Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F18975g8.256ON1200120060670.0
SAKL0H17204g8.256ON1211121622160.0
TPHA0B032508.256ON1215123417930.0
ZYRO0C01804g8.256ON1209125017830.0
TDEL0F038308.256ON1195122517690.0
Suva_10.1688.256ON1220123417660.0
Skud_12.1528.256ON1220124617650.0
NDAI0B023808.256ON1219124117650.0
NCAS0B049808.256ON1204122817590.0
Ecym_43158.256ON1212122717450.0
Smik_12.1438.256ON1220125117420.0
KLTH0G13838g8.256ON1214123317390.0
YLR084C (RAX2)8.256ON1220123317280.0
Kwal_56.235898.256ON1213124117250.0
AGR095W8.256ON1201123216610.0
Kpol_392.108.256ON1226124416260.0
KNAG0G020008.256ON1202123415700.0
KAFR0B026908.256ON1210125414990.0
CAGL0L12144g8.256ON1156120513341e-163
TBLA0E043908.256ON1278114013381e-163
KLLA0C17754g8.236ON22769717.9
Kwal_27.127003.136ON584105728.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18975g
         (1200 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...  2341   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   858   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   695   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   691   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   686   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   684   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   684   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...   684   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   682   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   676   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   675   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   674   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   670   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   669   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   644   0.0  
Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....   630   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   609   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   582   0.0  
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   518   e-163
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   520   e-163
KLLA0C17754g Chr3 (1576357..1577040) [684 bp, 227 aa] {ON} simil...    32   7.9  
Kwal_27.12700 s27 complement(1339337..1341091) [1755 bp, 584 aa]...    32   8.8  

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score = 2341 bits (6067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1165/1200 (97%), Positives = 1165/1200 (97%)

Query: 1    MFSINPLIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWDSPDLTYMNNFEELTVISYT 60
            MFSINPLIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWDSPDLTYMNNFEELTVISYT
Sbjct: 1    MFSINPLIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWDSPDLTYMNNFEELTVISYT 60

Query: 61   GQQNFTVQANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALEQ 120
            GQQNFTVQANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALEQ
Sbjct: 61   GQQNFTVQANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALEQ 120

Query: 121  QILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTT 180
            QILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTT
Sbjct: 121  QILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTT 180

Query: 181  ELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDLTSLQFD 240
            ELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDLTSLQFD
Sbjct: 181  ELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDLTSLQFD 240

Query: 241  QSVPLKLSSITGENVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYNSVE 300
            QSVPLKLSSITGENVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYNSVE
Sbjct: 241  QSVPLKLSSITGENVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYNSVE 300

Query: 301  ENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAPKSV 360
            ENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAPKSV
Sbjct: 301  ENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAPKSV 360

Query: 361  GINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYANNS 420
            GINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYANNS
Sbjct: 361  GINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYANNS 420

Query: 421  YNEPNCESVTEYSKAELSSDNWYTTDESDTYISTNIDDNIPYVTFHPNITYPGRYTFNIY 480
            YNEPNCESVTEYSKAELSSDNWYTTDESDTYISTNIDDNIPYVTFHPNITYPGRYTFNIY
Sbjct: 421  YNEPNCESVTEYSKAELSSDNWYTTDESDTYISTNIDDNIPYVTFHPNITYPGRYTFNIY 480

Query: 481  TPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLGSAPEIIVT 540
            TPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLGSAPEIIVT
Sbjct: 481  TPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLGSAPEIIVT 540

Query: 541  WDKAIGESDSVMVVDRLGVITEYIDTISISSNDTTFHLNGLFQYNTANVTASIFSTNDTF 600
            WDKAIGESDSVMVVDRLGVITEYIDTISISSNDTTFHLNGLFQYNTANVTASIFSTNDTF
Sbjct: 541  WDKAIGESDSVMVVDRLGVITEYIDTISISSNDTTFHLNGLFQYNTANVTASIFSTNDTF 600

Query: 601  NDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELNDEALISSSQKLGTSGYTTGIFE 660
            NDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELNDEALISSSQKLGTSGYTTGIFE
Sbjct: 601  NDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELNDEALISSSQKLGTSGYTTGIFE 660

Query: 661  YSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVNFTIDGHELLLFDNAYI 720
            YSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVNFTIDGHELLLFDNAYI
Sbjct: 661  YSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVNFTIDGHELLLFDNAYI 720

Query: 721  FNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLASLSSDGQVSSPT 780
            FNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLASLSSDGQVSSPT
Sbjct: 721  FNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLASLSSDGQVSSPT 780

Query: 781  LPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHMLQIQWSAPINAF 840
            LPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHMLQIQWSAPINAF
Sbjct: 781  LPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHMLQIQWSAPINAF 840

Query: 841  LYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFSTNERXXXXXXXXXXXXI 900
            LYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFSTNER            I
Sbjct: 841  LYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFSTNERVNSMVSFSSNNSI 900

Query: 901  LVGGSYEIDNCNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGKTLLVGGLIKTNNES 960
            LVGGSYEIDNCNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGKTLLVGGLIKTNNES
Sbjct: 901  LVGGSYEIDNCNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGKTLLVGGLIKTNNES 960

Query: 961  NIQLLSVEVGSNIFSTVKSGTEPLLSFVPIDDSTDNIIAQMNSEILRLESGTWSSFGPQL 1020
            NIQLLSVEVGSNIFSTVKSGTEPLLSFVPIDDSTDNIIAQMNSEILRLESGTWSSFGPQL
Sbjct: 961  NIQLLSVEVGSNIFSTVKSGTEPLLSFVPIDDSTDNIIAQMNSEILRLESGTWSSFGPQL 1020

Query: 1021 NNDSIVSGFKVLSGTESKKRDEGSHIVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFVIS 1080
            NNDSIVSGFKVLSGTESKKRDEGSHIVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFVIS
Sbjct: 1021 NNDSIVSGFKVLSGTESKKRDEGSHIVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFVIS 1080

Query: 1081 DPKEQESLPSSSFFQNVNDLYLSSSQTVLQXXXXXXXXXXXXXXXXXXXXXXXKDKKIDR 1140
            DPKEQESLPSSSFFQNVNDLYLSSSQTVLQ                       KDKKIDR
Sbjct: 1081 DPKEQESLPSSSFFQNVNDLYLSSSQTVLQSNNSDTSASSTPTPSTTSSSHSTKDKKIDR 1140

Query: 1141 GFIVLIGLALALATVAVIGLIGALICYFFINNNGYESLKPRINQDEMLDTVPPEKLMKFI 1200
            GFIVLIGLALALATVAVIGLIGALICYFFINNNGYESLKPRINQDEMLDTVPPEKLMKFI
Sbjct: 1141 GFIVLIGLALALATVAVIGLIGALICYFFINNNGYESLKPRINQDEMLDTVPPEKLMKFI 1200

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  858 bits (2216), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/1216 (41%), Positives = 728/1216 (59%), Gaps = 45/1216 (3%)

Query: 13   VLAGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELTVISYTGQQNFT- 66
             L  +V GSQLS++++ LNI     P  D     + ++  + +FE+LT   YTGQ+NFT 
Sbjct: 13   ALCQLVTGSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTG 72

Query: 67   -VQANESSLLYYSNDTFVKLFETSPETT---VTMIVPLFEDSFILSGTGQI-NGVALEQQ 121
             +   E  L+YYSN TF+KL   S E     +  I+P  +DSFILSGTG +  G  LEQQ
Sbjct: 73   SITETEKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQQ 132

Query: 122  ILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTTE 181
            +L NL+SL  + IF  ++  V DIL  +E V F G F  ++ N TGH  VLW+   N  +
Sbjct: 133  LLYNLSSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEIQ 192

Query: 182  LFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDLTSLQFDQ 241
            L PFKGFG +S+VNS+++L++DNI+FAG F  + + +LL++    +NSS ++ T ++FDQ
Sbjct: 193  LLPFKGFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLLKQI-RGSNSS-KNATDIEFDQ 250

Query: 242  SVPLKLSSITGE-NVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYNSVE 300
             +PLK +  + + +++   L+CPS   +GW             L  ++ PSK+RIYN+ +
Sbjct: 251  LIPLKHAGWSSQGSLEHSSLICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRIYNAFD 310

Query: 301  ENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAPKSV 360
             + ++SLFRIIT P+NGIMNLTYLDP +GEL  CDAWCPLLS E L Q   N T +  SV
Sbjct: 311  SDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTISSDSV 370

Query: 361  G-INNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYANN 419
              I NN+TN+KW+ +YQEFAFVN++ V  L F+AL SYGS+  L   E+++  +  +AN+
Sbjct: 371  AYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPTFAND 430

Query: 420  SYNEPNCESVTEYSKAELSSDNWYTTDESD-TYISTNID--DNIPYVTFHPNITYPGRYT 476
            + N+PNC+++  YS A  SS   +T    D +YI +  D   ++P V F+PNITY G YT
Sbjct: 431  TLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGDLPSVNFYPNITYAGDYT 490

Query: 477  FNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLGSAPE 536
             N+ TPGC  D SCS RGIVNVT+ D+  + VL++ LIYQ NN++K+D LY+G L SAP+
Sbjct: 491  LNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYLESAPK 550

Query: 537  IIVTWDKAIG--ESDSVMVVDRLGVITEYIDTISISSNDTTFHLNGLFQYNTANVTA--- 591
            I + + ++I    S S+MV DR+ VI + ID   I        LNGLFQY  +N T    
Sbjct: 551  ITLKFYESINTDSSTSIMVADRVDVIIDSIDQSKIGLKTINETLNGLFQYQISNFTTISN 610

Query: 592  -SIFSTNDTFNDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELNDEALISSSQKLG 650
             S+   N T N Y++ N P ++ L+A   NN +L+ G FNGIA ++LND+  I S Q++G
Sbjct: 611  DSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQLNDDLNIISEQRMG 670

Query: 651  TSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVNFTIDGH 710
            T G T GI  YSNGLL  G + + +  +   LSY+G  F+SFG L   I R  N TID  
Sbjct: 671  TGGPTEGINTYSNGLLFLGDFNLSS-QQISTLSYNG-TFSSFGNLRTNITRFNNITIDDS 728

Query: 711  ELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLASL 770
            ELL+F+N YIFNVS+N Y+ N+S+F ++  SAG NS  D +L G+  +R   ELNG   +
Sbjct: 729  ELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQRQYTELNGAVYI 788

Query: 771  SSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHMLQ 830
            +    +S+  LP      + Y A YIND+S AYA    S ++  H VLI   N S   L 
Sbjct: 789  NDANSISTIGLPSFDGK-RVYTATYINDSSTAYAYS--SKNDSTHHVLIARGNRSED-LP 844

Query: 831  IQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFSTNERXXX 890
            + WS  +N  +Y+   ++LA+GTN  +++       S+ N++  + +   N         
Sbjct: 845  VSWSHAVNTMIYNKDDSLLAVGTNAGDTNG---TSLSLFNISNSKMIGEENLGAKSSVNA 901

Query: 891  XXXXXXXXXILVGGSYEID----NCNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGK 946
                     +LVGG + ID    +C+ LCLYNY   +W++F N+SI+G+I  +QF + G 
Sbjct: 902  IVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDLQFFN-GT 960

Query: 947  TLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLLSFVPIDDSTDNIIAQMNSEIL 1006
             LL+ G + T NE+ I L  + + SN  + ++ G+  + SFV  D +TD +I Q ++EI 
Sbjct: 961  QLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHTTDELITQSDNEIS 1020

Query: 1007 RLESGTWSSFGPQLNNDSIVSGFKVLSGTE-SKKRDEGSHIVLLEGTLNSSEWGNLTSVV 1065
               +G W +   +  NDS+  G +++   + S KRD  +  +L+ G L  S +G++++++
Sbjct: 1021 YYTNGEWKNLTSEDFNDSLYMGAQLIPLKQTSSKRDVSNRALLVNGDLKHSTYGSVSAML 1080

Query: 1066 YDGSTQKWQPYFVISDPKEQESLPSSSFFQNVNDLYLSSSQTVLQXXXXXXXXXXXXXXX 1125
            YD   + W PYF++     + +  +S+ F N +   L ++QT+LQ               
Sbjct: 1081 YD--FEDWMPYFIV---DGENAGRASNIFMNKDLSSLYTTQTILQGSNTSTSTTSSNMPS 1135

Query: 1126 XXXXXXXXKDKKIDRGFIVLIGLALALATVAVIGLIGALICYFFINNNG-YESLKPRINQ 1184
                       KIDRGF+VLIGLALA+ TVAV+G  GA+I YFF  N G YE LKPR+++
Sbjct: 1136 ETSDKNESSSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAYFFAGNKGQYEPLKPRVDE 1195

Query: 1185 DEMLDTVPPEKLMKFI 1200
             +M+DTVPPEKLMKF+
Sbjct: 1196 GDMIDTVPPEKLMKFV 1211

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/1234 (36%), Positives = 672/1234 (54%), Gaps = 69/1234 (5%)

Query: 8    IYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWD----SPDLTYMNNFEELTVISYTGQQ 63
            + VL  LA     S LSNI KLLNI  +E PN +    S  +  + + E L    Y GQQ
Sbjct: 10   LVVLFSLANNATASSLSNILKLLNIQEFELPNLNFNNTSNSIQLLGDVENLQFYHYEGQQ 69

Query: 64   NFTVQANE-----SSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVAL 118
            NFT   N      ++L+YYS+D  ++L   S +T +  I+P+ +DSF+LSG+G +NG AL
Sbjct: 70   NFTDDGNSGISSTNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSGSGHLNGYAL 129

Query: 119  EQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVAN 178
             +Q+L NLT+L+  PIF   + N+  IL   E V F G F+    ++     + W++ ++
Sbjct: 130  GRQLLYNLTTLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVISWNMTSD 189

Query: 179  TTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLL-----QEFGNATNSSHED 233
                 PF+GFG +S VNS++KLN DNILF G F  + N+SLL       F N TNS+ E+
Sbjct: 190  EVIELPFQGFGSDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNFTNST-EN 248

Query: 234  LTSLQFDQSVPLKLSSITGENVQSDI--LLCPSGGQNGWSASEAVQSTLQFDLKNEIHPS 291
             +++Q +Q + LK ++        D    +C +G    W   E     LQ +  N + PS
Sbjct: 249  SSTIQLEQQISLKYATWDAGTAYFDQNNFVCEAGSSEAWIV-EGRSGNLQLNFPNTVSPS 307

Query: 292  KVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQ 351
            K+RIYN+      +SLFRI+T PSNGIMNLTY+DP +G+LK CDA+CPLL+   L   S 
Sbjct: 308  KIRIYNANTAEDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSGLETASS 367

Query: 352  NSTAAPK-SVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFE 410
            NST+  +  V INNN+T++ WSESYQEFAF+N+I V+ L  +A  SYGS  AL  IE+F+
Sbjct: 368  NSTSETRQRVFINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALSGIELFQ 427

Query: 411  TEFMVYANNSYNEPNC--ESVTEYSKAELSSDNWYTTDESDTYISTNIDDN---IPYVTF 465
                 YANN+ N+P C  ES + +S + LS + WY   +SD+YI+ N   +   +P V F
Sbjct: 428  DSHTAYANNTLNQPGCDTESTSLFSSSVLSDNGWYKGLDSDSYIAANYQSDSSPLPTVQF 487

Query: 466  HPNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDP 525
            +PNI   G ++  +YTPGCL D +C  R IVNVT++D +   VL++ LIYQ NNE K+D 
Sbjct: 488  YPNIQAVGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNNEMKYDE 547

Query: 526  LYTGSLGSAPEIIVTWDKAI--GESDSVMVVDRLGVITEYI--DTISISSN--DTTFHLN 579
            ++ G L  +PEI +T+   I      +++V DR+ +   YI  D I + SN   T+  LN
Sbjct: 548  IFNGKLTVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDILLDSNLKSTSLKLN 607

Query: 580  GLFQYNTANVTASIFST--NDTFNDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVEL 637
            GLFQY  +N T+   +   N++ +  AL  FP   +L   + NN I + G+ + I +++L
Sbjct: 608  GLFQYQLSNFTSDTKTKVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLAGSTSNIVQLQL 667

Query: 638  NDEALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDE 697
            N +  + ++  +   G TT I  YS GLL  G Y + + +  + LS++G  F+SF QL +
Sbjct: 668  NSDLELRNTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNG-TFSSFSQLGD 726

