259

Query: 329 RATGRLAAVAGTSTCHIAMSKDPIF---VKGVWGPYRDVM--APGFWLAEGGQSCTGALL 383
                L  +AGTS+C+  M   P+    + GVWGP+ +++     F +   GQSCTG L+
Sbjct: 260 -----LFMIAGTSSCY--MYGTPVSNTKIPGVWGPFNNILDDKGDFSVYAAGQSCTGKLI 312

Query: 384 AHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGN 443
            H+  +HP   ++  L   A++  +  L   +  + +++K  S+  LAK +FFYGDY GN
Sbjct: 313 EHLFESHPCARKI--LKSGADI--YQVLEQTIHGI-EKKKGLSIHILAKDMFFYGDYEGN 367

Query: 444 RSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVE--QMCNSGHELAAIF 501
           R+P ADP M+ + IG++ D SI +L+  Y+   EF++ QT+ I++  Q   +   +  + 
Sbjct: 368 RTPFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIRIQELR 427

Query: 502 MSGGQCRNGLLMRLLADC-TGLPIVIPR-YIDAAVVFGSALLGAVASE 547
           +SG Q RN  L+ L++    G+ I  PR  +D   + G+ +L   A+E
Sbjct: 428 ISGSQARNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANE 475

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 19/26 (73%)

Query: 737 LLNAKYKIFLDMAATQQKYRKLVDEV 762
           LL  KY+I LDMA  Q+ Y KLVDEV
Sbjct: 513 LLCVKYRIHLDMAKQQKYYYKLVDEV 538

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  180 bits (456), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 144/523 (27%), Positives = 240/523 (45%), Gaps = 69/523 (13%)

Query: 38  VGVDVGTGSARACVIDNLGN-ILSLAERPI---QRHELKPNYITQSSQEIWNAICYCVKN 93
           +G+DVG+ SAR  V +   + +L +A+ P+   Q    K     Q S EI  A+  C++ 
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPVPYYQDSSKKSWKFWQKSTEIIKALQKCLQK 68

Query: 94  VVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXXPDFTDNLQNIILWMDHRAIEETEE 153
           +     +    +   G  ATCSL             P    N  N+I WMD  A+ E + 
Sbjct: 69  L----NIREYEVKSCGVSATCSLAIFERDRTSNMLIP--YPNEDNVIFWMDSSAVNECQW 122

Query: 154 INAT-GDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIR 212
           +N     + L Y+GG+   EM +PK+K+  +     +      FDL  Y+ ++ +     
Sbjct: 123 LNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQYIAYELSRLYEW 182

Query: 213 SYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVT-ETTFLSAGEC 271
           +    + ++ L  +G +G  +GWS  F + I            L  +V+  TT L A + 
Sbjct: 183 NIEGLLGRENLNGIGNDGEVSGWSSSFYKNI----------INLPSNVSIGTTSLVANKH 232

Query: 272 IGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRAT 331
           I T                V    ID+YA W    +       P L  S           
Sbjct: 233 IST---------------TVVRSCIDSYASWFAVAS-------PHLETS----------- 259

Query: 332 GRLAAVAGTSTCHI-AMSKDPIFVKGVWGPYRDVM--APGFWLAEGGQSCTGALLAHVLT 388
             L  +AGTS+C++   +     + GVWGP+  ++     F +   GQSCTG L+ H+  
Sbjct: 260 --LFMIAGTSSCYMYGTTISDTRIPGVWGPFDTILDNRGDFSVYAAGQSCTGKLIEHLFE 317

Query: 389 THPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIA 448
           +HP   ++  L D A++  +  L   +  + ++    S+  L K +FFYGDY GNR+P A
Sbjct: 318 SHPCARKI--LKDGADI--YQVLEQTIRDI-EKNNGLSIHILTKDMFFYGDYEGNRTPFA 372

Query: 449 DPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVE--QMCNSGHELAAIFMSGGQ 506
           DP ++ + IG+S D S+ +L+  Y+   EF++ QT+ I++  Q  NS   +  + +SG Q
Sbjct: 373 DPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHIKELRISGSQ 432

