Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F18997gna 1ON40040020450.0
AGR094Wna 1ON1381283642e-41
Ecym_4314na 2ON9302113701e-37
SAKL0H17182gna 1ON6853543572e-36
KLTH0G13816gna 1ON6551403088e-30
Kwal_56.23599na 1ON6481352812e-26
Kwal_23.55935.277ON3501021097e-05
KLTH0G06908g5.277ON3611011087e-05
Ecym_73645.277ON3301991033e-04
AER235C5.277ON324861024e-04
KLLA0F21824g5.277ON27695950.002
SAKL0G10912g5.277ON33787960.003
TDEL0E034905.277ON34591860.044
NDAI0D015805.277ON29994800.18
TPHA0F007904.118ON28278731.5
KNAG0J001708.865ON1230126722.5
SAKL0A10406g1.534ON71179696.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18997g
         (400 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18997g Chr6 complement(1747295..1748497) [1203 bp, 400 aa]...   792   0.0  
AGR094W Chr7 (913067..913483) [417 bp, 138 aa] {ON} NOHBY739; No...   144   2e-41
Ecym_4314 Chr4 (675795..678587) [2793 bp, 930 aa] {ON} similar t...   147   1e-37
SAKL0H17182g Chr8 (1520135..1522192) [2058 bp, 685 aa] {ON} some...   142   2e-36
KLTH0G13816g Chr7 (1194256..1196223) [1968 bp, 655 aa] {ON} cons...   123   8e-30
Kwal_56.23599 s56 complement(615840..617786) [1947 bp, 648 aa] {...   112   2e-26
Kwal_23.5593 s23 complement(1230110..1231162) [1053 bp, 350 aa] ...    47   7e-05
KLTH0G06908g Chr7 (550439..551524) [1086 bp, 361 aa] {ON} conser...    46   7e-05
Ecym_7364 Chr7 complement(760757..761749) [993 bp, 330 aa] {ON} ...    44   3e-04
AER235C Chr5 complement(1073608..1074582) [975 bp, 324 aa] {ON} ...    44   4e-04
KLLA0F21824g Chr6 complement(2031719..2032549) [831 bp, 276 aa] ...    41   0.002
SAKL0G10912g Chr7 (922534..923547) [1014 bp, 337 aa] {ON} conser...    42   0.003
TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277     38   0.044
NDAI0D01580 Chr4 (377632..378531) [900 bp, 299 aa] {ON} Anc_5.277      35   0.18 
TPHA0F00790 Chr6 (179491..180339) [849 bp, 282 aa] {ON} Anc_4.11...    33   1.5  
KNAG0J00170 Chr10 (16247..19939) [3693 bp, 1230 aa] {ON} Anc_8.8...    32   2.5  
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    31   6.0  

>KLLA0F18997g Chr6 complement(1747295..1748497) [1203 bp, 400 aa]
           {ON} some similarities with uniprot|Q74ZV5 Ashbya
           gossypii AGR094W AGR094Wp
          Length = 400

 Score =  792 bits (2045), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/400 (96%), Positives = 386/400 (96%)

Query: 1   MRTEQFSQLPQPIKKELEVTKFQSSKADPTSPIDSSDTLRIQQRQRHTQQDNLLNQEHFQ 60
           MRTEQFSQLPQPIKKELEVTKFQSSKADPTSPIDSSDTLRIQQRQRHTQQDNLLNQEHFQ
Sbjct: 1   MRTEQFSQLPQPIKKELEVTKFQSSKADPTSPIDSSDTLRIQQRQRHTQQDNLLNQEHFQ 60

Query: 61  GNTSVHYIPPSQYFMASENLSLHYNVQNLIAENQQLREYVNYLKQNLQYLFENPHLLKKS 120
           GNTSVHYIPPSQYFMASENLSLHYNVQNLIAENQQLREYVNYLKQNLQYLFENPHLLKKS
Sbjct: 61  GNTSVHYIPPSQYFMASENLSLHYNVQNLIAENQQLREYVNYLKQNLQYLFENPHLLKKS 120

Query: 121 DTKLDAKPTKEYLSNSNTQDQAISTSISPLNSAKNIPSSGLSTSMEQLMDNMITYPFTFN 180
           DTKLDAKPTKEYLSNSNTQDQAISTSISPLNSAKNIPSSGLSTSMEQLMDNMITYPFTFN
Sbjct: 121 DTKLDAKPTKEYLSNSNTQDQAISTSISPLNSAKNIPSSGLSTSMEQLMDNMITYPFTFN 180