Query: 698  PIDRIVNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFL 757
             +    NFT +G ELL F+N Y++NVS+  Y+ N++ F  +  + G NS ND+LL G+ +
Sbjct: 727  NVTTFANFTYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSNNDTLLLGNIV 786

Query: 758  KRSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRV 817
            +      N    L  +  + S T     + + PY A ++NDT+  YA ++G       ++
Sbjct: 787  RSEYSNFNEPLKLYGNSSLESLT---FSSSIVPYAAVFLNDTANLYAYKDGE----NSKI 839

Query: 818  LITNTNSSSHMLQIQWSAPINAFLYDNVPNIL---AIGTNGSNSSSQYDVQFSILNLTGY 874
            +  N  ++S    + +S  +N   + N  ++L   AI  NGS+S         I N++  
Sbjct: 840  IYGNNMTTS----LDFSGTLNKLSFSNNSSLLFANAITNNGSSS-------LVISNISDG 888

Query: 875  ENVARVNFSTNERXXXXXXXXXXXXILVGGSYEID--NCNDLCLYNYQTKEWTSFLNDSI 932
             ++A  N +                ILV G++ +D  +C+ +CLYNY TK+W++F N +I
Sbjct: 889  MSLASENLNNYGYITSMIDFNSNNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTI 948

Query: 933  TGDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEV-GSNIFSTVKSGTEPLLSFVPID 991
             G I +MQ  +  + +L+ GL    N S+I L S+++ G NI          + SF+   
Sbjct: 949  KGSIVEMQLWNSDQ-ILISGLFSAQNYSSITLASLDIKGYNISVLSDDSKIEISSFIHDG 1007

Query: 992  DSTDNIIAQMNSEILRLESGTWSSFGPQLNNDSIVSGFKVLSGTESKKRDEGSHIVLLEG 1051
             S   I    N  I+  +S  W+           +   + +S          S I+   G
Sbjct: 1008 QS---ITVWSNDTIMEYKSEKWNEISFPNTTSKYIESVEAVSIDLQNSTSNVSKILFAYG 1064

Query: 1052 TLNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNVNDLYLSSSQTVLQX 1111
              NS+ +G L ++++      W+PYF I++ +  E  P+ + F+N +   L +S+  L  
Sbjct: 1065 EFNSTLYGRLNAMLFRAG--DWKPYFSINNFQVNED-PAITLFENRDLSSLFNSKNSLPA 1121

Query: 1112 XXXXXXXXXXXXXXXXXXXXXX-----KDKKIDRGFIVLIGLALALATVAVIGLIGALIC 1166
                                       K  KIDRGF+VLI LALA+ TVA++GL G  I 
Sbjct: 1122 NITSAETSSRSTVSSATATTVVNKIEGKHSKIDRGFVVLIALALAVGTVALLGLFGVTIA 1181

Query: 1167 YFFINNNGYESLKPRINQDEMLDTVPPEKLMKFI 1200
            Y F +   YES+KPRI+  EMLDTVPPEKLMKFI
Sbjct: 1182 YIFRDEQKYESIKPRIDGQEMLDTVPPEKLMKFI 1215

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/1250 (35%), Positives = 688/1250 (55%), Gaps = 98/1250 (7%)

Query: 7    LIYVLL---VLAGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELTVIS 58
            L + LL    L  +  GSQLS++++LLN S  + P  D     +  L  + +F++LT   
Sbjct: 2    LFFALLSFYFLLAITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYK 61

Query: 59   YTGQQNFTVQANESS----LLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQIN 114
            YTGQ+NFT   N S+    L+YYSNDTF++L   S +T +  IVPL EDSFILSG+G I+
Sbjct: 62   YTGQENFTSPLNSSTDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHID 121

Query: 115  GVALEQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWD 174
            G  L++Q+  NLT L+  PIF   +  V  IL     V F GNF+ S  ++TGH  VLW+
Sbjct: 122  GYNLQRQLHYNLTDLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWN 181

Query: 175  VVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQE--FGNATNSSHE 232
               N+T L PF GFG+NS VNS+++L+ DNILFAG+F E+ +  LL+    G+  +SS  
Sbjct: 182  SEKNSTSLLPFIGFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLLENHILGSNNSSSKS 241

Query: 233  DLTSLQFDQSVPLKLSSITGENVQ--SDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHP 290
            + T ++   ++PL+ ++ T  + Q  +D  +CP   +  W  S     +L   L  E  P
Sbjct: 242  NWTDVELGLAIPLQNANWTSSSSQFDADDFICPDPERESWLQS-GTSGSLACSLPQETTP 300

Query: 291  SKVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQIS 350
             K+RIYNS  E++E+SLFRI+  P+ GI+NL+Y+DP  GEL+ CDA+CPL + + L + S
Sbjct: 301  YKIRIYNSPVEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEAS 360

Query: 351  QNSTAAPKSVGI-NNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIF 409
             NS++        +NN+T++KW   +QEFAFVN++P++ ++FVAL+SYGSN  L S + F
Sbjct: 361  SNSSSVENMTTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFF 420

Query: 410  ETEFMVYANNSYNEPNCESVTEYSKAELSSDNWYTTDESDTYISTN-IDD--NIPYVTFH 466
            ++   +YANNS N+P C  +  YS A +S+++W       TY+ST+ ++D  NIP VTFH
Sbjct: 421  QSRASIYANNSLNQPACGKMQSYSNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFH 480

Query: 467  PNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPL 526
            P I YPG Y+  +YTPGCL D +C++R IVNVT+ D   NE L+S +IY+ NNE K+D L
Sbjct: 481  PQIQYPGNYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDEL 540

Query: 527  YTGSLGSAPEIIVTWDKAIGESD--SVMVVDRLGVITEYIDTISISSNDTTFHLNGLFQY 584
            + G L S+P++ + +   I  ++  SV+V D + +  +  D       D T  LNG+FQY
Sbjct: 541  WDGHLKSSPKVTLEYHSPIYPNNPTSVVVADYISLEAKSFDHFEKHKKDIT--LNGIFQY 598

Query: 585  NTANVTASIFSTNDTFNDYALYNFPL-----DANLYAASLNND-ILIGGNFNGIAKVELN 638
              +N T +I  T ++  + +L  FPL     +++L+A+   ND +L+  + +  A+++L+
Sbjct: 599  QISNFTKNI--TKESIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAEIKLD 656

Query: 639  DEALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHE--ILSYDGNAFNSFGQLD 696
                + SS+    +    GI  YS+GL+L G Y   N S+ +   LS++G +FNS+ +++
Sbjct: 657  KNWSVDSSKSFNLASQVRGIGSYSDGLILFGDY---NSSQRQPLALSFNG-SFNSYDKIN 712

Query: 697  EPIDRIVNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSF 756
              ++R  N  + G ELL+FDN + +NVS+  YVSN++ F ++  SAG N+  D +  G+ 
Sbjct: 713  RSVERFTNIDLKGTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAV 772

Query: 757  LKRSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHR 816
                   L G  SL  +G   S  + +   ++ PY  AY+NDT  AYA ++GS      R
Sbjct: 773  SDNDYENLQGPVSLFQNGSAVSSNIKD---NINPYMGAYLNDTLTAYAYKDGS----DSR 825

Query: 817  VLITNTNSSSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYEN 876
            ++ +N +        +W+  I   +Y N   +LA+GT+ S S  Q  V    LNLT  E 
Sbjct: 826  IVFSNGDEGPW----RWTNSIETMIYRNRDALLALGTSSSPSLPQLSV----LNLTTSEV 877

Query: 877  VARVNFSTNERXXXXXXXXXXXXILVGGSYEIDN--CNDLCLYNYQTKEWTSFLNDSITG 934
            +A                     +L+GG++   +  CN LCLYNY+ K W++F NDSITG
Sbjct: 878  LANETLDKGAEVNSMILFGKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITG 937

Query: 935  DIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTE-PLLSFVPIDDS 993
             + Q+Q  +  + LL+ G ++ N  S++ L+SV +      T+  G E PL SFV    S
Sbjct: 938  QVTQVQLRNSSE-LLIAGSLRVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVV---S 993

Query: 994  TDNIIAQMNSEILRLESGTWSSFGPQLNNDSIVSGFKVLSGTESKKRDEGSHIVLLEGTL 1053
             D ++   ++ ++  ++ +W                   S + S  + +  H V LE +L
Sbjct: 994  EDRLVVWNDTSLMAYDNTSWRHIST--------------SNSTSFTKLQDIHQVSLEHSL 1039

Query: 1054 ----NSSEWGNLTSVVYDGSTQ--------------KWQPYFVISDPKEQE-SLPSSSFF 1094
                NSS   NL  ++  G+ +               W P F+ +   E   S P+    
Sbjct: 1040 EKRANSSSNSNLDGLLVYGNDKTQGDSYQASIYDYYSWTPLFIANSKSENSNSGPNIFMN 1099

Query: 1095 QNVNDLYLSSSQTVLQXXXXXXXXXXXXXXXXXXXXXXXKDK---KIDRGFIVLIGLALA 1151
            Q+V+D ++S                              K +   K+DRG++VLIGLALA
Sbjct: 1100 QDVSDFFISEQMLPNPTNHTSSRSSSSSSSAVTSNSGDKKHRASHKVDRGYVVLIGLALA 1159

Query: 1152 LATVAVIGLIGALICYFFINN-NGYESLKPRINQDEMLDTVPPEKLMKFI 1200
            + TV VIG+ G LI Y F  +  GYE L P     +  +T PP K  KF+
Sbjct: 1160 IGTVVVIGVFGILIAYMFGEDIGGYEFLSPPAEGTKAAETAPPAKSSKFL 1209

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  686 bits (1769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/1225 (36%), Positives = 673/1225 (54%), Gaps = 64/1225 (5%)

Query: 7    LIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWDSPD--LTYMNNFEELTVISYTGQQN 64
            L+++L     +   SQL N++    I     P  D P   L     F  LT   Y GQ+N
Sbjct: 4    LLFLLFQSVCLSLASQLENLKNKHGIVNIGTPRLDFPGEALQLFGGFNALTFPQYEGQEN 63

Query: 65   FTVQANESS----LLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALEQ 120
            FT   N ++    ++YYSNDTF+KL   S ++ V  IVP   +SFIL G+G + G  L +
Sbjct: 64   FTGTINNNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPFGSESFILGGSGSLLGYELGR 123

Query: 121  QILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTT 180
            Q+L NL+ L+  PIF +++ +V  IL       F GNFS    +  GH    W+  +NTT
Sbjct: 124  QLLYNLSDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNSSSNTT 183

Query: 181  ELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDLTSLQFD 240
             L PF GFGE SIVNS++KL+SDNILF G F  + + +LL    N + ++H    S++ +
Sbjct: 184  SLLPFGGFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQ--SIEIN 241

Query: 241  QSVPLKLSS---ITGENVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYN 297
            + +PL+ ++    +  +  S   +CP+  +  WS   +   +L+  L  E +P KVRIYN
Sbjct: 242  ELLPLRAATWNTDSDSSFDSSAFICPNSQKEAWSV-PSTSGSLEASLPYESYPKKVRIYN 300

Query: 298  SVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAP 357
            S EE++ +SLFRIIT PSNGIMNLTY+DP SGEL  CDA+CPL+  + L     N   + 
Sbjct: 301  SPEEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTS- 359

Query: 358  KSVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYA 417
            + V ++NN T+++WS  YQ+FAFVN I VT LQF+AL+SYG    L S ++++     YA
Sbjct: 360  QVVRLDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYA 419

Query: 418  NNSYNEPNCESVTEYSKAELSSDNWYTTDESDTYISTNI---DDNIPYVTFHPNITYPGR 474
            NNS NE  CES    S + LS   W       +Y+  +     + +P VTF+P I Y G+
Sbjct: 420  NNSLNEVGCESNDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQ 479

Query: 475  YTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLGSA 534
            YT N+YTPGC  D +C+ R IVNVTM       +L+S+L++Q N   K+D +Y+G L +A
Sbjct: 480  YTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETA 539

Query: 535  PEIIVTWDKAIGESD--SVMVVDRLGVITEYIDTISISSNDTTFHLNGLFQYNTANVTAS 592
            P + + +   I  ++  +V+V DRL VI E +D +  +  D T  LNG+FQY  +N T S
Sbjct: 540  PVLTLEYYSPISPNNPSNVVVADRLEVIVESVDILK-NQTDETIPLNGMFQYQLSNFTNS 598

Query: 593  IFS----TNDTFNDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELNDEALISSSQK 648
              S     N T N Y + NFP +A+L+++  NN + +GG+ +G+A VEL+++  +SS+ K
Sbjct: 599  TDSKPSIANTTLNSYTVQNFPKNASLFSSMYNNTLWVGGSVSGVAAVELDEDLHVSSTAK 658

Query: 649  LGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVNFTID 708
              T G   GI  YS+G++L GT+ + +      L+++G  F SFG L+  +    N +  
Sbjct: 659  YATGGTVEGISSYSDGIILFGTFNLSSQPV-STLTFNG-VFGSFGNLETTLRTYTNVSFQ 716

Query: 709  GHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLA 768
              ELL+F+N Y+FN+S+N Y+SNSSTF ++  SAG N  +D+L  G+  K     L G A
Sbjct: 717  QDELLVFNNEYVFNLSSNSYISNSSTFGLSLWSAGRNQFDDTLFSGAVTKNQFPGLYGSA 776

Query: 769  SLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHM 828
            S+ S+  V+  +L       QPY A ++ND+  AYA + GS      ++   N       
Sbjct: 777  SIYSNSSVAHFSLQN---GAQPYAACHLNDSVTAYAYRYGSVS----QLYFDNGKEGPWT 829

Query: 829  LQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFSTNERX 888
                W   IN+  Y     ILAIGT+GS      +   S+ NLT ++ +A    S N   
Sbjct: 830  ----WFGTINSMRYSKNSTILAIGTDGSTD----EPILSLFNLTSFDVLANTTISENGTI 881

Query: 889  XXXXXXXXXXXILVGGSYEIDN--CNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGK 946
                       +LVGG Y I +  C+ LCLYNY  K+WT F N+SITG+I +MQ + E  
Sbjct: 882  SSMVFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLS-ESY 940

Query: 947  TLLVGGLIKTNNESNIQLLSVEVGS-NIFSTVKSGTEPLLSFVPIDDSTDNIIAQMNSEI 1005
             LL+ G +   N++++ LLS  + +  +   V     P+ SF+  D+   +II    + +
Sbjct: 941  DLLISGAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIAEDN---DIITWNETSL 997

Query: 1006 LRLESGTWSSFGPQLNNDSIVSGFKVLS-----GTESKKRDEGSHIVLLEGTLNSSEWGN 1060
                 G W +   + +N S++S   V++       + ++    +   +L    N +E+  
Sbjct: 998  SGYSDGDWQNL--EFDNSSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAGQNYAEYPQ 1055

Query: 1061 LTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNVNDLYLSSSQTVLQXXXXXXXXXX 1120
             +  +Y+   Q+W PY+V ++  + E    ++FF N +D  L  SQ +L           
Sbjct: 1056 AS--IYN--FQRWLPYYV-ANKADDEDPSRTTFFTNQDDSQLYDSQNLLSDPTRTTTSSS 1110

Query: 1121 XXXXXXX-----XXXXXXKDKKIDRGFIVLIGLALALATVAVIGLIGALICYFFINNNGY 1175
                              K  KI+RGF+VLIGLALAL TV +IG+ G L+   F  ++GY
Sbjct: 1111 SSTTSSSQTSPSKGSLVRKSGKINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSGY 1170

Query: 1176 ESLKPRINQDEMLDTVPPEKLMKFI 1200
            E + PR ++ EM+DTVPPEKL+KF+
Sbjct: 1171 EQVDPRADESEMIDTVPPEKLLKFL 1195

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1234 (35%), Positives = 704/1234 (57%), Gaps = 84/1234 (6%)

Query: 19   RGSQLSNIEKLLNISRYEAPNWD-SPD----LTYMNNFEELTVISYTGQQNFTVQ----A 69
            + SQL +I+ LL+I     P+ + S D    +  +   + L+   YTGQQNFT +     
Sbjct: 19   KASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQNFTKEIGSET 78

Query: 70   NESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALEQQILLNLTSL 129
            N   L+YYSN+T++ L E   +T +  I P   DSFILSG+G INGV L  Q+L NL++L
Sbjct: 79   NSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLGNQVLYNLSTL 138

Query: 130  TTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTTELFPFKGFG 189
            + + IF  ++ +V  +L  + +V F GNFS +  + TGHGA++WD  +NTT+L PF GFG
Sbjct: 139  SMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNTTQLLPFGGFG 198