Query: 507 CRNGLLMRLLADC-TGLPIVIPR-YIDAAVVFGSALLGAVASE 547
            +N  L+ L++    G+ I+ P+  +D   + G+ +L   A E
Sbjct: 433 AKNERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKE 475

 Score = 38.1 bits (87), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 735 RLLLNAKYKIFLDMAATQQKYRKLVDEV 762
           R LL  KY I LDMA  Q++Y KLVDEV
Sbjct: 511 RKLLCVKYHIHLDMAKQQKRYHKLVDEV 538

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  164 bits (416), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 145/550 (26%), Positives = 227/550 (41%), Gaps = 76/550 (13%)

Query: 38  VGVDVGTGSARACVID-NLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVVR 96
           +G+D+G+   R    +      +++  R +  +E +    TQSS EI  AI  C +++  
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVECFESL-- 65

Query: 97  DSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXXPDFTDNL-----QNIILWMDHRAIEET 151
              +D   +   G  ATCSL                 ++L     QN++ WMD  AIEE 
Sbjct: 66  --NIDIWAVQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAIEEC 123

Query: 152 EEINATGDKCLKYVGGQMSVEMEIPKI-KWLKNNIPEKKFAQCKFFDLADYLTFKATGSE 210
             IN        Y GG    EM +PK+  +LK+    K  +  + FDL  Y+ +      
Sbjct: 124 SNINDLAINEKAYFGGSFIPEMGVPKLASFLKS--CSKNNSDFEVFDLHTYVAYDLANRY 181

Query: 211 IRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTETTFLSAGE 270
                  + +     +G +G   GW  EF ++                    T  L    
Sbjct: 182 GWDASFLINRPNHNGIGHDGEIKGWKDEFYEK--------------------TLKLPPNV 221

Query: 271 CIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRA 330
            IG L       +      V  +  ID Y+ W    ++  +                   
Sbjct: 222 RIGPLC------INRRFSPVKVASCIDCYSSWFSMFSSTPERS----------------- 258

Query: 331 TGRLAAVAGTSTCHIAMSKDPI-FVKGVWGPYRDVM----APGFWLAEGGQSCTGALLAH 385
              L   AGTSTC++  +  P   + G+WGP+ D++     P + + E GQS TG L+ H
Sbjct: 259 ---LFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQSTTGKLIEH 315

Query: 386 VLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRS 445
           +  +HPA     +  +      F+ L + + L+ QQ  A SV    KH+F YG+  GNR+
Sbjct: 316 LFESHPAAKPYLEDRNVL----FNRLETEINLIEQQ-SAESVHFKTKHMFNYGELQGNRT 370

Query: 446 PIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGG 505
           P  DP M    IG+S D S  DL++ Y+   EF+A Q R I E +   G  +  I ++G 
Sbjct: 371 PYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL---GAPINDIRVAGS 427

Query: 506 QCRNGLLMRLLADCT-GLPIVIP-RYIDAAVVFGSALLGAVASESFNACAKLEETASDPA 563
           Q +N  L+ L++    G  + IP    D   V G+ LLG       N    +  T  +  
Sbjct: 428 QAKNNRLLSLISFVNHGSRVRIPATRADYVGVQGAYLLGKAKHLGLNVVELI--TQENGG 485

Query: 564 TTSNKDVSIR 573
            +  KD+ +R
Sbjct: 486 ESPMKDIEVR 495

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 23/31 (74%)

Query: 730 EDAPDRLLLNAKYKIFLDMAATQQKYRKLVD 760
           E+   R L   KYKI+L+MA TQ++YR++V+
Sbjct: 500 EENKLRALFEIKYKIYLNMAQTQRQYREMVN 530

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  160 bits (405), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 141/524 (26%), Positives = 228/524 (43%), Gaps = 70/524 (13%)

Query: 38  VGVDVGTGSARACVID-NLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVVR 96
           +G+D+G+ + R  + D     ++ +  +P+       N +TQSS +I +AI  C+    +
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGCI----Q 66

Query: 97  DSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXXPDF---TDNLQNIILWMDHRAIEETEE 153
           D   D +++   G  ATCSL                    +   N++ WMD  A  E E 
Sbjct: 67  DLNPDLKSVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSATLECEI 126