Query: 181 HVTYPKSQLSQSVPSNATNSSKFDHATTSAYSKNSSGLDIAFNIAYEENTENLPRRMNTD 240
           HVTYPKSQLSQSVPSNATNSSKFDHATTSAYSKNSSGLDIAFNIAYEENTENLPRRMNTD
Sbjct: 181 HVTYPKSQLSQSVPSNATNSSKFDHATTSAYSKNSSGLDIAFNIAYEENTENLPRRMNTD 240

Query: 241 TDHPQQLNINKQAKTMHAKKIGVASVSKGQQFKPPLSEDGKNYLVTDDGSLSIVMKNDLD 300
           TDHPQQLNINKQAKTMHAKKIGVASVSKGQQFKPPLSEDGKNYLVTDDGSLSIVMKNDLD
Sbjct: 241 TDHPQQLNINKQAKTMHAKKIGVASVSKGQQFKPPLSEDGKNYLVTDDGSLSIVMKNDLD 300

Query: 301 SVYSIYNEFMQSLKPQIDSFVQDHGRSKLXXXXXXXXXXXXXXFCSFVETIVNSTSFTSE 360
           SVYSIYNEFMQSLKPQIDSFVQDHGRSKL              FCSFVETIVNSTSFTSE
Sbjct: 301 SVYSIYNEFMQSLKPQIDSFVQDHGRSKLAKFQKKRTFQKRKAFCSFVETIVNSTSFTSE 360

Query: 361 EILDIIDGIRAQNDHSVIWVCNNLNQLKMDLLKQRPDLAR 400
           EILDIIDGIRAQNDHSVIWVCNNLNQLKMDLLKQRPDLAR
Sbjct: 361 EILDIIDGIRAQNDHSVIWVCNNLNQLKMDLLKQRPDLAR 400

>AGR094W Chr7 (913067..913483) [417 bp, 138 aa] {ON} NOHBY739; No
           homolog in Saccharomyces cerevisiae
          Length = 138

 Score =  144 bits (364), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 85/128 (66%)

Query: 271 QFKPPLSEDGKNYLVTDDGSLSIVMKNDLDSVYSIYNEFMQSLKPQIDSFVQDHGRSKLX 330
           Q++PPL+ DGKNYLV D+G  SI+M ND DS+YSIYNEF QSLK Q+++FVQD G+SKL 
Sbjct: 2   QYQPPLTADGKNYLVDDEGKFSIIMSNDQDSIYSIYNEFYQSLKLQVEAFVQDFGKSKLV 61

Query: 331 XXXXXXXXXXXXXFCSFVETIVNSTSFTSEEILDIIDGIRAQNDHSVIWVCNNLNQLKMD 390
                        F   VE I   T  + E++LDI D +R + + SV+WVCNNL  LK  
Sbjct: 62  QFRKKRTFQKKKAFVYLVEKIAYFTKLSPEQVLDIADNVRLKEEKSVVWVCNNLGALKCA 121

Query: 391 LLKQRPDL 398
           L+K RPDL
Sbjct: 122 LVKYRPDL 129

>Ecym_4314 Chr4 (675795..678587) [2793 bp, 930 aa] {ON} similar to
           Ashbya gossypii AGR093W +AGR094W
          Length = 930

 Score =  147 bits (370), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 128/211 (60%), Gaps = 13/211 (6%)

Query: 189 LSQSVPSNATNSS-KFDHATTSAYSKNSSGLDIAFNIAYEENTENLPRRMNTDTDHPQQL 247
           +S ++P ++T+S+  + ++T++ ++    G  ++  +A   NT NL    ++ T+H    
Sbjct: 723 MSSALPQDSTSSTICYSNSTSNIHNNAKEGQLVSSEVA--SNTNNL----SSSTEHKL-- 774

Query: 248 NINKQAKTMHAKKIGVASVSKGQQFKPPLSEDGKNYLVTDDGSLSIVMKNDLDSVYSIYN 307
              K+ ++ + +  G + +SKG Q++PPL+ +GK Y++ +DG  SIVM +D DS+YSIYN
Sbjct: 775 ---KKLRSRYKESSG-SKLSKGVQYQPPLTSEGKRYMLGEDGKFSIVMSSDQDSIYSIYN 830