Query: 190  ENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDL--TSLQFDQSVPLKL 247
            E+S VNS+VKLN DNILFAG F  + ++S+L      T ++   L  T+L+  Q +PL+ 
Sbjct: 199  EDSNVNSIVKLNDDNILFAGKFYTLDDSSILTTSSTNTTNASSTLNATTLELGQRIPLRY 258

Query: 248  SSITGEN---VQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYNSVEENSE 304
            +S   +     +S  L+CP   ++ W        +L   L  E+ P+K+R+YNS   +++
Sbjct: 259  ASWDSQGSTTFESSYLVCPDTSKDAW-LYPGTSGSLVCTLPYEVAPTKIRLYNSPNSDND 317

Query: 305  ISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAPKSVG-IN 363
            ISLF+I+T PS  IMNLTYLDP SGEL+ CD +CPL S + L   SQN +++   +  I+
Sbjct: 318  ISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQNVSSSLDMISFID 377

Query: 364  NNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYANNSYNE 423
            NN+T++KWS  +Q+FAF N++ VT L+F AL SYG+   L  +E+++  F  YANNS NE
Sbjct: 378  NNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQDTFSTYANNSLNE 437

Query: 424  PNCESVTEYSKAELSSDN-WYTTDESDTYISTNIDDN----IPYVTFHPNITYPGRYTFN 478
              C ++   S + + SDN WY      +YI+ +   N     P VTF+P+I +PG YT N
Sbjct: 438  YGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFYPSIIHPGHYTIN 497

Query: 479  IYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLGSAPEII 538
             YTPGC+QDN+CS RGIVNVTM +   N ++ + LIYQ NN  K+D +Y+G L  +PEI+
Sbjct: 498  TYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKIYSGYLDFSPEIV 557

Query: 539  VTWDKAIGESDS--VMVVDRLGVITEYIDTISISSNDTTFH----LNGLFQYNTANVTAS 592
            + +   I  S++  +MV D++ +IT+ +D+ S  S  T+      LNG+ QY  +N TA+
Sbjct: 558  MKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRHTPLNGILQYQRSNFTAT 617

Query: 593  IFS----TNDTFNDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELNDEALISSSQK 648
              +     N T N +++ N+P +++++A   +  +++GG  N I+ ++ ND   ++SS+ 
Sbjct: 618  TSNGTKIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHISVIDFNDNLEVTSSEN 677

Query: 649  LGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVNFTID 708
                G   G+ + + GLL+ G  +  +D++  +L ++G +F S     + ++  +N T+ 
Sbjct: 678  KTIQGDVYGMTQTNQGLLIFGDVR-SSDNKSTVLMFNG-SFESVSNYSKAVENAINITLA 735

Query: 709  GHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLA 768
             ++L++F+N YIFN S+N  +SNS++F ++  SAG N  +D L  G+  +    +L+G A
Sbjct: 736  NNDLIVFNNDYIFNASSNSQISNSTSFSLSLWSAGNNDNDDVLFSGAVSQMQFSDLSGSA 795

Query: 769  SLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHM 828
               ++  V +  L +    + PY  AY+N+++ AYA +     N   ++  +N  S S  
Sbjct: 796  RFLNESTVEALNLNK---GIVPYLGAYLNESTIAYAYKT----NSLSKIYFSNNVSPSW- 847

Query: 829  LQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFSTNERX 888
                WS  I   +Y N   +L IG+  S ++     + SILNL  +  +A     +N + 
Sbjct: 848  ---NWSNNITKMVYANNQTLLVIGSESSTTA-----ELSILNLRNFTTIANETLGSNAKI 899

Query: 889  XXXXXXXXXXXILVGGSYEID--NCNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGK 946
                       +LVGG +++   NC  LC+YNY++K W++F N++I G+I Q+ F +E +
Sbjct: 900  NAFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESE 959

Query: 947  TLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLL-SFVPIDDSTDNIIAQMNSEI 1005
             L++ GL  T  + +I+L S  + ++    + +G+   L SF   ++S   I+A  ++ +
Sbjct: 960  -LIISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEES---IVAWNDTSL 1015

Query: 1006 LRLESGTWSSFGPQLNNDSIVSGFKVLSGTES---KKRD----EGSHIVLLEGTLNSSEW 1058
            L  +   W++     N  S+ S   + + T+S   +KR     E   I+LL G  +  ++
Sbjct: 1016 LIYKDQKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQY 1075

Query: 1059 GNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNV-----------NDLYLSSSQT 1107
            GNL  +++D  +Q W PYF        E+L +SS+   +           + + LS+S  
Sbjct: 1076 GNLQGLLFD--SQNWTPYFT------SETLEASSYNPTIFINRDVSADFNSQIPLSNSNM 1127

Query: 1108 VLQXXXXXXXXXXXXXXXXXXXXXXXKDKKIDRGFIVLIGLALALATVAVIGLIGALICY 1167
             +                        K K +DRGF+VLIGLALAL TV+V+G++G ++ Y
Sbjct: 1128 TV-TSPQSTSPLSPSSSASSEPNKKSKKKNMDRGFVVLIGLALALGTVSVLGIVGVILAY 1186

Query: 1168 FFINNNG-YESLKPRINQDEMLDTVPPEKLMKFI 1200
             F +  G Y  +KPRI+++EMLDTVPPEKLMKF+
Sbjct: 1187 VFKDPEGDYRPIKPRIDENEMLDTVPPEKLMKFV 1220

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/1246 (35%), Positives = 706/1246 (56%), Gaps = 72/1246 (5%)

Query: 1    MFSINPLIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELT 55
            MF       +   LA   + SQL NI+ LL+I     PN +     S  +  +   + L+
Sbjct: 1    MFVHRLWTLIFPFLAQASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALS 60

Query: 56   VISYTGQQNFTVQ----ANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTG 111
            +  YTGQQNFT +     N   L+YYSN+T++++ + S +T +  I P   DSFILSG+G
Sbjct: 61   LYEYTGQQNFTKEISPGTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSG 120

Query: 112  QINGVALEQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAV 171
             IN + +  QIL NL++L+ +PIF   + +V  +L    +V F GNFS +  + TGH A+
Sbjct: 121  TINNMPIGNQILYNLSTLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSAL 180

Query: 172  LWDVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFG--NATNS 229
            +WD ++N T+L PF GFGENS VNS++KLN DNILFAG F  + ++S L   G  N TNS
Sbjct: 181  IWDSISNKTQLLPFGGFGENSNVNSIIKLNDDNILFAGKFYTLDDSSALITAGSNNTTNS 240

Query: 230  -SHEDLTSLQFDQSVPLKLSSITGEN---VQSDILLCPSGGQNGWSASEAVQSTLQFDLK 285
             S  + T L+  Q +PL+ ++   +     +S+ L+CP+  ++ W    A   TL   L 
Sbjct: 241  TSLLNATKLELGQRIPLRYATWDFQGSTTFESNSLVCPNANEDAW-VYPATSGTLVCKLP 299

Query: 286  NEIHPSKVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIED 345
             E+ P+KVR+YNS + + EIS+F+I+T PSN IMNLTYLDP SG+LK CD +CPL S   
Sbjct: 300  YEVSPTKVRLYNSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRAT 359

Query: 346  LTQISQNSTAAPKSVG-INNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALH 404
            L   SQN ++    +  ++NN+T++KWS  +Q+FAF N++PVT+L+F A+ SYG +  L 
Sbjct: 360  LLSASQNVSSPMDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLS 419

Query: 405  SIEIFETEFMVYANNSYNEPNCESVT-EYSKAELSSDNWYTTDESDTYIST----NIDDN 459
             +E+++  F  YANNS NE  C ++  + S + LSS++WY     ++YI+T    N D+ 
Sbjct: 420  GLELYQDTFSTYANNSLNEYGCSALANDSSSSTLSSNSWYNGLGGESYIATEYVPNQDEP 479

Query: 460  IPYVTFHPNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNN 519
             P V F+PNI +PG Y  N YTPGC+QD++CS RGIVNVTM +     ++ +  IYQ N+
Sbjct: 480  TPRVNFYPNIVHPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNND 539

Query: 520  EDKFDPLYTGSLGSAPEIIVTWDKAIGESD--SVMVVDRLGVITEYID---TISISSNDT 574
              K+D +Y+G L  +PEII+ +   I  S+  +V+V D++ VIT  +D   T+S S+N  
Sbjct: 540  NLKYDQIYSGYLDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTK 599

Query: 575  TF-HLNGLFQYNTANVTASIFST----NDTFNDYALYNFPLDANLYAASLNNDILIGGNF 629
             +  LNG+ QY  +N T++  +     N T N +A+ N+P +++L+A +  + +++GG  
Sbjct: 600  EYIPLNGVLQYQKSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTN 659

Query: 630  NGIAKVELNDEALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAF 689
            N I+ + LND   +  S+K    G   G+ + S GLL+ G     N+ +  +L ++G+  
Sbjct: 660  NHISIIGLNDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDLLSSNN-QSSVLLFNGSFE 718

Query: 690  NSFGQLDEPIDRIVNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGND 749
            N F      ++  +N ++  ++L++FDN YI N S++  + NS++F ++  SAG N  +D
Sbjct: 719  NVF-NYSRTVNSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDD 777

Query: 750  SLLFGSFLKRSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGS 809
             L  G+  +   G LNG A   S+ +V +  L      V PY AAY+N+++ AYA +   
Sbjct: 778  VLFSGAVSRMQFGGLNGSARFLSEDKVQALNLDNA---VVPYLAAYLNESTTAYAYET-- 832

Query: 810  TDNVQHRVLITNTNSSSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSIL 869
              N+ +++  +N    S      WS  I   LY N  ++L +G+  S ++     + SI 
Sbjct: 833  --NLLNKIYFSNNVDPSW----NWSTSITRMLYANNQSLLTVGSESSTTA-----ELSIF 881

Query: 870  NLTGYENVARVNFSTNERXXXXXXXXXXXXILVGGSYEID--NCNDLCLYNYQTKEWTSF 927
            NL  +  +A     +N +            +LVGG++++   NC+ LCLYNY++K W++F
Sbjct: 882  NLKNFTMIANETMGSNAKINALVNFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTF 941

Query: 928  LNDSITGDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLL-S 986
             N++  G+I Q+ F+   + L++ GL  T    +++L S  + ++    + +G E  + S
Sbjct: 942  FNNTFFGEITQLSFSAASQ-LVISGLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINS 1000

Query: 987  FVPIDDSTDNIIAQMNSEILRLESGTWSSFGPQLNNDSI--VSGFKVLSGTESKKRD--- 1041
            FV  ++S   I+A  ++ +L      W+      N+ SI  VS     +G  +  R    
Sbjct: 1001 FVVTEES---IVAWNDTSLLIYRDQEWNITSVPGNDSSIGSVSTINTNAGPGTLNRRATN 1057

Query: 1042 --EGSHIVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNVND 1099
              E   I+LL G  +  ++GNL  +++D  T  W PYFV          P+    ++V+ 
Sbjct: 1058 NAENGTILLLSGNFSIPDYGNLQGLLFDFET--WSPYFVSESSNTSNRNPTIFINRDVST 1115

Query: 1100 LYLS----SSQTVLQXXXXXXXXXXXXXXXXXXXXXXXKDKKIDRGFIVLIGLALALATV 1155
             + S    S+  V +                       K K+IDRGF+VLIGLALAL TV
Sbjct: 1116 EFNSQIPLSNLNVTETGPQSASSQFPSSSASSELKPKSK-KRIDRGFVVLIGLALALGTV 1174

Query: 1156 AVIGLIGALICYFFINNNG-YESLKPRINQDEMLDTVPPEKLMKFI 1200
            +V+G+ G ++ Y F +  G Y+ +KPRI+++EMLDTVPPEKLMKF+
Sbjct: 1175 SVLGIAGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/1241 (36%), Positives = 705/1241 (56%), Gaps = 75/1241 (6%)

Query: 8    IYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWD---SPDLTY--MNNFEELTVISYTGQ 62
            ++  L+L  +++ SQLSNI+ +LN++    P  +   S D T+  + + + L+   Y GQ
Sbjct: 6    VFNFLLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQ 65

Query: 63   QNFTVQ----ANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVAL 118
            QNFT      +N + L+YYSN+T ++L E S +T +  I P   DSFILSGTG ++G +L
Sbjct: 66   QNFTTGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFILSGTGSLSGYSL 125

Query: 119  EQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVAN 178
              Q+L NLT+L+  PIF +++E V  IL  +  V F GNF++       H  ++WD  ++
Sbjct: 126  TNQLLYNLTTLSIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSS 185

Query: 179  TTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDLTSLQ 238
            +TE   F GFGENSI+NS+VKLN DNILFAG F  +     L +   ++ ++  + T++ 
Sbjct: 186  STEFLNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFNSTTVD 245

Query: 239  FDQSVPLKLSSI-TGENV-QSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIY 296
              Q VPL  S+  TGE+   SD  +CP   +  W  S    S L   L  E+ P+K+RIY
Sbjct: 246  IGQLVPLSASTWDTGESTFDSDTFVCPDTTEESWIQSGTTGS-LTCKLPFEVAPTKIRIY 304

Query: 297  NSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAA 356
            NS  E++++SLFRI+T  + GIMNLTY+DP S ELK CDA+CPL S   L+Q   N+T+ 
Sbjct: 305  NSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSP 364

Query: 357  PKSVGI-NNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMV 415
              ++ +  +N+T++KW++ +QEFAF+N I V+ +QFVAL SYG+N AL S ++++  + V
Sbjct: 365  SDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAV 424

Query: 416  YANNSYNEPNCESVTEYSKAELSSDNWYTTDESDTYISTNI---DDNIPYVTFHPNITYP 472
            +AN++ NEPNC S+   S + LS+++W       TYIST      D +PYV+F P I YP
Sbjct: 425  FANDTLNEPNCNSIESSSSSSLSANDWEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKYP 484

Query: 473  GRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLG 532
            G+Y+ NIYTPGC QD++CS R IVNVT+ D     +LA+ LIYQ N E K+D LY+G L 
Sbjct: 485  GQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYLS 544

Query: 533  SAPEIIVTWDKAIGESDSV--MVVDRLGVITEYIDTISISSNDTT----FHLNGLFQYNT 586
            S+P + + +   +  S++V  +V DRL V+ + ++   ++SN T      +LNGL QY  
Sbjct: 545  SSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMNLNGLLQYQI 604

Query: 587  ANVTAS------IFSTNDTFNDYALYNFPLDANLYAASLNNDILIGGNFNG-IAKVELND 639
            +N + S      +  TN + N  +L  F  + ++YA   +++ L+ GN NG I  V+LN+
Sbjct: 605  SNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVKLNE 664

Query: 640  EALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDE-- 697
               I SS +   +G T G   YS G+L  G Y + +   + +++Y+G  FN     ++  
Sbjct: 665  NMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITY-LVNYNG-TFNEIPNFNKNS 722

Query: 698  PIDRIVNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFL 757
             I  +VN TI   ELL+ DN  I+NVS++  ++NSS  +++  S+G N   D++  G+  
Sbjct: 723  SITNVVNLTIHDTELLVIDNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDTVFSGAIA 782

Query: 758  KRSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRV 817
                 +LNG  ++ ++  V++ T   + +    Y   ++ND+ + YA +  S       +
Sbjct: 783  LLDYTDLNGSIAIGNNFTVTNIT-NNVSSTNSLYTGLFLNDSLSIYASKTDS----YSEL 837

Query: 818  LITNTNSSSHMLQIQWS--APINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYE 875
            L +N  S+       WS    IN  +Y +   +LA+ ++  N +S+     SILNLT +E
Sbjct: 838  LFSNGYSAP------WSFFEGINYMVYSSHQTMLAVASSDFNKNSE----LSILNLTTFE 887

Query: 876  NVARVNFSTNERXXXXXXXXXXXXILVGGSYEI--DNCNDLCLYNYQTKEWTSFLNDSIT 933
             +A    + N +            ++VGG++ I   NC+ LCLYNY + EW +F N SI 
Sbjct: 888  TIANETLNVNSKINGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSIN 947

Query: 934  GDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLL-SFVPIDD 992
            G I QM+  + G  LL+ GL    N S++ L  +++ +   S++K G   +L SF  I D
Sbjct: 948  GTIAQMELIN-GTQLLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGD 1006

