Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F18953g8.255ON64764733620.0
Ecym_43168.255ON62364114270.0
AGR096C8.255ON62364013501e-179
KLTH0G13860g8.255ON70869813121e-172
Kwal_56.235838.255ON70070213101e-172
TDEL0F038208.255ON68768212781e-167
Kpol_392.118.255ON67569112091e-157
SAKL0H17226g8.255ON71972112131e-157
NCAS0B038808.255ON70669111861e-153
NDAI0J014108.255ON71669411731e-151
YDR108W (TRS85)8.255ON69867911691e-151
ZYRO0C01826g8.255ON69970411631e-150
Skud_4.3698.255ON69869011531e-148
Suva_2.2688.255ON69566011421e-147
KAFR0B055708.255ON66967811301e-145
Smik_4.3548.255ON69868111271e-145
CAGL0B01705g8.255ON67268410911e-140
KNAG0H032708.255ON64868510521e-134
TPHA0B032608.255ON7145839051e-111
TBLA0E043808.255ON8896468871e-107
SAKL0A10274g1.530ON42979706.7
TBLA0B027308.797ON255109697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F18953g
         (647 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...  1299   0.0  
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   554   0.0  
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   524   e-179
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   509   e-172
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   509   e-172
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   496   e-167
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   470   e-157
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   471   e-157
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   461   e-153
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   456   e-151
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...   454   e-151
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   452   e-150
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...   448   e-148
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...   444   e-147
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   439   e-145
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...   438   e-145
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   424   e-140
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   409   e-134
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   353   e-111
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   346   e-107
SAKL0A10274g Chr1 (902542..903831) [1290 bp, 429 aa] {ON} simila...    32   6.7  
TBLA0B02730 Chr2 complement(628543..629310) [768 bp, 255 aa] {ON...    31   7.4  

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score = 1299 bits (3362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/647 (97%), Positives = 630/647 (97%)

Query: 1   MSLQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNID 60
           MSLQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNID
Sbjct: 1   MSLQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNID 60

Query: 61  SISMLFRYFGDYIQDRDQIPSTTDLKDPGSVSSGRHRSDSLFQRQASECVRFTRSLEDLI 120
           SISMLFRYFGDYIQDRDQIPSTTDLKDPGSVSSGRHRSDSLFQRQASECVRFTRSLEDLI
Sbjct: 61  SISMLFRYFGDYIQDRDQIPSTTDLKDPGSVSSGRHRSDSLFQRQASECVRFTRSLEDLI 120

Query: 121 SIDSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHSIYHRFFITLSSINLSRYH 180
           SIDSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHSIYHRFFITLSSINLSRYH
Sbjct: 121 SIDSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHSIYHRFFITLSSINLSRYH 180

Query: 181 SFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLENFPEFININDILPVFVLCYDEN 240
           SFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLENFPEFININDILPVFVLCYDEN
Sbjct: 181 SFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLENFPEFININDILPVFVLCYDEN 240

Query: 241 SREQWESVQALTKSLKKQLFVESVSISLFTPHDNQKSTTLHSPITVSLHEQVFNMSHPTS 300
           SREQWESVQALTKSLKKQLFVESVSISLFTPHDNQKSTTLHSPITVSLHEQVFNMSHPTS
Sbjct: 241 SREQWESVQALTKSLKKQLFVESVSISLFTPHDNQKSTTLHSPITVSLHEQVFNMSHPTS 300

Query: 301 INIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWDETVLQPRKSIFQSNKFFRRFISPKS 360
           INIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWDETVLQPRKSIFQSNKFFRRFISPKS
Sbjct: 301 INIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWDETVLQPRKSIFQSNKFFRRFISPKS 360

Query: 361 NHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKDFESY 420
           NHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKDFESY
Sbjct: 361 NHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKDFESY 420

Query: 421 PQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPLMTRAIEQYKKQDEKHSLRVIHCIXX 480
           PQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPLMTRAIEQYKKQDEKHSLRVIHCI  
Sbjct: 421 PQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPLMTRAIEQYKKQDEKHSLRVIHCILT 480