Query: 308 EFMQSLKPQIDSFVQDHGRSKLXXXXXXXXXXXXXXFCSFVETIVNSTSFTSEEILDIID 367
           EF QSLK Q+DSFVQD+G+SKL              F   VE I   +    E++LDI+D
Sbjct: 831 EFYQSLKLQVDSFVQDYGKSKLTQFRKKRTFQKKKAFVYLVEKISYFSKLPPEQVLDIVD 890

Query: 368 GIRAQNDHSVIWVCNNLNQLKMDLLKQRPDL 398
            +R +   SV+WVCNNL  LK  L+K RP L
Sbjct: 891 DVRIKEGKSVVWVCNNLGSLKYALVKYRPKL 921

>SAKL0H17182g Chr8 (1520135..1522192) [2058 bp, 685 aa] {ON} some
           similarities with uniprot|Q74ZV5 Ashbya gossypii AGR094W
           AGR094Wp
          Length = 685

 Score =  142 bits (357), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 118/354 (33%), Positives = 177/354 (50%), Gaps = 30/354 (8%)

Query: 65  VHYIPPSQYFMASENLSLHYNVQNLIAENQQLREYVNYL------KQNLQYLFENPHLLK 118
           +HY+      +  +N+ L  NV +L ++  QL+ +V+ +        +L    + P   +
Sbjct: 333 LHYLALENKSLREQNMVLLQNVSSLESQIAQLQNFVSVVVSKPTGATSLSLQPQEPRQAR 392

Query: 119 K----------SDTKLDAKPTKEYLSNSNTQDQAISTSISPLNSAK-NIPSSGLSTSMEQ 167
           K          S T++ A P +  L+     DQ +      LN+A  N+ +   S S + 
Sbjct: 393 KKIGKVKQQRTSPTQMSATPNQAPLAQI---DQIVPKQPPTLNTASSNLHNLQFSNSTDH 449

Query: 168 LMDNMITYPFTFNHVTYPKSQLSQSVPSNA-TNSSKFDHATTSAYSKNSSGLDIAFNIAY 226
            M    T   +++ +    S+L +S  SN  TNS++    T   +S N   L I    + 
Sbjct: 450 RMSEYDTMLHSYDPLMVRSSELGRS--SNGLTNSTQ--EPTFELHSANP--LIIQEGQSR 503

Query: 227 EENTENLPRRMNTDTDHPQQLNI--NKQAKTMHAKKIGVASVSKGQQFKPPLSEDGKNYL 284
             + +N P      T   QQL    +K+A+  +    G + +SKG+ + PP+S  GKNYL
Sbjct: 504 ILSYQNTPDPQLRSTLQQQQLRYTESKKARPKYKDTPG-SQLSKGKTYHPPVSITGKNYL 562

Query: 285 VTDDGSLSIVMKNDLDSVYSIYNEFMQSLKPQIDSFVQDHGRSKLXXXXXXXXXXXXXXF 344
           V +DG L+IVM ND DS+YSIYNEF QSLKPQ++SFV+D G+S+L              F
Sbjct: 563 VDEDGRLAIVMSNDQDSIYSIYNEFYQSLKPQVESFVKDFGKSRLVQFKKKRTFQKKKAF 622

Query: 345 CSFVETIVNSTSFTSEEILDIIDGIRAQNDHSVIWVCNNLNQLKMDLLKQRPDL 398
               E I    +   E +L IID IR + + SV+W CNNLN LK  L+K RPDL
Sbjct: 623 VYLAEKIAYMQNMPVETVLGIIDQIRHREEKSVVWACNNLNLLKDMLVKHRPDL 676

>KLTH0G13816g Chr7 (1194256..1196223) [1968 bp, 655 aa] {ON}
           conserved hypothetical protein
          Length = 655

 Score =  123 bits (308), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 85/140 (60%)

Query: 259 KKIGVASVSKGQQFKPPLSEDGKNYLVTDDGSLSIVMKNDLDSVYSIYNEFMQSLKPQID 318
           ++I  A +SKG+ ++PP + +GKNYL+ ++G L+IVM  +  SVY +YNE+ QSL+PQ+D
Sbjct: 507 RRIEGAKLSKGETYQPPQAPNGKNYLLDNEGRLAIVMATEQSSVYGVYNEYYQSLRPQVD 566