Query: 154 INATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRS 213
           +N T  +  +++GG    EM IPK+  +    PE +  + + FDL  Y+ ++        
Sbjct: 127 VNKTAGRLKEFMGGSFVPEMGIPKLASIFKK-PEAEGHKLEVFDLHSYIAYELAIKYGWD 185

Query: 214 YCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTETTFLSAGECIG 273
               + K     +G +G   GW   F           +D  KL  +V           I 
Sbjct: 186 TSRIINKPNENRIGHDGELKGWDAGFY----------NDVLKLPANVKIGP-------IH 228

Query: 274 TLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATGR 333
            L  ES   +         +  ID Y+ W    ++  +                      
Sbjct: 229 ALNTESPVRV---------ASCIDCYSNWFSMCSSSPN--------------------NS 259

Query: 334 LAAVAGTSTCHI-AMSKDPIFVKGVWGPYRDVM----APGFWLAEGGQSCTGALLAHVLT 388
           L   AGTSTC++ A +++   + GVWGP+ +++    A  + + E GQS TG L+ H+  
Sbjct: 260 LFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKLIEHLFE 319

Query: 389 THPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIA 448
           THPA    S   D + +  F  + S +E L +Q    SV   +KH+F YG+  GNR+P  
Sbjct: 320 THPAARAYSM--DKSKL--FSAIESAIEKL-EQDFGESVHFRSKHMFTYGELQGNRTPYC 374

Query: 449 DPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCR 508
           D SM    IG++ D S  DL + Y+   EF+A Q + I E  C    E+  I ++G Q +
Sbjct: 375 DSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKE--CFKA-EIKDIRIAGSQAK 431

Query: 509 NGLLMRLLADCTG-LPIVIP-RYIDAAVVFGSALLGAVASESFN 550
           N  L+ L +     + + IP +  D   V G+ LLG  A ++ N
Sbjct: 432 NTRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGKAAHKNIN 475

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 22/28 (78%)

Query: 735 RLLLNAKYKIFLDMAATQQKYRKLVDEV 762
           + LL AKYKI+LDMA TQ +YR +VD V
Sbjct: 506 KQLLEAKYKIYLDMAQTQMRYRAMVDSV 533

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  160 bits (406), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 144/526 (27%), Positives = 238/526 (45%), Gaps = 84/526 (15%)

Query: 38  VGVDVGTGSARACV--IDNLGNILSLAERPIQRHEL-KPNYITQSSQEIWNAICYCVKNV 94
           VGVD+G+ S R  +  ++N  ++L + ERP++ +        TQS+ EI  A+  C+  +
Sbjct: 13  VGVDLGSSSVRVGIYSLEN-DSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQECLDEL 71

Query: 95  VRDSGVDP--RTIHGIGFDATCSLXXXXXXXXXXXXXPDFTDNL-----QNIILWMDHRA 147
               G+ P  R+I   G  ATCS+             P     L     +N++ WMD  A
Sbjct: 72  ----GLRPGGRSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMDSVA 127

Query: 148 IEETEEINATGDKCLKY-VGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTF-- 204
            E  + ++      +K  + G    EM +PK+  L    P +     + FDL  Y+ +  
Sbjct: 128 SEACDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQFPGRSL---EVFDLHKYIAYDL 184

Query: 205 -KATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTET 263
            +  G ++ +  +     G+   G +G   GW +EF + +           KL  +V   
Sbjct: 185 ARRYGWDMAALANRPNSNGI---GHDGEVGGWPQEFYRNV----------LKLPATVA-- 229

Query: 264 TFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEV 323
                   +G  +      +G+++        ID YA W G  + + +            
Sbjct: 230 --------VGPASTFKGQRVGVAS-------CIDCYASWFGVCSTQPEQS---------- 264

Query: 324 KHGIDRATGRLAAVAGTSTCHI-AMSKDPIFVKGVWGPYRDVM--APGFW-LAEGGQSCT 379
                     L  VAGTSTC++ A +     + G+WGP+ +++      W + E GQS T
Sbjct: 265 ----------LFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEAGQSTT 314