Query: 481 XXXXXXXXXXXXXXXPLAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFL 540
                          PLAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFL
Sbjct: 481 FSDLLLSLSDTWVSSPLAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFL 540

Query: 541 PKPDEENKADESEAAENSKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQL 600
           PKPDEENKADESEAAENSKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQL
Sbjct: 541 PKPDEENKADESEAAENSKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQL 600

Query: 601 VAAKKWVELHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRLSMELS 647
           VAAKKWVELHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRLSMELS
Sbjct: 601 VAAKKWVELHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRLSMELS 647

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/641 (46%), Positives = 411/641 (64%), Gaps = 34/641 (5%)

Query: 5   FSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSISM 64
            SYEKYMNL+ YP+ WS P+P EIS+KVI N LSPCI VQS   L+ HL++++ I S+  
Sbjct: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61

Query: 65  LFRYFGDYIQDRDQIPSTTDLKDPGSVSSGRHRSDSLFQRQASECVRFTRSLEDLISIDS 124
           L RYFGDYIQDRDQ+      K     ++ R R +SLFQR +S  +RF   L D+IS+  
Sbjct: 62  LLRYFGDYIQDRDQLDDKISAK--LQPNNRRQRQNSLFQRNSSRYIRFQTPLTDIISV-G 118

Query: 125 EDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHSIYHRFFITLSSINLSRYHSFHH 184
           ++H ++  D++  LS++L+++E     N +P +LLKHSI+H+F   LSS  LS YHSF+H
Sbjct: 119 DNHQVEFNDLEESLSEFLKDIEE-HTVNDSPCELLKHSIFHKFITMLSSTTLSPYHSFNH 177

Query: 185 PVVALLPLDITKGQGYENAREILIHFKNLNNTLENFPEFININDILPVFVLCYDENSREQ 244
           P++ALL LDIT+G+ YE ARE+L+ FKNL NTL  FP FIN ND+LPVF+LC+D++S +Q
Sbjct: 178 PILALLALDITQGEEYELARELLMEFKNLPNTLSKFPAFINTNDVLPVFILCFDQSSPQQ 237

Query: 245 WESVQALTKSLKKQLFVESVSISLFTPHDNQKSTTLHSPITVSLHEQVFNMSHPTSINIP 304
           WE+VQ+L K +KKQLFVESV + +FT   + +S  LH PIT SL EQ+++ SHP S+ + 
Sbjct: 238 WETVQSLMKVIKKQLFVESVPLPIFTNFRD-RSIVLHPPITNSLQEQLYDSSHPVSLKLC 296

Query: 305 SRLLTHIYDTISFIVEEMMIPFMHRKLVFWDETVLQPRKSIFQSNKFFRRFISPKSNHPI 364
            RL+  IYDTI+ +VE++MIPFM+RK+ FWDET+LQPRKSIF SNK  +RFIS  S  P 
Sbjct: 297 PRLVKLIYDTINSMVEDLMIPFMNRKISFWDETILQPRKSIFHSNKLLKRFISKSSGSPT 356

Query: 365 AHKVNDPQDPAEGDIMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKDFESYPQYL 424
           A        P   D  F ASS EFLLRKLADW FMLSD+K AYSIY++L +DFE+YP Y+
Sbjct: 357 ASM------PTSPDGHFLASSNEFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYPLYM 410

Query: 425 APCLEYKTISLLMGAQNIITAKTIKTEVDPLMTRAIEQYKKQDEKHSLRVIHCIXXXXXX 484
           + C E+  +SLLMGA +I+TAK IK ++DPL+ + ++     +   SL  I C+      
Sbjct: 411 SSCQEFSALSLLMGAHSIVTAKMIKNDIDPLIMKYLDY--AVNNIISLDQIRCMIYMTEL 468

Query: 485 XXXXXXXXXXXPLAVNYLTYI-QKSHL-LGPYATVIILERIAYAYEICIDLRVNDHFLPK 542
                      P A+ YL  I QK +L LGP    +I ERI++AY + ID R++      
Sbjct: 469 FLSLSDTWTSAPFAIKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIH------ 522

Query: 543 PDEENKADESEAAENSKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVA 602
                 AD+   ++     E  L       + N +KL    ++++G TR+RK +++QL+A
Sbjct: 523 ------ADDDSTSDCDHDLEEEL-------YLNPHKLHCGKIQNQGFTRYRKEAVFQLLA 569

Query: 603 AKKWVELHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRLS 643
           AKKW++  +  Q  W +      Y  L  +     L  RL+
Sbjct: 570 AKKWLQCGQTRQGAWSLKRCNRVYRDLPFANAEGTLLSRLA 610

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  524 bits (1350), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 285/640 (44%), Positives = 401/640 (62%), Gaps = 39/640 (6%)

Query: 5   FSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSISM 64
            SYE YMNL+ YPEHWS P+PHEIS++VI N LSPC+ VQS   L+ HL + ++  S+ M
Sbjct: 2   LSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLYM 61

Query: 65  LFRYFGDYIQDRDQIPSTTDLKDPGSVSSGRHRSDSLFQRQASECVRFTRSLEDLISIDS 124
           L RYF DY+++R +        + GSVS G+ R  S++QRQ S  VRF R LE++I    
Sbjct: 62  LLRYFADYVRERGE--------EVGSVS-GQRRPGSVYQRQTSRYVRFQRPLEEVIET-V 111

Query: 125 EDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHSIYHRFFITLSSINLSRYHSFHH 184
           E   +   D++  L Q+L+++E     N +PS+LLKHSI+H+F   LSS  LS YH+ +H
Sbjct: 112 EQQAVDFEDLEEALGQHLRDIEA-RTTNESPSELLKHSIFHKFITMLSSTALSPYHTVNH 170

Query: 185 PVVALLPLDITKGQGYENAREILIHFKNLNNTLENFPEFININDILPVFVLCYDENSREQ 244
           P++ALL LD+T+G+ Y  ARE+L+ FKNL +    FP +IN ND+LPVF+LC+DE+S EQ
Sbjct: 171 PIMALLALDVTQGEEYTLARELLVQFKNLPSKSSKFPSYINTNDVLPVFILCFDESSSEQ 230

Query: 245 WESVQALTKSLKKQLFVESVSISLFTPHDNQKSTTLHSPITVSLHEQVFNMSHPTSINIP 304
           WE+VQAL K++KKQLFVESV + +FT +++     LH PIT SL EQV++ SHP  + + 
Sbjct: 231 WETVQALQKAIKKQLFVESVPLPIFTNYESDP-VVLHPPITNSLQEQVYDGSHPPLLRLC 289

Query: 305 SRLLTHIYDTISFIVEEMMIPFMHRKLVFWDETVLQPRKSIFQSNKFFRRFISPKSNHPI 364
            +L+  IY+TI+ +VE++MIPFM+RK+ FWDET+LQPRKSIF  NKF +RF++ K+N   
Sbjct: 290 PQLVDVIYETINAMVEDLMIPFMNRKISFWDETILQPRKSIFHGNKFLKRFMN-KTNSSA 348

Query: 365 AHKVNDPQDPAEGDIMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKDFESYPQYL 424
           A  ++        D  F ASS EFLLRKLADWSFMLSD+K AYSIY +L +DFE YPQYL
Sbjct: 349 AGTLS-----TSSDGYFLASSNEFLLRKLADWSFMLSDYKTAYSIYYILLRDFELYPQYL 403

Query: 425 APCLEYKTISLLMGAQNIITAKTIKTEVDPLMTRAIEQYKKQDEKHSLRVIHCIXXXXXX 484
           + C E+  +SLLMGA +I+T K IK ++DPL+ + ++        + L    C+      
Sbjct: 404 SSCQEFSALSLLMGAHSIVTTKMIKNDIDPLIMKYMD--STVASLNYLGKFRCLVYMAEL 461