Query: 993  STDNIIAQMNSEILRLESGTWSSFGPQLNNDSIVSGFKVLS-GTESKKRDE--GSHIVLL 1049
                II      +   E+G WS+     N+ + +   + +  G   +KRD    +   ++
Sbjct: 1007 K---IITWNGIMLESYENGAWSTIQSNFNSSTTIRSIEPIGFGPTLQKRDGTGSADGFII 1063

Query: 1050 EGTLNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNVNDLYLSSSQTVL 1109
             G +  +E+G + +++Y+   ++W+PY++IS    Q    +   F N +D  L +SQ+VL
Sbjct: 1064 NGNIYDTEYGTIQAMIYN--FKEWRPYYIISSTNSQ---IAGQIFMNRDDSALYNSQSVL 1118

Query: 1110 Q---------XXXXXXXXXXXXXXXXXXXXXXXKDKKIDRGFIVLIGLALALATVAVIGL 1160
            Q                                  KKIDRGF+VLIGLALAL TV+++G+
Sbjct: 1119 QNPNNATVTTPSSTSSGTPSATHSSQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGI 1178

Query: 1161 IGALICYFFINNNG-YESLKPRINQDEMLDTVPPEKLMKFI 1200
            IG ++ Y F + +G +++L PR N+DEML+TVPPEKLMKF+
Sbjct: 1179 IGLVLAYIFKDGDGSHDALNPRTNEDEMLETVPPEKLMKFL 1219

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  682 bits (1759), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/1228 (35%), Positives = 705/1228 (57%), Gaps = 72/1228 (5%)

Query: 12   LVLAGMVRGSQLSNIEKLLNISRYEAPNW----DSPDLTYMNNFEELTVISYTGQQNFTV 67
            L+L   +  SQLS++++ LNI+    PN     D      +   + L+   YTGQQNFT 
Sbjct: 10   LLLIPQIYASQLSSLQENLNITHINIPNLNLTTDDNSFELLGGIDSLSFYRYTGQQNFTS 69

Query: 68   ----QANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALEQQIL 123
                 +N + L YYSN+TF++L+E S ++ +  I+P   DSFILSG G + G +L  Q+L
Sbjct: 70   GILPNSNSNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFILSGKGSLGGYSLSNQLL 129

Query: 124  LNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTTELF 183
             NL+S +   IF   +++V  IL     V F GNF++S ++  GH   LW+  AN+T L 
Sbjct: 130  FNLSSFSLKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALWNYTANSTSLL 189

Query: 184  PFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDLTSLQFDQSV 243
            PF GFGENS++NS+ KLN DNILFAG F  + N++LL    N  N +  +++ +   Q +
Sbjct: 190  PFVGFGENSLINSITKLNDDNILFAGKFYTLDNSTLL----NVVNDTMRNISDINLGQLI 245

Query: 244  PLKLS--SITGENVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYNSVEE 301
            PL  +  S TG     +  +CP      W        TL  +L  ++ P+K+RIYNS + 
Sbjct: 246  PLSAATWSSTGSFFDEETFVCPDPTIEAW-FQNGTSGTLNCNLPFDVAPTKIRIYNSPDP 304

Query: 302  NSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAPKSVG 361
            ++EISLFRI + PS  IMNLTY+DP  G+LK CDA+CPL + + L   S+N T + + + 
Sbjct: 305  DNEISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLKSASENVTLSSEMIE 364

Query: 362  -INNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYANNS 420
             +N+N+++++WS+ +QEFAFVN +  + L+F+AL SYG+N  L S +I++  + ++ANNS
Sbjct: 365  LLNDNTSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSFQIYQDAYAIFANNS 424

Query: 421  YNEPNCESVTEYSKAELSSDNWYTTDESDTYISTNIDDN---IPYVTFHPNITYPGRYTF 477
             NEP+C S+  +S ++LS++ W    +   Y+ T    +   +P VTFHP++ Y G+Y+ 
Sbjct: 425  LNEPSCNSLESFSSSDLSNNTWTRGMDDQNYVKTTYIPHQGVLPEVTFHPDLKYSGQYSI 484

Query: 478  NIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLGSAPEI 537
             +YTPGC QDN+CS RGIVNVT+ + + N +L++ LIYQ N++ K+D LY+G L  +P+I
Sbjct: 485  ELYTPGCQQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLKYDELYSGYLNYSPKI 544

Query: 538  IVTWDKAI--GESDSVMVVDRLGVITEYIDTISISSNDT-TFHLNGLFQYNTANVTAS-- 592
             VT+   I  G +   +VVDRL ++   +D ++   N T +  LNGLFQY  +N + S  
Sbjct: 545  TVTYHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLELNGLFQYQLSNFSTSSK 604

Query: 593  ----IFSTNDTFNDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELNDEALISSSQK 648
                    N + N   L  F  + +L A+  N+ +L+G   +G++  ELN +  I SS +
Sbjct: 605  DSSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAGDDGLSIYELNKDLAIQSSSQ 664

Query: 649  LGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVNFTID 708
             G  G  TG+  YSNG+L+ G +    +S + +LS++G +F+S G +  PI    N TID
Sbjct: 665  QGIEGKITGLKSYSNGVLVYGDFNSSKESSN-VLSFNG-SFDSIGNITSPITNFANITID 722

Query: 709  GHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLA 768
              ELL+FDN  IFNVS++  +SN+S+F ++  S+G NS  D+L  G+  +     L+G  
Sbjct: 723  DSELLVFDNNLIFNVSSSSQISNTSSFSLSLWSSGSNSNGDTLFSGALSQVQFTNLSGSV 782

Query: 769  SLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHM 828
            S++++  +S+ +L  + +   PY A ++ND+   Y L+    D+    ++ ++ + +   
Sbjct: 783  SIANN--LSATSLRSIGS---PYAAIFLNDSVTGYVLKN---DSSTSEMIFSDGSKAPW- 833

Query: 829  LQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFSTNERX 888
               +W+  +++ LY    ++LA+G     SSS  + + SILNL  ++ +A    + N   
Sbjct: 834  ---RWTGYVDSMLYLTNQSMLAVG-----SSSSVNGELSILNLDSFKVLANETLNQNSSV 885

Query: 889  XXXXXXXXXXXILVGGSYEIDN--CNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGK 946
                       ILVGG++ I N  C  LCLYNY   +W +FLN +I G I ++Q  ++ +
Sbjct: 886  KTMVHFERNSSILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKLQIFNDSQ 945

Query: 947  TLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSG-TEPLLSFVPIDDSTDNIIAQMNSEI 1005
             L++ G+  T ++S++ L  + +  N    ++ G  EP+  F+ ID   DNI A   + +
Sbjct: 946  -LIIAGVFDTKSQSSVNLALMNLTDNKLVLIRWGFKEPVKDFITID---DNIFAWNETSL 1001

Query: 1006 LRLESGTWSSFGPQLNNDSIVS----GFKVLSGTESKKRDE---GSHIVLLEGTLNSSEW 1058
                S +W    P  N++S  +    G+   +    KKRD     +++++++G +  + +
Sbjct: 1002 FEYTSNSWVDI-PISNSNSSTTIDSIGWTTTTDNNLKKRDNSETSNNVLIVKGQIYDNVY 1060

Query: 1059 GNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFF-QNVNDLYLSSSQTVLQXXXXXXX 1117
            G++ +++Y+   ++W PY  I+      + P+  F  ++V+ L+   SQ  LQ       
Sbjct: 1061 GHIQAMIYN--FEEWIPYLSINSLVSSANQPAELFIDRDVSKLF--DSQLALQVSNTTAS 1116

Query: 1118 XXX----XXXXXXXXXXXXXKDKKIDRGFIVLIGLALALATVAVIGLIGALICYFFINNN 1173
                                  KKIDRGF+VLIGLALAL T+ V+G++G ++ Y F +++
Sbjct: 1117 ITASSSTPTPTSSPKKKLHQSKKKIDRGFVVLIGLALALGTMTVLGIVGVILAYAFRDDD 1176

Query: 1174 G-YESLKPRINQDEMLDTVPPEKLMKFI 1200
            G Y+ + PR+N+DEML TVPPEKLM+FI
Sbjct: 1177 GDYDVITPRVNEDEMLKTVPPEKLMEFI 1204

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1227 (36%), Positives = 690/1227 (56%), Gaps = 55/1227 (4%)

Query: 9    YVLLVL---AGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELTVISYT 60
            Y LLVL   AG+ +GSQ++ +    NI++Y AP+ D     +  L   ++F+     +Y 
Sbjct: 6    YTLLVLSFVAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYK 65

Query: 61   GQQNFTVQANE--SSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVAL 118
            GQQ FT  A+E  +SL+YYSN+T+V+L E      +  IVP  +DSFILSG G   G  L
Sbjct: 66   GQQIFTGLADERKNSLIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVFEGHRL 125

Query: 119  EQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVAN 178
            E Q++ NL+S   + I    +E+V DILT  E V F G F+ +  N +GH  V WD    
Sbjct: 126  EHQLIYNLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDK 185

Query: 179  TTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDLTSLQ 238
            ++ L PF GFG+ S+VN+++KL+  NILF G F  I N +LL    N ++S   + T+++
Sbjct: 186  SSSLLPFYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPH-RNVSSSFLSNSTNIE 244

Query: 239  FDQSVPLKLSSITGEN-VQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYN 297
             +    L+ SS+  +  + S   +CP G  + W+   +    L   + N++ PSK+RIYN
Sbjct: 245  TNALASLRFSSLVHDGTLNSSAFVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYN 304

Query: 298  SVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAP 357
            S + N++++LFRI+T PS  IMN+TY+DP +G L  CDAWCPL  +  L+ +++NST++ 
Sbjct: 305  SKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENSTSSV 364

Query: 358  KSVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYA 417
             +   NNN+  +KW+ +YQEFAFVN +P+  L F+A+ S+G N  L  IE+F+ E+  Y 
Sbjct: 365  MAAFPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTYV 424

Query: 418  NNSYNEPNCESVTEYSKAELSSDN-WYTTDESDTYISTNIDDNIPYVTFHPNITYPGRYT 476
            NN+ N+PNC+S   +  + +S D  WY      +Y++T+     P VT  P+I YPG YT
Sbjct: 425  NNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAGKPSVTLTPSIPYPGIYT 484

Query: 477  FNIYTPGCLQDNSCSKRGIVNVTMIDRSINEV-LASVLIYQTNNEDKFDPLYTGSLGSAP 535
             N+ TPGCL DN+C+ RGIVNVT+  R+ N   L +  IYQ N   K+DPL+ G L  +P
Sbjct: 485  LNLVTPGCLTDNTCAFRGIVNVTI--RAQNGTHLMNRWIYQNNENLKYDPLFRGYLDDSP 542

Query: 536  EIIVTWDKAI--GESDSVMVVDRLGVITEYIDTISISSNDTTFH-LNGLFQYNTANVTAS 592
             +++ W   I    +++VMV DR+  I + I+ + + +  +  + LNGLFQY  +N T +
Sbjct: 543  NVVLEWIGPIDPAAANNVMVADRVTSIIDSIEDLEMKNGTSNSNLLNGLFQYAASNFTNT 602

Query: 593  IFST---NDTFNDYALYNFPLDANLYAASLNNDILIGG-NFNGIAKVELNDE---ALISS 645
              ST   +   + Y + N P  ++L+    N+ + IG  + +G+AK+    +    +I  
Sbjct: 603  NLSTLVGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSIDGLAKISRRKDDWNDIIVD 662

Query: 646  SQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVNF 705
             Q + T G  TGIF YSNGL L  T      +    LS++G+    F + + P   I+N 
Sbjct: 663  PQLIDTEGPVTGIFPYSNGLAL--TVHSNQTNMASSLSFNGSISTIF-RSNAPSLSILNL 719

Query: 706  TIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGELN 765
            TIDG E+L+FDN Y++NVS+   +SNS T +++  SAG N  +D +L G+         N
Sbjct: 720  TIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDDLILAGNVQSTKHFVPN 779

Query: 766  GLASLSSDG-QVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTNS 824
            G  ++ +D  +V +  LP +  D   Y+  +IND+S+AYA    S  + +  +++   + 
Sbjct: 780  GAIAIDADSNEVVTSGLPSV-DDGIIYRGLFINDSSSAYAYYSKSLGSSKGGIVVYGEHE 838

Query: 825  SSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFST 884
              ++      + +N  LY    N+LA+ T+G   +SQ      I +L+      +  F  
Sbjct: 839  PEYLSTDD--STVNDMLYIKDSNLLAVVTSG---TSQGLASLYIHDLSADFAPIKETFEI 893

Query: 885  NERXXXXXXXXXXXXILVGGSYEIDNCNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADE 944
             E             +LVGG++  + C DLCLYNY T  WT F++ +ITGDIRQ+QF D 
Sbjct: 894  GEVINTMVLFGRNYTLLVGGTFTRNGCRDLCLYNYATNNWTRFMDGNITGDIRQLQFLD- 952

Query: 945  GKTLLVGGLIKTNNESNIQLLSVEVGS-NIFSTVK-SGTEPLLSFVPIDDSTDNIIAQMN 1002
            G TL+V GL+ +++  ++QL+ +++ +  I S ++ + T      + + +S+  +IA   
Sbjct: 953  GNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTGTFQHVLTVGNSSSELIAHDG 1012

Query: 1003 SEILRLESGTWSSFGPQLNNDSIVSGFKVLSGTESK-----KRDE-GSHIVLLEGTLNSS 1056
            +++     G W +  P  +  + ++G  +LS   S+     KRD  G+ +V++ G  +S 
Sbjct: 1013 NQVFHFVDGQWKNISPDTSGQTQINGLTLLSTDFSQRNSIMKRDRVGNELVVINGNFSSP 1072

Query: 1057 EWGNLTSVVYDGSTQKWQPYFVISDPKE---QESLPSSSFFQNVNDLYLSSSQTVLQXXX 1113
            ++G++ ++ YD     W PY+  S P+E    E +P    F N +  + SSSQ  L    
Sbjct: 1073 DYGDINAMYYD--FNGWNPYY-FSVPRESNSDEVIPQGQLFLNKDVSFTSSSQIYLSNDN 1129

Query: 1114 XXXXXXXXXXXXXXXXXXXXKDKKIDRGFIVLIGLALALATVAVIGLIGALICYFFINNN 1173
                                  KK+ + F+VLI LALALATVAV+G++G L  Y F ++N
Sbjct: 1130 DNDDTPAASEPATHEKHT----KKLAKIFVVLIALALALATVAVLGVVGVLFAYLFGDHN 1185

Query: 1174 GYESLKPRINQDEMLDTVPPEKLMKFI 1200
             YE LKPRIN+ EML TVPPEKLMKFI
Sbjct: 1186 AYEPLKPRINEAEMLKTVPPEKLMKFI 1212

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/1251 (36%), Positives = 700/1251 (55%), Gaps = 82/1251 (6%)

Query: 1    MFSINPLIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELT 55
            MF         L LA   + SQL NI+ LL+I     PN +     S  +  +   + ++
Sbjct: 1    MFVHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAIS 60

Query: 56   VISYTGQQNFTVQ----ANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTG 111
               YTGQQNFT       N   L+YYSN+T+++L + S +T +  I P  +DSFILSG+G
Sbjct: 61   FYKYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSG 120

Query: 112  QINGVALEQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAV 171
             IN +++  QIL NL++L+ +PIF  ++ +V  +L  + +V F GNFS +  +  GH A+
Sbjct: 121  TINNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSAL 180

Query: 172  LWDVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNAS-LLQEFGNATNSS 230
            +WD +++T +L PF GFGENS VNS++KLN DNI+FAG F  + ++S L+    N TNS+
Sbjct: 181  VWDAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLITSSNNGTNST 240

Query: 231  HE-DLTSLQFDQSVPLKLSSITGEN---VQSDILLCPSGGQNGWSASEAVQSTLQFDLKN 286
               + T L+  Q + L+ +S   +    + S+ L+CP+   N W    A   +L  +L  
Sbjct: 241  FSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAW-LYPATSGSLVCNLPY 299

Query: 287  EIHPSKVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDL 346
            E+ P+K+R+YNS +  SEI+LF+I+T PS+ IMNLTYLDP SGELK CD +CPL S   L
Sbjct: 300  EVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATL 359

Query: 347  TQISQNSTAAPKSVG-INNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHS 405
               SQN++++   +  I+ N+T++KWS  +Q+FAF N++PVT L+ +AL SYG +  L  
Sbjct: 360  LAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSG 419