Query: 380 GALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGD 439
           G LL H+  THPA  + +   D   +  F  L  R+  + +     S+  LA+H+F YG+
Sbjct: 315 GRLLEHLFETHPAARDYA--GDTGRL--FKDLEDRIADM-EADSGCSIHHLARHMFLYGE 369

Query: 440 YHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQM-CNSGHELA 498
             GNR+P ADP M    +G++ D S  +L++ Y+   EF+A QTRQIVE     +   + 
Sbjct: 370 LQGNRTPYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAAAIG 429

Query: 499 AIFMSGGQCRNGLLMRLLADCTG-LPIVIP-RYIDAAVVFGSALLG 542
            + ++G Q RN  L+ L++   G +P+ +P R    A V G+ LLG
Sbjct: 430 ELRVAGSQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLG 475

 Score = 38.1 bits (87), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 19/28 (67%)

Query: 735 RLLLNAKYKIFLDMAATQQKYRKLVDEV 762
           R LL AKY I LDMA  QQ+YR  +D V
Sbjct: 517 RRLLEAKYAIHLDMAQVQQRYRSEIDAV 544

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  159 bits (402), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 137/471 (29%), Positives = 207/471 (43%), Gaps = 72/471 (15%)

Query: 31  ERKMVYYVGVDVGTGSARACVIDNLGNILSLAER----PIQRHELKPNY-ITQSSQEIWN 85
           E K    +G+D+G+ S R  +  N  N   +A +    P        N+  TQSS+EI  
Sbjct: 3   ENKPTAGIGIDLGSSSVRVSLF-NFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILT 61

Query: 86  AICYCVKNVVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXXPDFTDNLQNIILWMDH 145
           AI  C + +     +D   I   G  ATCSL              +  D  +N++ WMD 
Sbjct: 62  AIDQCFQEL----NIDKHEIKSCGVGATCSLAIFQTKDNALIPW-NLDDPDKNVVFWMDS 116

Query: 146 RAIEETEEINATGDKCLK-YVGGQMSVEMEIPKIKW----LKNNIPEKKFAQCKFFDLAD 200
            AI+ET+E+N      ++ ++GG    EM +PK++     LKN      F   +  DL  
Sbjct: 117 IAIKETQEVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTF---EIIDLHR 173

Query: 201 YLTFKATGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSV 260
           Y+           Y +      L  +G +G   GWS  F + + L+              
Sbjct: 174 YIAMSLAQQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYENV-LQ-------------- 218

Query: 261 TETTFLSAGECIG-TLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVK 319
                L     IG T   + +++ GL       S  ID Y+ W             AL+ 
Sbjct: 219 -----LPPNIVIGPTKHSQHSSKQGLKV-----SSCIDCYSNWF------------ALLP 256

Query: 320 SDEVKHGIDRATGRLAAVAGTSTCHI-AMSKDPIFVKGVWGPYRDVM--APGFWLAEGGQ 376
           S+            L  V GTSTC++ A S+    + GVWGP+ ++   +  F + E GQ
Sbjct: 257 SN--------LQNSLFIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFDRSDQFSIYEAGQ 308

Query: 377 SCTGALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFF 436
           SCTG L+ H+  THPA + +    D  ++  F  +N  +E + +Q    S+    KH+FF
Sbjct: 309 SCTGKLIEHLFKTHPASSHIDT-RDWPHL--FSQINDFIEKV-EQNTQDSIHMQTKHMFF 364

Query: 437 YGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIV 487
           YGD  GNR+P ADPSM    IG++ D S  +L   Y+   EFIA Q + ++
Sbjct: 365 YGDLDGNRTPYADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHML 415

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 707 TKDK-LWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEV 762
           T DK + EV +N T   +   P + D     LL  KY+I+ +MA  Q+KYRK V+ V
Sbjct: 478 TSDKSIVEVAHNQTYSYRP--PEKTDGLLVELLEVKYQIYFNMAEQQRKYRKQVNNV 532

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  159 bits (402), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 150/526 (28%), Positives = 232/526 (44%), Gaps = 86/526 (16%)

Query: 38  VGVDVGTGSARACVID-NLGNILSLAERPIQRHELKPNYITQSSQEIWN------AICYC 90
           +G+D+G+ S R  +   +  ++L +  +P+      P Y   +   +W        I   
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFSKPV------PYYYESNRTSLWEYTQDSAEILTA 61