Query: 319 SFVQDHGRSKLXXXXXXXXXXXXXXFCSFVETIVNSTSFTSEEILDIIDGIRAQNDHSVI 378
           S+  D G+  +              F  +VE I    +   E +LDI+D +R +   SV+
Sbjct: 567 SYADDFGKKSMGHFRKKRTFQKKKAFVQWVERISQLNNMPPELVLDIVDEVRLKEKKSVV 626

Query: 379 WVCNNLNQLKMDLLKQRPDL 398
           W CNNL + ++ L + +PDL
Sbjct: 627 WACNNLGRFRLVLNRYKPDL 646

>Kwal_56.23599 s56 complement(615840..617786) [1947 bp, 648 aa] {ON}
           [contig 176] FULL
          Length = 648

 Score =  112 bits (281), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 77/135 (57%)

Query: 264 ASVSKGQQFKPPLSEDGKNYLVTDDGSLSIVMKNDLDSVYSIYNEFMQSLKPQIDSFVQD 323
           A ++KG+ + PP + DGK YL+ ++G L+IVM     SVY +YNE+ QSL+PQ+D++ +D
Sbjct: 505 AKLTKGETYHPPQAPDGKRYLLDEEGKLAIVMAPVQSSVYGVYNEYYQSLRPQVDAYAED 564

Query: 324 HGRSKLXXXXXXXXXXXXXXFCSFVETIVNSTSFTSEEILDIIDGIRAQNDHSVIWVCNN 383
           +G+  +              F  +VE + +      E +LD+ID +R +   SV+W CNN
Sbjct: 565 YGKKSIGHFRKKRTFQKKKAFVQWVERLSDLNGIPPELVLDMIDDVRVREKKSVVWACNN 624

Query: 384 LNQLKMDLLKQRPDL 398
           L   +  L    P+L
Sbjct: 625 LGSCRTALGHYNPEL 639

>Kwal_23.5593 s23 complement(1230110..1231162) [1053 bp, 350 aa]
           {ON} [contig 11] FULL
          Length = 350

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 46/102 (45%)

Query: 286 TDDGSLSIVMKNDLDSVYSIYNEFMQSLKPQIDSFVQDHGRSKLXXXXXXXXXXXXXXFC 345
            D    ++ M N   +V+++Y+EF  SL PQ+  + + +G+ +                 
Sbjct: 244 VDISEFTLQMSNQPTTVFALYSEFETSLGPQMLEYEKRYGKGQSSRLPRIRTFQRRRALV 303

Query: 346 SFVETIVNSTSFTSEEILDIIDGIRAQNDHSVIWVCNNLNQL 387
           S ++     T    EE +   + IR +N  SV W+ NNL ++
Sbjct: 304 SEIDKFSRRTGRPIEEAIAYFELIRTRNRRSVAWLYNNLTRI 345

>KLTH0G06908g Chr7 (550439..551524) [1086 bp, 361 aa] {ON} conserved
           hypothetical protein
          Length = 361

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 45/101 (44%)

Query: 287 DDGSLSIVMKNDLDSVYSIYNEFMQSLKPQIDSFVQDHGRSKLXXXXXXXXXXXXXXFCS 346
           D  +  + M  +  +V  +Y E+   L+PQI  F + +G+ ++                +
Sbjct: 256 DISAYVLKMSGNPKTVGDMYYEYEHQLRPQILEFEKRYGKGQISRLPKVRTYQRRRALIN 315

Query: 347 FVETIVNSTSFTSEEILDIIDGIRAQNDHSVIWVCNNLNQL 387
            +E        + EE +   + IR QN  +V W+ NNLN++
Sbjct: 316 EIEKFARREGKSIEEAVQYFEEIRTQNKKTVPWLYNNLNRI 356

>Ecym_7364 Chr7 complement(760757..761749) [993 bp, 330 aa] {ON}
           similar to Ashbya gossypii AER235C
          Length = 330

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 47/199 (23%), Positives = 87/199 (43%), Gaps = 21/199 (10%)

Query: 200 SSKFDHATTSAYSKNSSGLDIAFNIAYEENTENLPRRMNTDTDHPQQLNINKQAKTMHAK 259
           SS  +HAT        +GLDIA ++A++++ + L RR  T ++    ++I K       +
Sbjct: 135 SSNSNHAT--------AGLDIA-SLAFDQDIQALKRR-RTSSECSTGVSIAKVGIEEDEE 184