Query: 406  IEIFETEFMVYANNSYNEPNCES-VTEYSKAELSSDNWYTTDESDTYISTNI--DDN--I 460
            +E+++  F  YANNS NE  C + V + S + LS+++WY     ++YI+TN   D N  I
Sbjct: 420  LELYQNTFSTYANNSLNEYGCSALVNDSSSSILSNNSWYNGLTGESYIATNYIPDQNEPI 479

Query: 461  PYVTFHPNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNE 520
            P V F+PNI + G YT N YTPGC+QDN+CS RGIVNVT+ +   N ++ +  IYQ N+ 
Sbjct: 480  PRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDN 539

Query: 521  DKFDPLYTGSLGSAPEIIVTWDKAIGESD--SVMVVDRLGVITEYIDTIS----ISSNDT 574
             K+D +++G L  +PEI++ +   I  S+  +V+V DR+ VIT  +DT +    I++   
Sbjct: 540  LKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKR 599

Query: 575  TFHLNGLFQYNTANVTASIFST----NDTFNDYALYNFPLDANLYAASLNNDILIGGNFN 630
               LNG+FQY  +N T +  +     N T N + + N+P +A+L     N+ +++GG  N
Sbjct: 600  QTPLNGIFQYQKSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGGVSN 659

Query: 631  GIAKVELNDEALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFN 690
             I+ ++LN+   I SS+     G   GI +   GLL+ G  +  +D++  +L ++     
Sbjct: 660  RISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLR-SSDNQSTVLLFN----E 714

Query: 691  SFGQLDEPIDRI---VNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSG 747
            SFG++     R+    N +I  +EL +FDN YI N S+N  +SNS++F ++  +AG N  
Sbjct: 715  SFGKVPNYSKRVNSATNISIADNELFVFDNNYIINASSNAQISNSTSFSLSLWAAGNNGN 774

Query: 748  NDSLLFGSFLKRSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQE 807
             D L  G+        LNG AS  ++ QV +  +      + PY  AY+N++ +AYA + 
Sbjct: 775  GDVLFSGTVSHMEFSNLNGSASFKNEDQVQALNIGR---GIVPYFGAYLNESVSAYAYE- 830

Query: 808  GSTDNVQHRVLITNTNSSSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFS 867
              TD +         N S +     WS  I   LY N   +L +    S SSS  D+  +
Sbjct: 831  --TDALNKIYFSNKVNPSWN-----WSNTITRMLYANNQTMLVV---SSESSSTADL--T 878

Query: 868  ILNLTGYENVARVNFSTNERXXXXXXXXXXXXILVGGSYEID--NCNDLCLYNYQTKEWT 925
            I NL     +A     +N +            ILVGG ++I   NC+ LCLYNY+TK W+
Sbjct: 879  IFNLRNMTTIANETLGSNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWS 938

Query: 926  SFLNDSITGDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLL 985
            +F N++I G++ Q+  A+  + L++ GL  T    +I+L S  + +     + SG+E  L
Sbjct: 939  TFFNNTIFGEVTQLSLANSSE-LIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKL 997

Query: 986  -SFVPIDDSTDNIIAQMNSEILRLESGTWSSFGPQLNNDSIVSGFKVL-----SGTESKK 1039
             SFV  D+S   ++A  ++ +    +  W +     ++DS++     +     S T +K+
Sbjct: 998  NSFVVTDNS---LVAWNDTSLFIYGNQKW-NITSLPSDDSLIGSVSTISTNTKSDTLNKR 1053

Query: 1040 RDEGSH---IVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQN 1096
                +H   I+LL G     ++GNL S+++D   Q W PYF+          P  +FF N
Sbjct: 1054 ATNNAHDGSILLLNGNFTMPQYGNLQSLLFD--FQAWTPYFISEISNSSNYNP--TFFIN 1109

Query: 1097 VNDLYLSSSQTVLQXXXXXXX------XXXXXXXXXXXXXXXXKDKKIDRGFIVLIGLAL 1150
             +     +SQ  L                              + KKIDRGF+VLIGLAL
Sbjct: 1110 RDVSTEFNSQITLPNLNITVTNPQSTSSQSPSTSATSESKSKSEKKKIDRGFVVLIGLAL 1169

Query: 1151 ALATVAVIGLIGALICYFFINNNG-YESLKPRINQDEMLDTVPPEKLMKFI 1200
            AL TV+V+G++G ++ Y F +  G Y+ +KPRI+++EMLDTVPPEKLMKF+
Sbjct: 1170 ALGTVSVLGIVGVILAYVFKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/1233 (34%), Positives = 672/1233 (54%), Gaps = 52/1233 (4%)

Query: 1    MFSINPLIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELT 55
            M +   L   +L LA    GS L  +E  L +  Y+ PN D     + ++  + NF+++ 
Sbjct: 1    MRATTCLATSVLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDIN 60

Query: 56   VISYTGQQNFTVQAN---ESSLLYYSNDTFVKLFETSPET---TVTMIVPLFEDSFILSG 109
            ++ Y+GQ+NFT + +   E++L+YYSN+TF++++ +S  +   +V  IVP  +D+FILSG
Sbjct: 61   ILKYSGQKNFTGEVSGNPENALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILSG 120

Query: 110  TGQINGVALEQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHG 169
             G I+G  L +Q+L NL+SL    IF   +  V  I    + V F G+F   +SN+T H 
Sbjct: 121  AGSISGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIHS 180

Query: 170  AVLWDVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNS 229
             ++WD + +  E+ PF GFG+NS VNS++ L++ NILFAG+F  + N   L    N +N+
Sbjct: 181  LLVWDSIKDGVEVLPFGGFGKNSTVNSILNLDNSNILFAGNFSAVDNTQQLNNI-NVSNT 239

Query: 230  SHEDLTSLQFDQSVPLKLSSITGENVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIH 289
            S+  +  L    S+    + ++   +    + CPS    GW  + + Q   +  +  E  
Sbjct: 240  SNTSVPELGHQISLQ-SAAWVSDGTLDKSAIKCPSTESTGWLKTGSTQGQFELYMPEETR 298

Query: 290  PSKVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQI 349
            PSK+R++N+ + + ++SLFRI+T PSNGIMNLTYLDP +GEL  CDAWCPLLS ++LT I
Sbjct: 299  PSKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLLSSQNLTDI 358

Query: 350  SQNSTAAPKSVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIF 409
            S  S    + V    N T L+WSES+Q+FAFVN++PV+ L F+AL SYGS+  L  IE++
Sbjct: 359  SSKSYPGDQ-VQYFENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSSVGLAGIELY 417

Query: 410  ETEFMVYANNSYNEPNCESVTEYSKAELS-SDNWYTTDESDTYISTNIDDNI--PYVTFH 466
            E+ + VYANN+ N PNC   +  S A LS S  W +      Y+ST++ D+   P+V F+
Sbjct: 418  ESAYSVYANNTLNAPNCAQGSATSNALLSNSSAWDSGSSEGNYLSTSVQDSETNPFVIFY 477

Query: 467  PNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPL 526
            P+I YPG YT ++ TPGCL+D+SC  RGI+N T+ D   N +L S+ IYQ N+ +KFD L
Sbjct: 478  PSIIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIYQNNDYEKFDTL 537

Query: 527  YTGSLGSAPEIIVTWDKAI--GESDSVMVVDRLGVITEYIDTISISSNDTTFHLNGLFQY 584
            Y+G L S  ++ + +D AI  G    VMV  ++ V  E  D  S+  N+T+  +NGL  Y
Sbjct: 538  YSGFLDSEVKVTLEFDGAINSGTEVPVMVASKIVVNIEDFDQ-SVFENNTSGFINGLLHY 596

Query: 585  NTANVTASI-----FSTNDTFNDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELND 639
            +T+N ++ +     +S  D    Y++   P  +N++A    +D+++      +A+++L +
Sbjct: 597  STSNTSSFLSELGSYSATD-LAHYSVSKLPKHSNIFANMFEDDLVLFTTDGEMARLKLAN 655

Query: 640  EALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPI 699
               I            + I EYS GL++ GT+     S      ++G  FN   + +  +
Sbjct: 656  NLSIEEYTFETIGKDISTISEYSGGLIIVGTFN--GSSEPAARGFNGTFFN-LTEFNSTV 712

Query: 700  DRIVNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKR 759
                N T+   E+L+FD   I N +    + ++S   +   SAG N  ND+L  G  L+ 
Sbjct: 713  RTFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASAGRNPYNDTLFQGYVLQN 772

Query: 760  SVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLI 819
                LNG   +S++ +  S     L   + PY AA++++++ AYA    + DN  +   +
Sbjct: 773  DYTNLNGSFFISTNSEEVSQNFWALGGKL-PYDAAFVDNSTTAYAYY--NPDNTSNSFGV 829

Query: 820  TNTNSSSHMLQIQ-WSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVA 878
            +  N S   +Q+  WS  + A       ++LAIG    ++    D Q  + N +  E++A
Sbjct: 830  SVMNDSGSTVQLSAWSGKVGAMASSKNDSLLAIGGKDQHT----DSQLLVTNSSSGESLA 885

Query: 879  RVNFSTNERXXXXXXXXXXXXILVGGSYEIDN--CNDLCLYNYQTKEWTSFLNDSITGDI 936
               + +               +LVGGS+ ++N  C+ LCL+NYQ K+W+ FLN+SI G I
Sbjct: 886  SYKWDSEISLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDKKWSPFLNNSIRGVI 945

Query: 937  RQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLLSFVPIDDSTDN 996
             +M+  +    LL+ G  + N    + L S+ +  +    +  G   L  FV +D S++N
Sbjct: 946  NRMEIFNN-SNLLIAGSFRLNETDGVSLASICLKDSSSEILHEGNITLNGFVSMDGSSNN 1004

Query: 997  IIAQMNSEILRLESGTWSSFGPQLNNDSIVSGFKVL---SGTESKKRDEGSHIVLLEGTL 1053
            ++A  ++ +L+LESG W         +S   G  V      T  +KRD  S ++L+ G+L
Sbjct: 1005 VVAFSDTSLLQLESGKWQQISTNFTENSKFKGLDVFPLKDTTRKQKRDSSSKVLLITGSL 1064

Query: 1054 NSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNVNDL-----YLSSSQTV 1108
              +++G++ +  YD  + +W P+   +       L +S  F N  DL     Y    Q  
Sbjct: 1065 QHAKFGSINAAFYD--SGEWTPFLSSNQATSSSDLETSHVFLN-RDLSDFLDYKGYLQGT 1121

Query: 1109 LQXXXXXXXXXXXXXXXXXXXXXXXKDKKIDRGFIVLIGLALALATVAVIGLIGALICYF 1168
                                     K KKIDRGFIVLI LALAL T+AV+GL+G +  YF
Sbjct: 1122 FSSNTSSGTSGTPSPSGSSPSNLQRKKKKIDRGFIVLISLALALGTLAVLGLLGVIFSYF 1181

Query: 1169 FINN-NGYESLKPRINQDEMLDTVPPEKLMKFI 1200
            F ++ +GY+  KPR +++EM+DTVPPEKLM+FI
Sbjct: 1182 FGDSGDGYQLSKPRTDENEMIDTVPPEKLMRFI 1214

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/1233 (36%), Positives = 700/1233 (56%), Gaps = 72/1233 (5%)

Query: 14   LAGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELTVISYTGQQNFTVQ 68
            L  + + SQL NI+ LL+I     PN +     S  +  +   + L+   YTGQQNFT +
Sbjct: 14   LVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFYEYTGQQNFTKE 73

Query: 69   ----ANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALEQQILL 124
                 +   L+YYSN+T+++L + S +T +  I P   DSFILSG+G IN +++  QIL 
Sbjct: 74   IGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTINNISVGNQILY 133

Query: 125  NLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTTELFP 184
            NL++L+ +PIF  ++  V  +L  N ++ F GNFS +  + TG+ A++WD ++NTT+L P
Sbjct: 134  NLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIWDSISNTTQLLP 193

Query: 185  FKGFGENSIVNSVVKLNSDNILFAGSFQEIQNAS-LLQEFGNATNS-SHEDLTSLQFDQS 242
            F GFGENS VNS+VKLN+DNILFAG F  + + S L+    N TNS S  + T+L+  Q 
Sbjct: 194  FGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSALISSSNNGTNSTSSLNATTLELGQR 253

Query: 243  VPLKLSSITGEN---VQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYNSV 299
            +PL+ +S   +      SD L+CP+  ++ W   +    +L  +L  E+ P+K+R+YNS 
Sbjct: 254  IPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDT-SGSLVCNLPYEVSPTKIRLYNSQ 312

Query: 300  EENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAPKS 359
              +SEIS+F+I+T PS+ IMNLTYLDP SGELK C  +CPL S   L   SQN +++   
Sbjct: 313  RSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATLLSASQNVSSSMDM 372

Query: 360  VG-INNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYAN 418
            +  I+NN T++KW+  +Q+FAFVN++PV+ L+FVAL SYG +  L  +E+++  F  YAN
Sbjct: 373  ITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSGLELYQDTFSTYAN 432

Query: 419  NSYNEPNCESV-TEYSKAELSSDNWYTTDESDTYISTNI----DDNIPYVTFHPNITYPG 473
            +S NE  C ++  + S + LSS++WY     ++YI+       ++ IP V F+PNI +PG
Sbjct: 433  DSLNEYGCSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQNEPIPRVKFYPNIIHPG 492

Query: 474  RYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLGS 533
             YT N+YTPGCLQDN+CS RGIVNVTM ++  N ++ + LIYQ N+  K+D +Y+G L  
Sbjct: 493  HYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDNLKYDQIYSGYLDF 552

Query: 534  APEIIVTWDKAIGESD--SVMVVDRLGVITEYID---TISISSN-DTTFHLNGLFQYNTA 587
            +PEI++ +   I  ++  +V+V D++ VIT  +D   T+S SSN      LNG+ QY  +
Sbjct: 553  SPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSDSSNAKKETLLNGILQYQKS 612

Query: 588  NVTASIFST----NDTFNDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELNDEALI 643
            N T++  +     N T N + + N+P +++LYA   +N ++IGG  N I+ V+LND+  +
Sbjct: 613  NFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGGVSNRISIVDLNDDFEV 672

Query: 644  SSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIV 703
            +SS+     G   GI + + GLL+ G     N+ +  +  ++G+  N F Q    ++  +
Sbjct: 673  TSSKNQTIQGDVHGITKTNQGLLIFGDILSSNN-QSAVFLFNGSFENVFNQ-SRTVNSAL 730

Query: 704  NFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGE 763
            N ++  ++ ++ DN Y+ N S+N  + NSS+F ++  +AG N   D L  G+      G 
Sbjct: 731  NISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGDVLFSGAVSHMQYGN 790

Query: 764  LNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLITNTN 823
            LNG     ++ ++       L   + PY  AY+N+++ AYA +  S + +          
Sbjct: 791  LNGSVRFLNENEIEP---LNLEGGIVPYLGAYLNESATAYAYEVDSLNKIYF-------- 839

Query: 824  SSSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARVNFS 883
            S+       WS+ I   LY +   +LA+    S ++     + SI +L     +A     
Sbjct: 840  SNEVYPSWNWSSGITQMLYADNQTLLAVSAGSSTTA-----ELSIFDLRNLTMIANETLG 894

Query: 884  TNERXXXXXXXXXXXXILVGGSYEID--NCNDLCLYNYQTKEWTSFLNDSITGDIRQMQF 941
            +N R            +LVGG +++   NC  LCLYNY++K W++FLN++I G+I Q+ F
Sbjct: 895  SNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSF 954

Query: 942  ADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLL-SFVPIDDSTDNIIAQ 1000
             +  + L++ GL +T    +I+L S  + ++    + SG+E  L SF   +DS   I+A 
Sbjct: 955  TNSSE-LIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDS---IVAW 1010

Query: 1001 MNSEILRLESGTWSSFGPQLNNDSIVSGFKVLSGTES---KKR-----DEGSHIVLLEGT 1052
             ++ +    +  W+      N  SI S   + +  ES    KR     + GS I+LL G 
Sbjct: 1011 NDTSLFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGS-ILLLNGN 1069

Query: 1053 LNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNVNDLYLSSSQ----TV 1108
             N S++G L S+++D   QKW PYF+          P     ++V+  + S S      +
Sbjct: 1070 FNISQYGYLQSLLFD--FQKWTPYFISETTNTSNYNPIIFINRDVSTEFNSQSPLANVNI 1127