Query: 91  VKNVVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXXPDFTDNLQNIILWMDHRAIEE 150
           +K     + +    +   G  ATCSL              +   + +N++ WMD  A EE
Sbjct: 62  IKECFDMADLQKYDVKSCGVAATCSLVLCERSGDDTFQHCE--GDSRNVVFWMDSMAKEE 119

Query: 151 TEEINATGDK-CLKYVGGQMSVEMEIPKI-KWLKNNIPEKK-FAQCKFFDLADYLTFKAT 207
           T  +NA   +  L ++GG    EM IPK+ ++LK+   E K   Q + FDL  Y+ +K  
Sbjct: 120 TNSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQWEVFDLHKYVAYKLA 179

Query: 208 GSEIRSYCSTVCKQGLLP----LGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTET 263
               + YC    +    P    +G +G   GWSK F           D   +L  +VT  
Sbjct: 180 ----QEYCWNTERLSNHPNSNGIGHDGELAGWSKSFY----------DKIVRLPPNVTIG 225

Query: 264 TFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEV 323
                  C  T+  E +         V+    ID Y+ W   + +               
Sbjct: 226 -------CPKTIENEDSL--------VIVDSCIDCYSSWFSPLQS--------------- 255

Query: 324 KHGIDRATGRLAAVAGTSTCHI---AMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTG 380
              +++ T  L  VAGTSTC+I      K    VKG+WGP+ D++     + E G SC+G
Sbjct: 256 ---LNKNT--LFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKVVYESGSSCSG 310

Query: 381 ALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDY 440
            L+ H+ T+HP+   L+ LS    +SK   L   + +   Q  A+S+   A + F YGD 
Sbjct: 311 KLIEHLFTSHPSAISLN-LSTGQLISK---LEEEINIWETQN-ATSIHFEACNNFLYGDL 365

Query: 441 HGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQM--CNSGHELA 498
            GNR+P  DP MR   IG+S D S  DL + Y+   E +A QT+ +V+     NS +EL 
Sbjct: 366 DGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDNFEKLNSINEL- 424

Query: 499 AIFMSGGQCRNGLLMRL--LADCTGLPIVIPRYIDAAVVFGSALLG 542
             F+ G Q +N  L++L  L +   L +V     D   V G+ LLG
Sbjct: 425 --FICGSQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLG 468

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  158 bits (400), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 138/534 (25%), Positives = 232/534 (43%), Gaps = 88/534 (16%)

Query: 38  VGVDVGTGSARACVI---DNLGNILSLAERPIQRHELKPNYI---TQSSQEIWNAICYCV 91
           +G+D+G+ S R  +    D+L  ++   ++ I  +    + +   TQS+ EI   I  C+
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDL--MVQCVKQKISYYYHGDSALWEYTQSTDEIMKVIERCL 63

Query: 92  KNVVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXXPDFT-DNLQNIILWMDHRAIEE 150
                D  +D   I   G  ATCS+                +  + QN+I WMD+ +  E
Sbjct: 64  ----HDLKIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNSSKTE 119

Query: 151 TEEINATGDKCLK-YVGGQMSVEMEIPKIKWLKNNIPEKKFAQ---CKFFDLADYLTFKA 206
            + +N   +K L+ ++GG+   EM IPKI  L N +      Q       DL  YL ++ 
Sbjct: 120 CKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMDLHRYLAYEI 179

Query: 207 TGSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQE---------IGLEELIADDFAKLG 257
                 ++   +       +G +G  +GWS +F  +         IG E  + DDF    
Sbjct: 180 AKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFYIDTLKIPSNITIGPEPPLEDDFEYCK 239

Query: 258 GSVTETTFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPAL 317
           G V                                +  ID Y+ W+   +   +      
Sbjct: 240 GIV--------------------------------ASCIDCYSSWLSLCSPTPE------ 261

Query: 318 VKSDEVKHGIDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVM--APGFWLAEGG 375
                           L  V GTSTC++  +     + GVWGP+ D++  +  + + EGG
Sbjct: 262 --------------ESLFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNSNTYAVYEGG 307