Query: 485 XXXXXXXXXXXPLAVNYLTYI-QKSHL-LGPYATVIILERIAYAYEICIDLRVNDHFLPK 542
                      P A+ YL  I Q   L LGP +  ++ ERI+YAY++ ID R++      
Sbjct: 462 FLSLSDTWTSAPFAIKYLELILQNEQLKLGPLSRTMLWERISYAYQLRIDPRIHT----- 516

Query: 543 PDEENKADESEAAENSKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVA 602
            D+E  +D     E + + +  +  + +H WR         + S GLTR RK ++++L+A
Sbjct: 517 -DDEYLSD--NFMELTTEDDFCMNPNKLHHWR---------IHSLGLTRHRKEAVFRLLA 564

Query: 603 AKKWVELHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRL 642
           AKKW+E     Q  W +      Y  L  +     L  RL
Sbjct: 565 AKKWLEYGHIRQGAWSLKGCNKVYRNLGFANADGTLLSRL 604

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  509 bits (1312), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 283/698 (40%), Positives = 408/698 (58%), Gaps = 69/698 (9%)

Query: 3   LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62
           +  S+ KYMNL  + +    P+P EIS+K++ + +SP + V S   LD H+++ Y +DS+
Sbjct: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSL 60

Query: 63  SMLFRYFGDYIQDRDQIPSTTDLKDPGSVSSGRHRSDSLFQRQASECVRFTRSLEDLISI 122
            ML RYFGD + DRDQ  +  +L      +  R RS+SLFQRQAS  +RFTR L DLI +
Sbjct: 61  YMLLRYFGDCVSDRDQAEAGPELGTESGKNRNRARSNSLFQRQASHYLRFTRPLTDLIDV 120

Query: 123 -DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHSIYHRFFITL--SSINLSRY 179
            +S D +     ++ FL +YL  +E     + TP  LL+HSIYH+FF T   S+ +LS Y
Sbjct: 121 RESRDLLFDYHSLEVFLEKYLSLVEANTTSD-TPHTLLQHSIYHKFFTTAISSTAHLSPY 179

Query: 180 HSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLENFPEFININDILPVFVLCYDE 239
            SF+HPV +LL LDI+K QGYE AR++LI FKN++NT  +FP FIN+NDILPVF+LCY+E
Sbjct: 180 ESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNTTPHFPAFINVNDILPVFLLCYEE 239

Query: 240 NSREQWESVQALTKSLKKQLFVESVSISLFTPHDNQKST---TLHSPITVSLHEQVFNMS 296
           +SREQ+E  Q+L+K++KKQLFVES+ +  +  + N  ++    LH PI  SL E +++M 
Sbjct: 240 DSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAGASPSRILHQPIMSSLEETMYSMM 299

Query: 297 HPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWDETVLQPRKSIFQSNKFFRRFI 356
             ++I +P  L+ +IYD ++ +++E+MIPFM RK+ FWDE++LQPRKSIF ++KFFR+ I
Sbjct: 300 KESTITLPLSLINYIYDRLTNLIDELMIPFMKRKISFWDESILQPRKSIFPNSKFFRKLI 359

Query: 357 SPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKD 416
           S     P A   +      +G   F A+S EF+LRKLADWSFMLSDFK AYS Y+LL+KD
Sbjct: 360 SKTPAPPPAS--DSATHSQQGVAYFAATSNEFILRKLADWSFMLSDFKNAYSTYELLSKD 417

Query: 417 FESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPLMTRAIEQYK------------ 464
           FE  P+YLA CLE+  +S+LMGAQ+I+T K IK ++DPL+ RA++ Y+            
Sbjct: 418 FEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDIDPLINRALKSYELSARKAKEKNAQ 477

Query: 465 -------KQDEKHSLRV-------------------------------IHCIXXXXXXXX 486
                  K+ EK S                                    C+        
Sbjct: 478 LKSSALAKKAEKDSKSATLPSTVSDEHSGQELDEGVSSAPSQSAQSYETRCMLLAAELFL 537