Query: 1109 LQXXXXXXXXXXXXXXXXXXXXXXXKDKKIDRGFIVLIGLALALATVAVIGLIGALICYF 1168
                                     K KKI RGF+VLIGLALAL TV+V+G+ G ++ Y 
Sbjct: 1128 TVTSPQSTSSQPPSSSASSESKSKSKKKKIGRGFVVLIGLALALGTVSVLGIAGVILAYV 1187

Query: 1169 FINNNG-YESLKPRINQDEMLDTVPPEKLMKFI 1200
            F +  G Y+ +KPRI+++EMLDTVPPEKLMKF+
Sbjct: 1188 FKDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/1241 (34%), Positives = 684/1241 (55%), Gaps = 69/1241 (5%)

Query: 1    MFSINPLIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELT 55
            M + + L    LV+A +  G+ L+ IE  L +  +E P+ D     + ++  + NF+ L 
Sbjct: 1    MLTKSWLATSFLVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLN 60

Query: 56   VISYTGQQNFTVQANES---SLLYYSNDTFVKLFETSPETT-----VTMIVPLFEDSFIL 107
               YTGQ NFT  ++E    SL+Y+SN T ++L  +SP+ +     V  ++PL +DSFIL
Sbjct: 61   YYRYTGQDNFTGISDEKARESLIYHSNGTLLEL--SSPQYSNESFSVDHVIPLRDDSFIL 118

Query: 108  SGTGQINGVALEQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETG 167
            SGTG I+G  L+ Q++ NL+ L+ + IF  ++  V  I        F G+F     ++  
Sbjct: 119  SGTGAISGAVLDHQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDT 178

Query: 168  HGAVLWDVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQE-FG-N 225
            HG ++WD V N  E  PF G G++S VNS++ L+ +NILFAG+F  I   S L    G N
Sbjct: 179  HGLIVWDFVKNEVETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSALNSTLGIN 238

Query: 226  ATNSSHEDLTSLQFDQSVPLKLSSITGE-NVQSDILLCPSGGQNGWSASEAVQSTLQFDL 284
            +T+ S  +L+       +PLK +  T + ++Q D L+CPS   +  SA     +T QF+L
Sbjct: 239  STSDSAPELS-----HKIPLKTAKWTSDGSLQKDDLVCPS--NSATSAWLGTGTTGQFEL 291

Query: 285  K--NEIHPSKVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLS 342
               + I PSK+R++N+   + E+SLFR+IT PSNGIMNLTYLDP+SGEL+ CDAWCPLLS
Sbjct: 292  SIAHTIRPSKLRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLS 351

Query: 343  IEDLTQISQNSTAAPKSVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAA 402
             ++LT  +++  A+   V   NN T ++WSESYQ+FAFVN +PVT + F+AL SYGS+  
Sbjct: 352  TQNLTA-AKSKAASTDQVEFLNNQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVG 410

Query: 403  LHSIEIFETEFMVYANNSYNEPNCESVTEYSKAELSSDNWYTTDESDTYISTNIDDN--I 460
            ++  E++E +F VYAN+S+N P+C S + YSKA LS+  W      + Y+ T ++++   
Sbjct: 411  VNGFELYEDDFSVYANDSFNVPDCSSTSNYSKASLSASQWDQGSSDEDYVYTLVENSQEA 470

Query: 461  PYVTFHPNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNE 520
            P VTF+P I Y G YT N+ TPGCL D SC  R +VN ++ D +   +L+S+ IYQ N+ 
Sbjct: 471  PSVTFYPQIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDY 530

Query: 521  DKFDPLYTGSLGSAPEIIVTWDKAIG--ESDSVMVVDRLGVITEYIDTISISSNDTTFHL 578
            +K+D LY+G L +  ++++ ++ AIG  E   +MV  ++ V T+  D+   +    T  L
Sbjct: 531  EKYDNLYSGYLENEVKVVLEYEGAIGNTEGSPMMVAGQISVNTDEFDSSVFTDKYKTGKL 590

Query: 579  NGLFQYNTANVTASI--FSTNDT--FNDYALYNFPLDANLYAASLNNDILIGGNFNGIAK 634
            NGL  Y+ +N ++ +  F +N++     Y++ NF  ++N +     N I++  +   ++K
Sbjct: 591  NGLLHYSLSNSSSYLQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGKVSK 650

Query: 635  VELNDEALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQ 694
            +E++ +  + +          +G+F +S GL + GT+   + S      Y+G+ F     
Sbjct: 651  LEIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTF---DGSTKGAKFYNGSFF----- 702

Query: 695  LDEPIDR-----IVNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGND 749
             D P+         NFT+DG EL+   N Y  N + +    NSS   +T +SAG+N+  +
Sbjct: 703  -DIPLSHSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGE 761

Query: 750  SLLFGSFLKRSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGS 809
            ++ +GS  +    +LNG   +SS+   SS  L      +  Y A YI++++  YA  + S
Sbjct: 762  TVFYGSLTRNEYTDLNGSFFISSN-SQSSSRLRGSQGRIW-YDATYIDNSTTGYAFYDPS 819

Query: 810  TDNVQHRVLITNTNSSSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSIL 869
            + N  + V I    +    L  +W+  + + LY    ++LA+G      S     Q  + 
Sbjct: 820  STNGSYGVSIYKDMAKERDLSYRWTNMVGSMLYSKNSSLLALGMKNETRSP----QLLLT 875

Query: 870  NLTGYENVARVNFSTNERXXXXXXXXXXXXILVGGSY--EIDNCNDLCLYNYQTKEWTSF 927
            NLT  E+ A   + TN              +LVGG +     NC+ LCL++Y+ K W+ F
Sbjct: 876  NLTTGEDTATFEWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPF 935

Query: 928  LNDSITGDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLLSF 987
             ++ I G I  M+  ++  +L++GG    N+   + L S+ +    ++ +  GTE +L F
Sbjct: 936  FDNMINGSIHSMKIFNK-SSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDF 994

Query: 988  VPIDDSTDNIIAQMNSEILRLESGTWSSFGPQLNNDSIVSG---FKVLSGTESKKRDEGS 1044
            + +D   DN++A   +++ RL +  W S   Q ++ S+  G   F +  G ++KKR+E  
Sbjct: 995  IFVDGKVDNLVAVSANDLFRLTNNNWESISAQFDDSSVFGGLSEFPIQQGGQNKKREEEK 1054

Query: 1045 HIVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNVNDLYLSS 1104
            + +L+ G L    +G +++ +YD     W PYF  +     + L  S  + N +     +
Sbjct: 1055 NSLLITGDLLHKTYGKISAALYD--FNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFN 1112

Query: 1105 SQTVLQXXX----XXXXXXXXXXXXXXXXXXXXKDKKIDRGFIVLIGLALALATVAVIGL 1160
             Q VLQ                           K  KI RGF+VLIGLALA+ T+AV+G+
Sbjct: 1113 YQGVLQSSRGGNSSSVPSGTSSPTSSSPSQLGAKKNKIARGFVVLIGLALAMGTLAVMGV 1172

Query: 1161 IGALICYFF-INNNGYESLKPRINQDEMLDTVPPEKLMKFI 1200
            IG  + +FF  +++ Y+SL+PR ++ EM+DTVPPEKLM+FI
Sbjct: 1173 IGIALTFFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  644 bits (1661), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/1232 (32%), Positives = 643/1232 (52%), Gaps = 75/1232 (6%)

Query: 7    LIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWD-----SPDLTYMNNFEELTVISYTG 61
            L+  L  L  +VRGS L ++ +  +I  ++ P  D     +  L   ++F+     +Y G
Sbjct: 7    LVAALAPLGDVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYYNYKG 66

Query: 62   QQNFTVQANE--SSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALE 119
            QQ FT Q     SSL+YYS  T+V+L +   +T V  IVP   DSFILSGTG++    LE
Sbjct: 67   QQLFTGQEQHQGSSLIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKLQDQRLE 126

Query: 120  QQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANT 179
             Q++ NL++L  + I P ++E+V DIL   + V F G F+ S  N++GH AV W+  + T
Sbjct: 127  HQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQWNATSRT 186

Query: 180  TELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFG--NATNSSHEDLTSL 237
            T L PF GFG  S VN+++KL+   +LF G F  ++ AS  +      +T     ++T++
Sbjct: 187  TSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASYAETASVLASTEKPQLNVTTI 246

Query: 238  QFDQSVPLKLSSITGE-NVQSDILLCPSGGQNGW----SASEAVQSTLQFDLKNEIHPSK 292
            + +    L+ S+IT + ++     +CP+   + W    S     +  L   + + I PSK
Sbjct: 247  ETNALTSLRYSTITSDGHLDKGKFICPTSNDDSWFVPHSGDGPARGELNIKVLHRIIPSK 306

Query: 293  VRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQN 352
            +RIYNS +  +EI LFRI+T PS  IMN+TY+DP +GEL  CDAWCPL+   +LT  +  
Sbjct: 307  IRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMPRSNLTSKAAE 366

Query: 353  STAAPKSVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETE 412
            S  A  +  +N+    +KW+  YQEFAF+N I +  ++F+AL SYG+N  L  +E+F+TE
Sbjct: 367  SGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNVGLVGVELFQTE 426

Query: 413  FMVYANNSYNEPNCESVTEYSKAELSSDNWYTTDESDTYISTNIDDNIPYVTFHPNITYP 472
            +  Y N++ N+PNC    + S    +++ W+      +Y+S N+ ++ P V   P I + 
Sbjct: 427  YDAYVNSTLNQPNCGE-QQLSPFSTTANIWHQGATDASYLSANVVESNPMVNVKPVIPHS 485

Query: 473  GRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLG 532
            G YT N+YTPGC  D +C  RGIVNVT++  S    L +  IYQ N   K+DPLYTG L 
Sbjct: 486  GTYTLNLYTPGCEDDGTCDYRGIVNVTLL-ASNGTTLMTRWIYQNNYRLKYDPLYTGHLD 544

Query: 533  SAPEIIVTWDKAIGES--DSVMVVDRLGVITEYIDTISISSNDTTFHLNGLFQYNTANVT 590
              P + + W   I  +    +MV DR+  I + +D +    +     LNGLFQY  A  +
Sbjct: 545  PNPTVRMEWVSPINSAVNRKIMVADRVSAIIDSLDGLDDIRHPREKSLNGLFQYTPAGSS 604

Query: 591  ASIFSTNDTFNDYALYNFPLDANLYAASLNNDILIGGNFNG-IAKV-----ELNDEALIS 644
                      N     + P   +L     +  +++G    G IA V     + ND  +  
Sbjct: 605  LD-NGIQKYINKDPQTDMPEGVSLVGQVYDGKLILGVKSTGHIAVVTPKGTDWNDVDVT- 662

Query: 645  SSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPIDRIVN 704
               +    G   GI  YS GL+ +G + + +      L YDGN F SF  L+     I+N
Sbjct: 663  ---RQDVPGSLNGISPYSKGLVFTGKFNLSSGPS-SALHYDGN-FGSFFDLNSETSSIIN 717

Query: 705  FTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLKRSVGEL 764
             TIDG ELLLF+N +I+N S +  ++ SS F+++  SA  NS ND L  GS      G  
Sbjct: 718  MTIDGSELLLFNNKFIYNTSTSQMLT-SSMFQLSALSAAANSNNDLLFTGSIADIKHGSA 776

Query: 765  NGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGS------TDNVQHRVL 818
            +G  +L ++G + +   P + +  + ++  Y+NDT+ AYA    S      T  V     
Sbjct: 777  HGAVALDAEGNIFTSGTPSI-SGARVHRGVYLNDTATAYAYYSVSPNSSVATGGVVIETP 835

Query: 819  ITNTNSSSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVA 878
              N N S+++      A +   +Y    N L I TN    +    + + +  L   + VA
Sbjct: 836  GNNFNLSNNI------ATVREMIYVKKTNFLVISTNEVEGTPGALILYDLRTL---QEVA 886

Query: 879  RVNFSTNERXXXXXXXXXXXXILVGGSYEIDNCNDLCLYNYQTKEWTSFLNDSITGDIRQ 938
            R   +  ER            +LVGGS+E D C+DLCLYN+  + W++F +  I+G+I+Q
Sbjct: 887  REKLNPGERINSIVLFGEDNTLLVGGSFEKDGCHDLCLYNFVKRSWSAFASGLISGEIKQ 946

Query: 939  MQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEP----LLSFVPIDDST 994
            +QF +  + L+  G +   +  NI  L+ ++  +    V+   +P      S + I DS 
Sbjct: 947  LQFVNN-RNLIAVGSMTVQSRPNILFLNFDLVRS--RVVEQHEQPNGRAFNSVLTIGDSG 1003

Query: 995  DNIIAQMNSEILRLESGTWSSFGPQLNNDSIVSGFKVL----SGTESKKRDEGSHIVLLE 1050
            D  +A+   ++       W +  P       + G  +L      +++K+   G+ +V++ 
Sbjct: 1004 DEYVAEDGKQVWHYSGSEWKTVTPLSGGQIRIDGISLLMLNNPRSQNKRNRVGNELVVIH 1063

Query: 1051 GTLNSSEWGNLTSVVYDGSTQKWQPYF--VISDPKEQESLPSSSFFQNVNDLYLSSSQTV 1108
            G +NSSE+G + ++ Y+   + W+PY+  + S  +E+ ++P    F N +    +++   
Sbjct: 1064 GQMNSSEYGEINAMHYN--FENWEPYYFTIGSSAREEFNVPRGQIFLNQDISRQTTTSLP 1121

Query: 1109 LQXXXXXXXXXXXXXXXXXXXXXXXKDKKIDRGFIVLIGLALALATVAVIGLIGALICYF 1168
            L+                         +K+ +G++VLI L LALAT+A++G+IG ++ Y 
Sbjct: 1122 LE------------VVVSDSPPTAEPKRKLAKGYVVLIALGLALATIALLGIIGVILAYA 1169

Query: 1169 FINNNGYESLKPRINQDEMLDTVPPEKLMKFI 1200
            F ++N Y+ LKPRIN+DEML TVPPEKLMKFI
Sbjct: 1170 FGDHNAYQPLKPRINEDEMLKTVPPEKLMKFI 1201

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/1244 (35%), Positives = 661/1244 (53%), Gaps = 83/1244 (6%)

Query: 12   LVLAGMVRGSQLSNIEKLLNISRYEAPNWD----SPDLTYMNNFEELTVISYTGQQNFT- 66
            L + G+ + SQL+N++  L I+    P  +    + ++  ++N E LT   Y GQQNFT 
Sbjct: 11   LGIIGVSQASQLTNVKDSLGINTVNIPQINFGNTNNEIQILSNIEGLTFYQYQGQQNFTG 70

Query: 67   ---VQANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALEQQIL 123
                 +N   L+YYSNDT +KL E S  T +  IVPL ED+FILSG+G + G  LE Q+L
Sbjct: 71   SIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLL 130

Query: 124  LNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTTELF 183
             NL+ L+  P+F + ++N+  IL   + V F GNFS + +N+T +  + W+ V    ++ 
Sbjct: 131  YNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDML 190

Query: 184  PFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQE-----FGNATNSSHEDLTSLQ 238
            PF GFG+NS VNS++KL+ DN+LF G F  + + SLL           + SS    T+L+
Sbjct: 191  PFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVSNITTYTQQNSTSSSSTETNLE 250

Query: 239  FDQSVPLKLSSIT--GENVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIY 296
             +Q + LK +S    G+   S   +CP+G    WS S      +  +L  E   SK+RI+
Sbjct: 251  LEQQISLKYASWASLGDLKSSTQFICPNGQNEAWS-SAGTTGEITCNLAFEASLSKIRIF 309

Query: 297  NSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNS-TA 355
            NS  E  +I+ FRI+T PSNGIMNLTYLDP + E+K CDA+CPL S   L   S+N+ T+
Sbjct: 310  NSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQASSENATTS 369

Query: 356  APKSVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMV 415
            A  S  IN N TN+ WS  YQEFAFVN +PVT LQ +AL SYG N  L   ++++  + +
Sbjct: 370  ASTSAFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSI 429

Query: 416  YANNSYNEPNCESV-TEYSKAELSSDNWYTTDESDTYISTNI---DDNIPYVTFHPNITY 471
            +ANNS NEP C+S  T    + LS++ WY    S +YI+T     DD  P V F+P+I  
Sbjct: 430  FANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINR 489

Query: 472  PGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSL 531
             G YT NIYTPGC  D +CS RGIVNVT+ D + N+++++ LIYQ NNE K+D L+ G L
Sbjct: 490  IGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFL 549