Query: 376 QSCTGALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLF 435
           QSCTG L+ H+L THPA + +++      + K +   S +E    ++   S+    KH+F
Sbjct: 308 QSCTGKLIEHLLQTHPASSSIAKDDWPLLLEKIEQEISAIE----EQTGRSIHFKTKHMF 363

Query: 436 FYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVE--QMCNS 493
           FYGD+ GNR+P ADP M    IG++ D S ++L + Y+   EF+A Q + ++        
Sbjct: 364 FYGDFQGNRTPYADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYMISIFNKAQG 423

Query: 494 GHELAAIFMSGGQCRNGLLMRLLADC-TGLPIVIPRY-IDAAVVFGSALLGAVA 545
             ++  I + G Q +N  L+ L++    G  I +P+  ++ + V G+ LLG  A
Sbjct: 424 QDKITEIRICGSQAKNKRLLSLISLLHEGGTIKLPKTDVELSGVSGAFLLGKSA 477

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%)

Query: 727 PTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEV 762
           P+  + P  +LL AKY+I LDMA  Q  YR++++++
Sbjct: 502 PSSINQPLSMLLEAKYEIHLDMAKQQLIYREMINKI 537

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  113 bits (282), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 115/495 (23%), Positives = 198/495 (40%), Gaps = 81/495 (16%)

Query: 38  VGVDVGTGSARACVIDNLGNIL---SLAERPIQRHELKPNYITQSSQEIWNAICYCVKNV 94
           +GVD+G+   R  + D   + L   +  + P  RH      ITQ + +I  A    V+  
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSLVKETKEKVPYFRH--GNGIITQCTSDILTA----VEKA 59

Query: 95  VRDSGVDPRTIHGIGFDATCSLXXXXXXXXXX---XXXPDFTDNLQNIILWMDHRAIEET 151
                +    I  +G  ATCS+                 D      +II WM   AIEET
Sbjct: 60  FNTLYIQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAIEET 119

Query: 152 EEIN-ATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSE 210
           E +N  T +  L + GG+   EM IPK+  L     +         DL  +L +K +   
Sbjct: 120 EYLNNITDESILCHFGGKFFPEMAIPKLLHLNKLYKDDGLT---VLDLHIWLLWKISLKL 176

Query: 211 IRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSVTETTFLSAGE 270
                  V +     +G +G   GWSKEF + + L ++   + A +  +           
Sbjct: 177 GHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKIFIGNNAVIKKNEQ--------- 227

Query: 271 CIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRA 330
                                G   ID YA W    +                   ++R 
Sbjct: 228 --------------------FGDSCIDCYASWFQCWSTAM----------------LNRT 251

Query: 331 TGRLAAVAGTSTCHIAMSK-DPIFVKGVWGPYRDVMA--------PGFWLAEGGQSCTGA 381
              L  VAGTSTC +  S     F+ G+WGP++D++           + + E G S TG 
Sbjct: 252 ---LFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYEAGISRTGV 308

Query: 382 LLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYH 441
           LL  +L+THPA  +       ++V+  + +  +++L+ +Q    S+  + K+ FF+ DY 
Sbjct: 309 LLEKLLSTHPAVKD-------SDVNFLETVEHKIDLI-EQSDTQSIHLMIKNTFFHEDYE 360

Query: 442 GNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIF 501
              S         +I+ +  + ++ DL++ Y+   E +A Q   ++         ++ + 
Sbjct: 361 EFESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEGHITISKLL 420

Query: 502 MSGGQCRNGLLMRLL 516
           ++G Q +N  L+++L
Sbjct: 421 ITGSQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 115/519 (22%), Positives = 198/519 (38%), Gaps = 100/519 (19%)

Query: 38  VGVDVGTGSARACVI--DNLGNILSLAERPIQRHE--LKPNYITQSSQEIWNAICYCVKN 93
           +G+DVG+ S R  +   ++   I ++ +  + +HE   K  + TQ++  + ++I   ++ 
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTIKTIVKEMLYKHEPDSKLWHYTQNAFVMRDSIFTALEE 64