Query: 260 KI-------GVASVSKGQQFKPPLSEDGKNYL----VTDDGSLSIVMKNDLDSVYSIYNE 308
            +         A++   QQ +P      +  L    + +     + M +    V  +Y E
Sbjct: 185 DVVTIQKDRNAAALGHLQQRQPHRHISTRRALPASHLQEIEDYELQMIDSPKDVNELYRE 244

Query: 309 FMQSLKPQIDSFVQDHGRSKLXXXXXXXXXXXXXXFCSFVETIVNSTSFTSEEILDIIDG 368
           F  SLK QI  F + +G+ +L                S ++     T+ ++EE +   D 
Sbjct: 245 FDTSLKLQIMEFEKRYGKGQLSRIPKIRTYQRRRALVSEIDRYARFTNKSTEEAIQFFDT 304

Query: 369 IRAQNDHSVIWVCNNLNQL 387
           IR + + +V W+ NNL ++
Sbjct: 305 IRVEKNKTVAWLYNNLGKI 323

>AER235C Chr5 complement(1073608..1074582) [975 bp, 324 aa] {ON}
           NOHBY524; No homolog in Saccharomyces cerevisiae'
          Length = 324

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%)

Query: 302 VYSIYNEFMQSLKPQIDSFVQDHGRSKLXXXXXXXXXXXXXXFCSFVETIVNSTSFTSEE 361
           V  +Y EF  SLK QI  F + +G+ +L                S ++     T+ ++EE
Sbjct: 232 VNELYREFDTSLKLQIMEFEKRYGKGQLSRIPKIRTYQRRRALVSEIDRYARFTNKSTEE 291

Query: 362 ILDIIDGIRAQNDHSVIWVCNNLNQL 387
            +   D IR + + +V W+ NNL ++
Sbjct: 292 AIQFFDDIRMEKNKTVAWLYNNLGKI 317

>KLLA0F21824g Chr6 complement(2031719..2032549) [831 bp, 276 aa]
           {ON} conserved hypothetical protein
          Length = 276

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 43/95 (45%)

Query: 293 IVMKNDLDSVYSIYNEFMQSLKPQIDSFVQDHGRSKLXXXXXXXXXXXXXXFCSFVETIV 352
           ++M +   SV+ +Y+EF    K QI  F + HG  +L                + +    
Sbjct: 174 LIMTDCPKSVHDLYHEFYTDTKLQILHFEEKHGAGQLSKLPKLRTYQRRSALVNAINKYA 233

Query: 353 NSTSFTSEEILDIIDGIRAQNDHSVIWVCNNLNQL 387
              + T E+ ++   GI  +ND ++ W+ NNL ++
Sbjct: 234 KGKNITVEQSIEHFQGIVEENDKTIPWLYNNLAKI 268

>SAKL0G10912g Chr7 (922534..923547) [1014 bp, 337 aa] {ON} conserved
           hypothetical protein
          Length = 337

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%)

Query: 301 SVYSIYNEFMQSLKPQIDSFVQDHGRSKLXXXXXXXXXXXXXXFCSFVETIVNSTSFTSE 360
           SV  +Y+EF  SLK QI  F +  G+ +L                S ++     T+ ++E
Sbjct: 245 SVAELYDEFDNSLKLQILEFEKKFGKGQLSRIPKIRTYQRRRALVSEIDKYARFTNKSTE 304

Query: 361 EILDIIDGIRAQNDHSVIWVCNNLNQL 387
           + +   + IR + + +V W+ NNL ++
Sbjct: 305 DAIHFFENIRNEKNKTVAWLYNNLGRV 331

>TDEL0E03490 Chr5 (652306..653343) [1038 bp, 345 aa] {ON} Anc_5.277
          Length = 345

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 42/91 (46%)

Query: 301 SVYSIYNEFMQSLKPQIDSFVQDHGRSKLXXXXXXXXXXXXXXFCSFVETIVNSTSFTSE 360
           SV  +Y+E+  SLK QI+ F +  G+ +L                + ++    S + T+ 
Sbjct: 247 SVAEVYHEYENSLKSQIEEFERLFGKGQLSKLPKIRTYQRRRALVTEIDKYATSYNKTTH 306

Query: 361 EILDIIDGIRAQNDHSVIWVCNNLNQLKMDL 391
           E ++  + +R     +V  + NNL ++  +L
Sbjct: 307 EAIEFFEKVRIAKKRTVPGLYNNLGKILKEL 337