Query: 532  GSAPEIIVTWDKAIGESDS--VMVVDRLGVIT------EYIDTISISSNDTTFHLNGLFQ 583
              AP++ + +   I + +S  V+V D + ++       E I  ++ S+ +    LNG+FQ
Sbjct: 550  DYAPKVTLEYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTSSTEELKVPLNGMFQ 609

Query: 584  YNTANVTASIFST-----NDTFNDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELN 638
            Y  +N T+S  ++     N + N + +  F    +LY    N  +L+GG+  G+  + L+
Sbjct: 610  YQLSNFTSSNNNSTLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSIAGVYALSLS 669

Query: 639  DEALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEP 698
            +   I S++ + T G  TG   Y+ G++L G + + N      LSY+G  F+SFG ++  
Sbjct: 670  NYTNIRSTRIVETGGEVTGTGAYAGGVVLFGNFNISNRIVSS-LSYNG-TFDSFGNVNSN 727

Query: 699  IDRIVNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLK 758
            I    N T    E+L F+N Y FN S + Y+ N+S   ++  SAG N   D+L  G   +
Sbjct: 728  IATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLITR 787

Query: 759  RSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVL 818
                 LN  A L+ +G   S    +L   +QPY   Y+ND+  AY     S  N+     
Sbjct: 788  NEFPNLNNSAVLTGNGTAQS---LQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILF--- 841

Query: 819  ITNTNSSSHMLQIQWSAPI---NAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYE 875
                   S+ LQ  W+ P    +A+  DN    + +G++ SN  S    +  +LN T  +
Sbjct: 842  -------SNGLQGNWNLPRSVSSAYYSDN--ETMFVGSSLSNGDS--GAELFVLNFTTMD 890

Query: 876  NVARVNFSTNERXXXXXXXXXXXXILVGGSYEI--DNCNDLCLYNYQTKEWTSFLNDSIT 933
             +    F  N              +LVGG +     NC++LCL N    +W+SF N    
Sbjct: 891  LLYNETFDVNSSINSIVSFGRNSSLLVGGDFTAPNTNCSNLCLLNLGNNQWSSFSN-KFD 949

Query: 934  GDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLLSFVPIDDS 993
            G I  ++FA++ + LL+ G  +  N+S I L  +++ +  F ++ S ++ + SF   + +
Sbjct: 950  GTITGLEFANDSR-LLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQKVNSF---NYN 1005

Query: 994  TDNIIAQMNSEILRLESGTWSSF-------GPQLNNDSIVSGFKVLSGTESKKRDEGSHI 1046
               I+A  +S I      +WS+           + N  IVS       T +   +    +
Sbjct: 1006 NGTIVAWDSSTIYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKLNNSLSTNNTSNNLNDEL 1065

Query: 1047 VLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNVNDLYLSSSQ 1106
            +L+ G L S ++G + ++ YD   Q W PY+ I+ P    +   +S F N +   L  SQ
Sbjct: 1066 ILVFGELYSEDYGFVQAMFYD--FQNWIPYY-ITQPYSSLNTSKNSLFMNKDISLLYESQ 1122

Query: 1107 TVLQXXXXXXXXXXXXXXXXXXXXXXXK---------DKKIDRGFIVLIGLALALATVAV 1157
             VLQ                                 + KI RG++VLIGLALA+ TVA+
Sbjct: 1123 VVLQNPNSTISISSTSSSSATTRSSSTSSTSLKNGNIESKIHRGYVVLIGLALAIGTVAI 1182

Query: 1158 IGLIGALICYFFINNNG-YESLKPRINQDEMLDTVPPEKLMKFI 1200
            +G+ G  + Y F ++ G Y  +KPRI++ EMLDTVPPEKLMKFI
Sbjct: 1183 LGIFGVTMAYIFSDDKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/1234 (33%), Positives = 656/1234 (53%), Gaps = 84/1234 (6%)

Query: 7    LIYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWD----SPDLTYMNNFEELTVISYTGQ 62
            ++Y L     + R S L N+ ++LN +    P +D    +     +++   ++   Y GQ
Sbjct: 5    VVYCLWFAVAITRASNLENVRRILNATEVTVPTFDVGNKNNQFQILDDINGISFYEYLGQ 64

Query: 63   QNFTVQANES---SLLYYSNDTFVKLFET-SPETTVTMIVPLFEDSFILSGTGQINGVAL 118
            QNFT  AN +    L+YYSN+TF+ L ++ + E  +  I+PL +DSFILSG G IN V+L
Sbjct: 65   QNFTTDANVTDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSL 124

Query: 119  EQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVAN 178
              Q++ N+T L+ + IF + + ++  +      V F+GNF+ +  N TG  A++WD    
Sbjct: 125  ASQLVFNMTDLSITKIFDTPLRSIEGVTVDGPLVYFMGNFTFN--NNTG--AIMWDSRDR 180

Query: 179  TTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHEDLTSLQ 238
            +  L PF GFG  + +NS++KLN DNILFAG F  + N+SLL +  N +  S  + TSL 
Sbjct: 181  SINLLPFHGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQ-SNVSEESVRNTTSLL 239

Query: 239  FDQSVPLKLSSI-TGENVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIYN 297
             + SVPL+ S   T   + S  L+CP   ++ WS S A       +L  +I PSK+RIYN
Sbjct: 240  LNPSVPLQYSQWKTNGELDSSQLICPDPSKDSWSVS-ATTGDFTCELPFQITPSKIRIYN 298

Query: 298  SVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAAP 357
            S +++S++SLFR +T P+  IMNLTYLDP SG +  CDA+CPL S   L     N+  A 
Sbjct: 299  SPDKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEAN 358

Query: 358  KSVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMVYA 417
                INNNSTN++W+ +YQEFA V+ +  T L+F ALASYG+N  L   +I++  F  + 
Sbjct: 359  TVAIINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFG 418

Query: 418  NNSYNEPNC-----ESVTEYSKAELSSDNWYTTDESDTYISTNIDDNIPYVTFHPNITYP 472
            NNS+N PNC     +S   ++ + LS +NW +  E  T   T  ++ +P VT+  +I + 
Sbjct: 419  NNSFNTPNCNNNDKDSNNTFTSSSLSPNNWTSVGEYLTVGYTPNENPVPKVTYKIDIQHS 478

Query: 473  GRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSLG 532
            G Y+ N++TPGC  DN+CS RGIVN T+ D   N++LA+ LIYQ N+E K+D LY+G L 
Sbjct: 479  GEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSGQLN 538

Query: 533  SAPEIIVTWDKAIGESDSV--MVVDRLGVITEYIDTISISSNDTTFHLNGLFQYNTANVT 590
            S+ EI +T+   +  S++V  +V DR+ +    +D +S  +  +   LNGLFQY  +N T
Sbjct: 539  SSCEITMTYYSGLYASNTVTTIVADRVDLNIISMD-LSHRTEVSKLALNGLFQYQISNFT 597

Query: 591  ---ASIFSTNDTFNDYALYNFPLDANLYAASL-NNDILIGGNFNGIAKVELNDEALISSS 646
                 +   N + N +AL NF    +L A  L N+ IL+ G    +  + LN +  + +S
Sbjct: 598  NDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSINLNTDLSVQNS 657

Query: 647  QKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEPID-----R 701
             +L ++   T    YSNGL++        D +  +  +  N    F  L+  +D      
Sbjct: 658  TRLISTENFTTFQPYSNGLVML-------DGQGNVSLFKDN----FKNLNTTMDGSLATD 706

Query: 702  IVNFTIDGHELLLFDNAYIFNVSANMYV-SNSSTFEITGQSAGINSGNDSLLFGSFLKRS 760
            + N T++G ELL+F+N YI+NV++     SNSS F +T  SAG NS ND++  G  ++  
Sbjct: 707  VANITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGKVVQWQ 766

Query: 761  VGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVLIT 820
                N  A +++D       +  LP++  P +  ++ND S  Y  +E +    + ++ IT
Sbjct: 767  YAIANQSAQVNADFNDGIEQM-SLPSNTVPSRGIFLNDDSTGYFYKESN----KSKLYIT 821

Query: 821  NTNSSSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYENVARV 880
            N+NS+S +   +W       +YD    +L +G    N+   +    S+ NLT ++ +   
Sbjct: 822  NSNSTSGL---EWYGEPETVVYDKNDTLLMVGYYNDNT---FSSTLSLTNLTSFDVIKEE 875

Query: 881  NFSTNERXXXXXXXXXXXXILVGGSYEID--NCNDLCLYNYQTKEWTSFLNDSITGDIRQ 938
            N +                +LV G +E    NC+DLCLYNY++ +W S  N+S++G +  
Sbjct: 876  NLNVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAA 935

Query: 939  MQFADEGKTLLVGGL-IKTNNESNIQLLSV---EVGSNIFSTVKSGTEPLLSFVPIDDST 994
            +Q       L++G L +   N+ N+  +++    VGS I    K     L S +    S 
Sbjct: 936  LQLYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMK--KDAPVNLHSMIV---SN 990

Query: 995  DNIIAQMNSEILRLESGTWSSFGPQLNNDSIVSGFKVLSGTESKKRDEGSHIVLLEGTLN 1054
              I+A  ++ +   +  +W+       + S  S    +S  +    +     +LL G   
Sbjct: 991  SRIVAWNDTVLFSFDGNSWTRVSVPGTDSSATS----ISSVQFISMEGTDDALLLLGEFR 1046

Query: 1055 SSEWGNLTSVVYDGSTQKWQPYFVISDPKEQES----LPSSSFFQNVNDLYLSSSQTVL- 1109
             SE+G++ S+VY+   + W PY +  D   Q +    +       N+  + L +S  VL 
Sbjct: 1047 HSEFGDIKSIVYN--FRDWIPYLLYVDGPRQGTGHLFMNRDISLHNIAQIPLLNSTRVLT 1104

Query: 1110 -QXXXXXXXXXXXXXXXXXXXXXXXKDKK----IDRGFIVLIGLALALATVAVIGLIGAL 1164
             Q                         K     +DRGF+VLIGLALALATV+V+G+ G L
Sbjct: 1105 NQSFASSTSSSVSSTSTTLPKVSTTHSKPGRRIVDRGFVVLIGLALALATVSVMGVAGVL 1164

Query: 1165 ICYFFINNNG--YESLKPRINQDEMLDTVPPEKL 1196
            + Y F +N G  Y++L PR++++ M++T+PPEKL
Sbjct: 1165 LAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/1254 (34%), Positives = 687/1254 (54%), Gaps = 98/1254 (7%)

Query: 1    MFSINPLIYVLLVLAGMVRGSQLSNIEKLLNISRYEAP------NWDSPDLTYMNNFEEL 54
            M + + LI  L +   +   SQLS +E  L I  +  P      N DS  L  + +++ L
Sbjct: 1    MRTHHKLIKSLSLFTTLSLASQLSQLENSLGIQTFAPPALIFSSNNDSS-LQLLGSYDAL 59

Query: 55   TVISYTGQQNFTVQ----ANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGT 110
            ++ +YTGQQNF+ Q     N + L+YYSN+T ++L +   +T +  IVP+  DSFILSG+
Sbjct: 60   SLYTYTGQQNFSYQITPDTNSNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGS 119

Query: 111  GQINGVALEQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGA 170
            G +N  +LE Q+  NL+SL+  PIF + +E V  IL   + V F GNF+ S   + GH  
Sbjct: 120  GSLNEYSLENQLFYNLSSLSVYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGHSV 179

Query: 171  VLWDVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSS 230
             +W++ +N+T L PF GFGENS +N++++LN DNILFAG F  + +ASLL    N +N++
Sbjct: 180  AVWNITSNSTGLLPFLGFGENSSINNILRLNDDNILFAGEFYTLDDASLLTS--NTSNAT 237

Query: 231  HEDLTSLQFDQSVPLKLSSITGE--NVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEI 288
              ++  L+    +PL  ++ + +  +  +   +C +   + W  S     TL   L  + 
Sbjct: 238  -TNIYDLELSPLLPLNEATWSSDVSDFDASSFICVNPDSDAWFVS-GTTGTLACSLPYDS 295

Query: 289  HPSKVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQ 348
              +K+RIYNS +  ++IS FR+I+ PS  IMN+TY+DP +G L+ CD++CPLLS + L+ 
Sbjct: 296  ALTKIRIYNSPDSQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLSS 355

Query: 349  ISQNSTAAPKSVGINNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEI 408
             S  ++ +  +  +++N+T +KWS  YQEF FVN +  T+LQF+AL SYGSN AL    +
Sbjct: 356  ASDAASVSEMARLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSL 415

Query: 409  FETEFMVYANNSYNEPNCES-VTEYSKAELSSDNWYTTDESDTYIS---TNIDDNIPYVT 464
            ++ E+ V+ANNS N  +C S  ++Y+ + LS ++W       TY++   T  DD IP VT
Sbjct: 416  YQDEYAVFANNSLNGASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVT 475

Query: 465  FHPNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFD 524
            F+ N+ Y G Y  N+YTPGC  D +CS RG+VNVT+ D S + +L++V IYQ N   K+D
Sbjct: 476  FNANLPYSGDYVINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYD 535

Query: 525  PLYTGSLGSAPEIIVTWDKAIGESDS---VMVVDRLGVITEYID---TISISSNDTTFHL 578
             L++G L ++  I++ +   I  SDS    +V DR  +    +D    IS S N +T  L
Sbjct: 536  ELFSGYLKNSVRIVLEYVSGI-SSDSTGTTVVADRSNIYVTSLDILGQISSSKNGSTVAL 594

Query: 579  NGLFQYNTANVTASIFSTNDTFNDYALYNFPLD-----ANLYAASLNNDILIGGNFNGIA 633
            NGLFQY  +N +++  S++       L  +PLD     ++L+A++ +N +L+GG    + 
Sbjct: 595  NGLFQYQLSNFSSTFNSSSAKVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVY 654

Query: 634  KVELNDEALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFG 693
             +E +++   S+S   G  G    +  +S G+ L G + +   +   + +Y+G +FN F 
Sbjct: 655  ALESSNDLNFSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSGVTEGAV-TYNG-SFNPFT 712

Query: 694  QL-DEPIDRIVNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLL 752
            Q  +  ID   N T    E+L+F+NAY++NVS++  +SNSS+  ++  SAG N+  D L 
Sbjct: 713  QYGNSSIDTFKNVTFGNSEILVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDLLF 772

Query: 753  FGSFLKRSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDN 812
             G+  + S    N   ++ ++  V      E    + PY   Y+N +  AY  Q    D+
Sbjct: 773  NGASSQMSYSFNNESINIGANNIVQGLNFNE---SIDPYLGLYMNTSHGAYFYQ----DD 825

Query: 813  VQHRVLITNTNSSSHMLQIQWSAPINAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLT 872
               RV  TN +  S     QW   + A +Y +  ++L  GT+ S  SS +    ++LN T
Sbjct: 826  DNTRVYFTNGSQPSW----QWPNDVVAAIYSDNQSLLIAGTSSSLESSSF---LTVLNTT 878

Query: 873  GYENVAR-------------VNFSTNERXXXXXXXXXXXXILVGGSYEID--NCNDLCLY 917
             Y+ +A              VNF++N               ++GG++ +   NC  LCL+
Sbjct: 879  TYDVIANESLSSQQSQISGIVNFASNATA------------IIGGNFSMPNVNCFGLCLF 926

Query: 918  NYQTKEWTSFLNDSITGDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTV 977
            NY    W+SF + SI G +  MQ  +E + L+V GL  T N S+I + S+ + +N  + +
Sbjct: 927  NYGNSTWSSFADASINGTVDHMQLFNESE-LIVSGLFSTKNISSITMASLNLKNNKITAL 985

Query: 978  KSG-TEPLLSFVPIDDSTDNIIAQMNSEILRLESGTWS-SFGPQLNNDSIVS--GFKVLS 1033
            KSG +    SF   D     I+A  N+ +   E   W+      +N+ S+V    +  L+
Sbjct: 986  KSGESNTFKSFTVADQK---IVAWNNTALSIYEDNVWTVERISNINSSSVVDNLNYVTLA 1042

Query: 1034 GTESKKRDEGSHIVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSF 1093
               SK+    S  +L+ G L  + +G++ ++VYD S+  W PY +I+     ES  S + 
Sbjct: 1043 SALSKRDTSSSDAILVSGQLYDNSYGHIQAMVYDFSS--WVPYLLIN----SESDSSINA 1096