Query: 94  VVRDSGVDPRTIHGIGFDATCSLXXXXXXXXXXXXXP-----DFTDNLQNIILWMDHRAI 148
           +     V+   +   G  ATCS+             P     + T+N  +II W DH A 
Sbjct: 65  L----HVNSYIVKICGVSATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDHTAQ 120

Query: 149 EETEEIN-----------ATGDKCLKYVGGQMSV--EMEIPKIKWLKNNIPEKKFAQCKF 195
            E + +N              +K L  +G +     EM IPK+  L N I E  +     
Sbjct: 121 PEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYETPHI 180

Query: 196 FDLADYLTFKATGSEIRSYCSTVC---KQGLLPLGVEGSKNGWSKEFLQEIGLEELIADD 252
            ++ D   + A     +   +TV    K  +  +G++G   GW                D
Sbjct: 181 LEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGW----------------D 224

Query: 253 FAKLGGSVTETTFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDV 312
            +    ++ ET+F     CIG       +++   T  V     ID YA W  T A   D 
Sbjct: 225 LSFYVWALPETSF---PICIG------PSKVINETSIVRPKSCIDCYASWFSTDACTKD- 274

Query: 313 EIPALVKSDEVKHGIDRATGRLAAVAGTSTCHI-AMSKDPIFVKG--------VWGPYRD 363
                                L   AGTSTC + AM +  +   G         WGP+ +
Sbjct: 275 -------------------DTLFMAAGTSTCCLYAMPRSALEYFGEQQQPLSLFWGPFTN 315

Query: 364 VM----APGFWLAEGGQSCTGALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLA 419
           V+       F   E G S TG LL  +   H   A  S ++++ N     Y+ +++ +  
Sbjct: 316 VLDKDKKSSF---EIGFSETGILLEKLFNKHQITASWS-VAESIN-----YVENQIAIY- 365

Query: 420 QQRKASSVVALAKHLFFYGDYHGNRSPIA--DPSMRAAIIGQSMDNSIDDLSIMYLGACE 477
            +RK S  + L   ++ +  Y     P     P          + +S   L   Y+   E
Sbjct: 366 -ERKKSHSIYLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIFKYIAILE 424

Query: 478 FIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLLMRLL 516
           ++A Q   ++ Q       +  + +SG Q +N  L+ L+
Sbjct: 425 YLAYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

>Suva_4.314 Chr4 (557178..558239) [1062 bp, 353 aa] {ON} YBR076W
           (REAL)
          Length = 353

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 50/123 (40%), Gaps = 15/123 (12%)

Query: 182 KNNIPEKKFAQCKFFDLADYLTFKATGSEIRSYCSTVCKQGL-LPLGVE-GSKNGWSKEF 239
           +  I  KKF+Q K F+ ++Y  F    S+ +    ++ KQ + LP   +  S  GW K  
Sbjct: 60  RKTIKHKKFSQRKIFNNSEYFDFDKGSSDCKHVLKSISKQLIFLPRCFQHHSIRGWMK-- 117

Query: 240 LQEIGLEELIADDFAKLGGSVTETTFLSAGECIGTLTEESAAELGLSTHCVVGSGVIDAY 299
                      D +++ G  +          C+ TL   S +  GL T   + S +I  +
Sbjct: 118 -----------DRYSEFGYKIKRNQHCPPSACVQTLYNTSRSNNGLFTPSDLDSLIIYKF 166

Query: 300 AGW 302
             +
Sbjct: 167 MRY 169

>NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4.9
           YHL032C
          Length = 703

 Score = 37.0 bits (84), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 45/188 (23%), Positives = 80/188 (42%), Gaps = 18/188 (9%)

Query: 371 LAEGGQSCTGALLAHVLTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVAL 430
           ++E G   T A      T  P      + S A   S   +L   L L+ +      + + 
Sbjct: 437 ISEHGALTTPAYWFPNSTEQPEPHFALEGSIAVGGSVVQWLRDNLRLIPKSEHIGPLASR 496

Query: 431 AKH---LFFYGDYHGNRSPIADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIV 487
            +    + F   ++G  +P  DP  RA I+G S   +   ++     A E +  Q R I+
Sbjct: 497 VRDSGGVVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQVRAIL 553