>NDAI0D01580 Chr4 (377632..378531) [900 bp, 299 aa] {ON} Anc_5.277
          Length = 299

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/94 (22%), Positives = 44/94 (46%), Gaps = 1/94 (1%)

Query: 300 DSVYSIYNEFMQSLKPQIDSFVQDHGRSKLXXXXXXXXXXXXXXFCSFVETIVNSTSFTS 359
           +S+  ++ E+   L P++    + +G+  L                S ++        + 
Sbjct: 203 NSITELFYEYENVLTPKVKDIQKKYGKKCLKQITNIRTLQRRKALVSEIKKFAKQNRKSI 262

Query: 360 EEILDIIDGIRAQNDHSVIWVCNNLNQLKMDLLK 393
           +E L++ + IR +N+ SV W+ NN++ L +D LK
Sbjct: 263 KETLEVAEYIRLKNNRSVPWLYNNISHL-LDELK 295

>TPHA0F00790 Chr6 (179491..180339) [849 bp, 282 aa] {ON} Anc_4.118
           YGL005C
          Length = 282

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 43/78 (55%), Gaps = 5/78 (6%)

Query: 133 LSNSNTQD----QAISTSI-SPLNSAKNIPSSGLSTSMEQLMDNMITYPFTFNHVTYPKS 187
           LS ++T+D    QA+S+++ +  +      ++ L TS+E L     T P T++  T  K+
Sbjct: 38  LSATSTEDLTKTQAVSSALLARFDYYTKTLTNELKTSLESLEKLSETIPSTWSSSTLDKA 97

Query: 188 QLSQSVPSNATNSSKFDH 205
            L  S PSNA  SSK ++
Sbjct: 98  TLGTSEPSNAHGSSKLEY 115

>KNAG0J00170 Chr10 (16247..19939) [3693 bp, 1230 aa] {ON} Anc_8.865
           YML091C
          Length = 1230

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 61/126 (48%), Gaps = 7/126 (5%)

Query: 203 FDHATTSAYSKNSSGLDIAFNIAYEE-NTENLPRRMNTDTDHPQQLNINKQAKTMHAKKI 261
           F ++  +  +KN++G+D  F I  E  NT     ++   T +   L +N  A T    ++
Sbjct: 300 FKNSIVAYEAKNNNGIDF-FKIGKELINTVVKKNKLENTTINYYLLAMNLYATTSTTAQV 358

Query: 262 GVASVSKGQQFKPPLS---EDGKNYLVTDDGSLSIVMKNDLDSVYSIYNEFMQSLKPQID 318
            +  ++  +Q    LS   E    Y ++      I  KNDL    ++YNEF+ SL  +I+
Sbjct: 359 PIPDLTSLKQKAIDLSPSYEKDSFYFISLVNLAKI--KNDLAFTKTLYNEFLTSLPQEIN 416

Query: 319 SFVQDH 324
           + ++DH
Sbjct: 417 TSLRDH 422

>SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} similar
           to uniprot|P36037 Saccharomyces cerevisiae YKL213C DOA1
           WD repeat protein required for ubiquitin- mediated
           protein degradation forms complex with Cdc48p plays a
           role in controlling cellular ubiquitin concentration
           also promotes efficient NHEJ in postdiauxic/stationary
           phase
          Length = 711

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 34/79 (43%), Gaps = 1/79 (1%)

Query: 118 KKSDTKLDAKPTKEYLSNSNTQDQAISTSISPLNSA-KNIPSSGLSTSMEQLMDNMITYP 176
           +KS   L   P K YLS SN    AI   +  LNS  K    + L+     L +   +Y 
Sbjct: 453 RKSKNALKVLPVKSYLSISNFNPDAIFNGLVKLNSKEKTFDDTDLAAIGSALHNIEESYE 512

Query: 177 FTFNHVTYPKSQLSQSVPS 195
             F + +  +S  S  VPS
Sbjct: 513 LLFANASIIRSSWSNKVPS 531

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.126    0.349 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,287,728
Number of extensions: 2015599
Number of successful extensions: 9314
Number of sequences better than 10.0: 353
Number of HSP's gapped: 9813
Number of HSP's successfully gapped: 360
Length of query: 400
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 288
Effective length of database: 40,638,807
Effective search space: 11703976416
Effective search space used: 11703976416
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)