Query: 1094 FQNVNDLYLSSSQTVLQXXXXXXXXXXX------XXXXXXXXXXXXKDKKIDRGFIVLIG 1147
            F + +    +++Q  L                                +KIDRGF+VL+G
Sbjct: 1097 FIDRDMSSFTNTQVALLTNSGTVSNSSSSTTSPGASASATSIPNKTHKRKIDRGFVVLLG 1156

Query: 1148 LALALATVAVIGLIGALICYFFINNNG-YESLKPRINQDEMLDTVPPEKLMKFI 1200
            LALAL TVAV+G+ G ++ Y F ++NG YE + PRI+++EM++TVPPEKLMK+I
Sbjct: 1157 LALALGTVAVLGIAGVIMAYVFRDDNGAYEPINPRIDENEMIETVPPEKLMKYI 1210

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  518 bits (1334), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 391/1205 (32%), Positives = 608/1205 (50%), Gaps = 107/1205 (8%)

Query: 44   DLTYMNNFEELTVISYTGQQNFTVQA---NESSLLYYSNDTFVKLFETSPETTVTMIVPL 100
            ++  + + E     +Y GQQNFT  +   NE  L+YYSN+T ++L     +  +  I+P 
Sbjct: 11   EIQLLGSIETFNYYNYQGQQNFTTASSSQNELELIYYSNNTLLRLDAVPTDVEMRHIIPF 70

Query: 101  FEDSFILSGTGQINGVALEQQILLNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSM 160
             +D FILSG G I+G+ L +QILLNLT L+  PIF   +  V  I   NE V F G+ + 
Sbjct: 71   MDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNEVVYFGGDITY 130

Query: 161  SVSNETGHGAVLWDVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLL 220
            + +  +G   V W+   N++ L PF GFG NS VNS+++L ++N+LF G F +++N S +
Sbjct: 131  NNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQFAKLENNSFV 190

Query: 221  QEFGNATNSSHEDLTSLQFDQSVPLKLSSITG-ENVQSDILLCPSGGQNGWSASEAVQST 279
             +  N T +    +   +  Q + L+ ++     N+  D  +CP+  Q  W  SE     
Sbjct: 191  SK-TNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDAFICPNSDQQAW-YSEGSYGV 248

Query: 280  LQFDLKNEIHPSKVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCP 339
            +  +  N +  SK+RIYN+   +++ISLFR+I  P NGI+NLTYLDP S ++K C   CP
Sbjct: 249  ITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDIKHCTENCP 308

Query: 340  LLSIEDLTQISQNSTAAPKSVG-INNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYG 398
            L + E L     N T     +  INNNSTN+KW+E YQEFAFVN +P+T LQFVA  SY 
Sbjct: 309  LFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSLQFVASNSYY 368

Query: 399  SNAALHSIEIFETEFMVYANNSYNEPNCESVTEY-SKAELSSDNWYTTDESDTYISTNID 457
             N  L   +I++  F ++ NNS+NEPNC S  +  S  +LS + W+T    ++Y++ +  
Sbjct: 369  QNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVANDNSYLANSYI 428

Query: 458  DN---IPYVTFHPNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLI 514
             N    P +T+   I  PG Y  N+ TPGC +DN+CS RGIVNVT  D S   +L S LI
Sbjct: 429  PNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNGNILGSALI 488

Query: 515  YQTNNEDKFDPLYTGSLGSAPEIIVTWDKAIGESDSVMV-------VDRLGVITEYI-DT 566
            YQ NN  K+D ++ G L ++  + V +   I  +            V R+ + +E+I D 
Sbjct: 489  YQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATVVVGVVDVVRVSISSEFISDQ 548

Query: 567  ISISSNDTTFHLNGLFQYNTAN-------VTASIFSTNDTFNDYALYNFPLDANLYAASL 619
            I     D + HLNG+F+Y+ +N       +T  I  T    +D+ + NF   A+++A   
Sbjct: 549  I---DGDRSLHLNGIFEYSPSNFTFDNGYLTGKIDYT--ILDDFGVSNFNKGASIFAVDQ 603

Query: 620  NNDILIGGNFNGIAKV-ELNDEALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSR 678
            N ++ +G     + ++  LN  ++ S+   L  SG   G++    GL++ G+        
Sbjct: 604  NQNLYLGSTNGSVYELNSLNGSSVPSTENNL--SGLINGMYSVEEGLVIFGSIA------ 655

Query: 679  HEILSYDGNAFN-SFGQLD----EPIDRIVNFTIDGHELLLFDNAYIFNVSANMYVSNSS 733
            H    Y     N S   LD    + I    N T+ G  LL+FDN+ IFN+++ M   N+S
Sbjct: 656  HRGREYGAVILNKSITPLDIVANDSIQASFNSTLFGSNLLVFDNSTIFNMTSFMVFENTS 715

Query: 734  TFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKA 793
               +  ++AG NS +D LL G+ + +     N    +SS+G  S  +L +  T      A
Sbjct: 716  YRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDT---IEGA 772

Query: 794  AYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHMLQIQWSAPINAFLYDNVPNILAIGT 853
             Y+NDT A Y+L  G+ +  Q         S    L   W + +    Y N   +L    
Sbjct: 773  IYLNDTKALYSLSSGNVNYFQL--------SDKQRLPWTWQSTVVPVFYSNGQQLLGAIQ 824

Query: 854  NGSNSSSQYDVQF-------SILNLTGYENVARVNFSTNERXXXXXXXXXXXXILVGGSY 906
              SN S    +            NLT ++  A VNF++N               LVGG +
Sbjct: 825  ENSNKSQIVLIDLFSSQVINDTGNLTMHKINAIVNFASNATA------------LVGGDF 872

Query: 907  EIDN--CNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGKTLLVGGLIKTNNESNIQL 964
             + N  C  LCLYNY    W+SFLN+SITG+I Q++F D    +L+ G ++ N  ++I L
Sbjct: 873  SLSNPACVGLCLYNYNNSNWSSFLNNSITGNISQIKFND--TQMLLSGKLEVNKTADINL 930

Query: 965  LSVEVGSNIFSTVKSGTEPLLSF---VPIDDS--TDNIIAQMNSEILRLESGT-WSSFGP 1018
            LS+ + SN         + +L +   V +DD     N++   NS  + + + T WS+   
Sbjct: 931  LSINLTSN--------KQDILLYNNSVVLDDFILVRNLVVGWNSTDIFIRNVTQWSNL-- 980

Query: 1019 QLNNDSIVSGFKVLSGTESKKRDEGSHIVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFV 1078
             + +D   +    ++  E+   D    +++  G  +S ++G + +V+YD ++  W PYF 
Sbjct: 981  NIFDDGTNA---TINRIENFGADSNPALIIY-GQFDSMKYGTINAVIYDFNS--WYPYFE 1034

Query: 1079 ISDPKEQESLPSSSFFQNVND-LYLSSSQTVLQXXXXXXXXXXXXXXXXXXXXXXXKDKK 1137
            + D   Q + P   FF + +   Y ++   V                         K  K
Sbjct: 1035 V-DVVSQTATP--LFFADRDQSSYGNTRHVVPDHIIVSSSHSSSAPSSSSSHKTNEKPYK 1091

Query: 1138 IDRGFIVLIGLALALATVAVIGLIGALICYFF--INNNGYESLKPRINQDEMLDTVPPEK 1195
            I RGF+VLIGLALALAT+ V+G+ G +I   F    N  Y+ +K   + +     + PEK
Sbjct: 1092 IRRGFVVLIGLALALATLIVLGITGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEK 1151

Query: 1196 LMKFI 1200
            L++ +
Sbjct: 1152 LIRVL 1156

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  520 bits (1338), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 368/1140 (32%), Positives = 603/1140 (52%), Gaps = 95/1140 (8%)

Query: 8    IYVLLVLAGMVRGSQLSNIEKLLNISRYEAPNWDSPD-------LTYMNNFEELTVISYT 60
            I +L V    V  +QL++++ +L I    AP ++  D       L   N F+ L  + Y 
Sbjct: 11   ILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTLNFVHYN 70

Query: 61   GQQNFT---VQANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVA 117
            GQQNFT   + ++++ L+YYSNDT+++L +    T +  I+P  +D+FILSGTG +NG  
Sbjct: 71   GQQNFTQPIISSSQNHLIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGTGSLNGFE 130

Query: 118  LEQQILLNLTSLTTSPIFPSA-VENVMDILTVNET--VIFVGNFSMSVSNET-GHGAVLW 173
            L  Q++ NLT L+ +PIF +  V  V  I    +T  V F GNFS  + +    +G ++W
Sbjct: 131  LSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNISNGLIIW 190

Query: 174  DVVANTTELFPFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQ-----EFGNATN 228
            D  +N T  + F GFG NS++N+++KLNS+++LF+G F  + + S+L       F N T+
Sbjct: 191  DSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNITFPNNTS 250

Query: 229  S--SHEDLTSLQFDQSVPLKLSSI----TGENVQSDILLCPSGGQNGWSASEAVQSTLQF 282
            S  S +++++ + +Q +PL         T + +  + L+CP+     W AS++   +LQ 
Sbjct: 251  SLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAW-ASDSKAGSLQI 309

Query: 283  DLKNEIHPSKVRIYNSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLS 342
             L   I PSK+RI+NS + + E++ FRI  G  N IM+L YLDP  G+LK C  +CPL +
Sbjct: 310  TLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSEFCPLYN 369

Query: 343  IEDLTQISQNSTAAPKSVGI-NNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNA 401
               L   + N       + + +NN+T++KWS +YQEFAFVN   +T L+F AL+SYGS  
Sbjct: 370  RNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALSSYGSRV 429

Query: 402  ALHSIEIFETEFMVYANNSYNEPNCESVTEYSKAEL----------------SSDNWYTT 445
             L  + +F+++  V+AN SYN+P+C   T Y   +L                S ++WYT 
Sbjct: 430  GLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSDNDWYTP 489

Query: 446  DESDTYISTNIDDN---IPYVTFHPNITYPGRYTFNIYTPGCLQDNSCSKRGIVNVTMID 502
              +  Y++     +   IP VTF+PN+ Y G YT ++ TPGC  DNSC  RGIVNVTM +
Sbjct: 490  LPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIVNVTMWN 549

Query: 503  RSINEVLASVLIYQTNNEDKFDPLYTGSLGSAPEIIVTWDKAI--GESDSVMVVDRLGVI 560
            ++ + +L + LIYQTN   KFD ++ G L    +I +++   +     +  +V DR+ +I
Sbjct: 550  QTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTGNFTIVADRINLI 609

Query: 561  TEYIDTI-SISSNDTTFH---LNGLFQYNTANVTASIFS--TNDTFNDYALYNFPLDANL 614
               +D + + SSN+   +   LNGLFQY   N   ++    TN T N YA  N+P + +L
Sbjct: 610  INSLDFVTTTSSNEIDIYNVTLNGLFQYPEYNSVNNLNENYTNSTINQYAYSNYPANVSL 669

Query: 615  YAASLNND-ILIGGNFNGIAKVELNDEAL-ISSSQKLGTSGYTTGIFEYSNGLLLSGTYQ 672
             AA+ + D +L+GG+ N + + ++      IS           TGI  YS+GL+  G   
Sbjct: 670  IAAAYDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGIVPYSDGLIAYGDI- 728

Query: 673  VENDSRHEILSYDGNAFNSFGQLDEPIDRIVNFTI-DGHELLLFDNAYIFNVSANMYVSN 731
            +++   ++ +++  N F + G   + I    N ++    E+L F+N Y +N S      N
Sbjct: 729  MDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNKYFYNQSNMEDFKN 788

Query: 732  SSTFEITGQSAGINSGNDSLLFGSFLKRSVGELNGLASLSSDGQVSSPTLPELPTDVQPY 791
            +STFE++  SAG N+ ND +  G   +     L G+ S++++ Q+       L  ++ PY
Sbjct: 789  TSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKE---LNLGNNIYPY 845

Query: 792  KAAYINDTSAAYALQEGSTDNVQHRVLITNTNSSSHMLQIQWSAPINAFLYDNVPNILAI 851
             A ++ND+S  YA  E +T    +R++    +S+   +   W   I++  +    ++L++
Sbjct: 846  SAVFLNDSSTIYAYMEPNTR--LNRLI----HSNGEQISWSWKNKISSMAFFPNESLLSV 899

Query: 852  GTNGSNSSSQYDV--QFSILNLTGYENVARVNFSTNERXXXXXXXXXXXXILVGGSYEID 909
            GT      S  DV   FSILNLT  + +A    + N +            +LVGG++   
Sbjct: 900  GT-----ISDKDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFS 954

Query: 910  N--CNDLCLYNYQTKEWTSFLNDSITGDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSV 967
            +  C+ LCL+NY+TK W++F+N+++ G + +++  +    +L+ G + TN  +NI L  +
Sbjct: 955  DYQCSGLCLFNYETKNWSTFMNNTLEGTVSKLELKNNSN-ILISGTLSTNKSANIDLALL 1013

Query: 968  EVGSNIFSTVKSGTEPLLSFVPIDDSTDNIIAQMNSEIL-RLESGTWSSF-----GPQLN 1021
             + +   S +   T  L SF    + T N IA  NS  L +  +  WS          L 
Sbjct: 1014 NLNTYNVSILLQNTN-LTSF----EFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLK 1068

Query: 1022 NDSIVSGFKVLSGTES----KKRDEGSHIVLLEGTLNSSEWGNLTSVVYDGSTQKWQPYF 1077
             DSI S F + +   S    K+    ++I++  G   S   G + ++ Y   T  W PYF
Sbjct: 1069 LDSI-SIFDITNKNSSSILEKRALRDTNIMVATGQFYSKGLGTVQALYYTSDT--WIPYF 1125

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 1/68 (1%)

Query: 1134 KDKKIDRGFIVLIGLALALATVAVIGLIGALICYFFINNNG-YESLKPRINQDEMLDTVP 1192
            K  KI RGF+VLIGLAL+LATVA++G+ G L+ + F ++ G YESLKPR  + EM D VP
Sbjct: 1210 KKHKIQRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGDYESLKPRTTEHEMFDAVP 1269

Query: 1193 PEKLMKFI 1200
            PEKLM F+
Sbjct: 1270 PEKLMPFV 1277

>KLLA0C17754g Chr3 (1576357..1577040) [684 bp, 227 aa] {ON} similar
           to uniprot|P26364 Saccharomyces cerevisiae YER170W ADK2
           Mitochondrial adenylate kinase catalyzes the reversible
           synthesis of GTP and AMP from GDP and ADP may serve as a
           back-up for synthesizing GTP or ADP depending on
           metabolic conditions 3' sequence of ADK2 varies with
           strain background
          Length = 227

 Score = 32.0 bits (71), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 33/69 (47%), Gaps = 7/69 (10%)

Query: 209 GSFQEIQNASLLQEFGNATNSSHEDLTSLQFDQSVPLKLSSIT----GENVQSDIL---L 261
           GS +  Q + LL+EFG+    S  DL   Q +   PL LS+ +    G+ +  D++   +
Sbjct: 16  GSGKGTQTSKLLKEFGSIKAISSGDLLRKQIEHGTPLGLSASSYIEKGQLLPDDLITGVV 75

Query: 262 CPSGGQNGW 270
           C      GW
Sbjct: 76  CDELKSRGW 84

>Kwal_27.12700 s27 complement(1339337..1341091) [1755 bp, 584 aa]
           {ON} YGR077C (PEX8) - peroxisome associated protein
           containing a PTS1 signal [contig 260] FULL
          Length = 584

 Score = 32.3 bits (72), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/105 (20%), Positives = 49/105 (46%), Gaps = 9/105 (8%)

Query: 128 SLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTTELFPFKG 187
           S+  S I+ SA++   D LT++E++  +  + + +S         +D+  N  +      
Sbjct: 66  SIICSKIWDSALKG--DFLTLHESIEMIFLWKLEISEPCVSITEFYDIWDNAIKCCGRWS 123

Query: 188 FGENSIVNSVVKLNSDNILFAGSFQEIQNASLLQEFGNATNSSHE 232
           F + +I+ +++K  S        F ++Q +  L + G+ T   H+
Sbjct: 124 FAQITILGAIIKTKSK-------FSQLQASFFLDDVGSVTRQYHD 161

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 131,326,155
Number of extensions: 6144558
Number of successful extensions: 15318
Number of sequences better than 10.0: 60
Number of HSP's gapped: 15568
Number of HSP's successfully gapped: 63
Length of query: 1200
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1079
Effective length of database: 39,606,813
Effective search space: 42735751227
Effective search space used: 42735751227
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)