Query: 488 EQM------CNSGHE---LAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGS 538
           + M       +S +E   LA + + GG  ++  +M++ AD  G  I + R   + +V  +
Sbjct: 554 KAMGSDEVYGDSAYEKKNLATLAVDGGMSKSNEVMQIQADILGPCIKLRR---SPIVECT 610

Query: 539 ALLGAVAS 546
           AL  A+A+
Sbjct: 611 ALGAAIAA 618

>NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}
           Anc_4.9 YHL032C
          Length = 810

 Score = 35.4 bits (80), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 66/147 (44%), Gaps = 16/147 (10%)

Query: 410 YLNSRLELLAQQRKASSVVALAKH---LFFYGDYHGNRSPIADPSMRAAIIGQSMDNSID 466
           +L   L L+ +      + +  +    + F   ++G  +P  DP  RA I+G S   +  
Sbjct: 583 WLRDNLRLIPKSEHVGPLASRVRDSGGVVFVPAFNGLFAPYWDPDTRATIMGISQSTTAS 642

Query: 467 DLSIMYLGACEFIAQQTRQIVEQM----CNSGHE---LAAIFMSGGQCRNGLLMRLLADC 519
            ++     A E +  Q R I++ M       G+E   +  + + GG  ++  +M++ AD 
Sbjct: 643 HIA---RAAIEGVCFQVRAILKAMSGDKIEDGYEKGTVVTLSVDGGMSKSDEVMQIQADI 699

Query: 520 TGLPIVIPRYIDAAVVFGSALLGAVAS 546
            G  I + R   + +V  +AL  A+A+
Sbjct: 700 LGPCIKLRR---SPIVECTALGAAIAA 723

>KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON}
           similar to uniprot|P32190 Saccharomyces cerevisiae
           YHL032C GUT1 Glycerol kinase converts glycerol to
           glycerol- 3-phosphate glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p derepression of
           expression on non- fermentable carbon sources is
           mediated by Opi1p and Rsf1p
          Length = 661

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 32/157 (20%), Positives = 66/157 (42%), Gaps = 21/157 (13%)

Query: 391 PAYAELSQLSDAANVSKFDYLNSRLELLAQQRKA---SSVVALAKHLFFYGDYHGNRSPI 447
           P YA    ++ A  V +  +L   L L+ +       +S V  +  + F   + G  +P 
Sbjct: 412 PHYALEGSVAVAGAVVQ--WLRDNLRLIPRAEDVGPLASAVPNSGGVVFVPAFSGLFAPY 469

Query: 448 ADPSMRAAIIGQSMDNSIDDL-------------SIMYLGACEFIAQQTRQIVEQMCNSG 494
            DP  RA I+G S   +   +             +I+   + +    + +  +E++ +  
Sbjct: 470 WDPDARATIMGMSQYTTASHIARAAVEGVCFQARAILKAMSSDAFGSEDKDFLEEVVDET 529

Query: 495 HE---LAAIFMSGGQCRNGLLMRLLADCTGLPIVIPR 528
           +E   L+ + + GG  R+  +M++ AD  G  + + R
Sbjct: 530 YEKTLLSTLAVDGGMSRSDEVMQIQADILGPCVKVRR 566

>NDAI0B03840 Chr2 complement(965694..969785) [4092 bp, 1363 aa] {ON}
           Anc_8.228 YER164W
          Length = 1363

 Score = 32.3 bits (72), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 39/68 (57%), Gaps = 6/68 (8%)

Query: 696 NHNNAKVLRDVTKDKLWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKY 755
           N NN  + +  TKD+L +++Y      +   P E    ++L +N   ++F+D++  Q +Y
Sbjct: 22  NVNNIHIPKPQTKDQLEQLIYRYRAIQQ--HPVE----NKLEINLLEEVFIDISNDQDEY 75

Query: 756 RKLVDEVK 763
            K+V++++
Sbjct: 76  NKIVEQLR 83

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,091,842
Number of extensions: 2484124
Number of successful extensions: 5905
Number of sequences better than 10.0: 38
Number of HSP's gapped: 5920
Number of HSP's successfully gapped: 73
Length of query: 763
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 646
Effective length of database: 40,065,477
Effective search space: 25882298142
Effective search space used: 25882298142
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)