Query: 487 XXXXXXXXXPLAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEE 546
                    P A+ YL  I     LG  + +++ ER+AY Y + +D RV    LP  D  
Sbjct: 538 SLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERLAYCYALRVDPRVKGK-LPSLD-- 594

Query: 547 NKADESEAAENSKKGE--NGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAK 604
                 ++ +N K+GE   G +  D    + ++K+ QN + S GL R RK +L++L+A K
Sbjct: 595 -----GQSGQNEKRGEESEGSDESDDETQKYDHKISQNCMASLGLARRRKSTLFRLIATK 649

Query: 605 KWVELHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRL 642
           KW E  +  QA W +      Y +L  + R D +  +L
Sbjct: 650 KWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKL 687

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  509 bits (1310), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 285/702 (40%), Positives = 410/702 (58%), Gaps = 75/702 (10%)

Query: 3   LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62
           +  SYE+YMNL+ + +  S P+P EIS+K++ N +SP + V S+  LD H+++ Y +DS+
Sbjct: 1   MPLSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSL 60

Query: 63  SMLFRYFGDYIQDRDQIPSTTDLKDPGSVSSGRHRSDSLFQRQASECVRFTRSLEDLISI 122
            ML RYFGD I DRDQ  S  +     + S  R RS SLFQRQAS+ +RFTR L D+I  
Sbjct: 61  YMLLRYFGDCISDRDQADSEQESGVEPNKSRARSRSGSLFQRQASQFLRFTRPLSDIIGT 120

Query: 123 -DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHSIYHRFFITL--SSINLSRY 179
            ++ D +     ++ FL +YL+ L  +     TP  LL+HSIYH+FF T   S+ +LS Y
Sbjct: 121 RETRDLLFDYHSLEVFLQKYLE-LVDVKTSPDTPHTLLQHSIYHKFFTTAISSTAHLSPY 179

Query: 180 HSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLENFPEFININDILPVFVLCYDE 239
             F+HPV +LL LDI++ +GYE+AR++L+ FKN++N   +FP FIN+NDILPVF+LCY+E
Sbjct: 180 ECFNHPVCSLLALDISQNEGYEDARDLLVTFKNMHNKTPHFPSFINVNDILPVFLLCYEE 239

Query: 240 NSREQWESVQALTKSLKKQLFVESVSISLFTPHDNQKST---TLHSPITVSLHEQVFNMS 296
            SREQ+E+ Q+L K +KKQLFVES+ +  ++ +   K T    LH PI  SL E +F+M 
Sbjct: 240 GSREQFETCQSLAKMMKKQLFVESLLLPCWSVNFTAKDTPTRVLHQPIMSSLEETMFSML 299

Query: 297 HPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWDETVLQPRKSIFQSNKFFRRFI 356
             ++ ++P   + HIYD ++ +V+E+MIPFM RK+ FW+E++LQPR+SIF ++KFFR+ I
Sbjct: 300 KDSAFDLPLPFIEHIYDRLTKLVDELMIPFMKRKISFWEESILQPRRSIFPNSKFFRKLI 359

Query: 357 SPKSNHPIAHKVNDPQDPAE-GDIMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTK 415
              S  P     ND    +E G   F A+S E LLRKLADWSFMLSDFK AYS Y+LL+K
Sbjct: 360 ---SKAPTPSTNNDSATHSEQGLAYFAATSNELLLRKLADWSFMLSDFKTAYSTYELLSK 416

Query: 416 DFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPLMTRAIEQYK----KQDEKHS 471
           DFE +P+YLAPCLE+  +S+LMGAQ+I+T K IK ++DPL+TRA++ Y+    K  E++ 
Sbjct: 417 DFEQHPEYLAPCLEWCALSVLMGAQSIVTVKMIKNDIDPLITRALKSYELCASKAKERNG 476

Query: 472 L--------------------------RV--------------------IHCIXXXXXXX 485
           L                          RV                      C+       
Sbjct: 477 LLKSKLQNRDHDKSLNGFETISNSHDDRVSGTTDFEISSTPSQSAQSYETRCMLLAAELF 536

Query: 486 XXXXXXXXXXPLAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHF----LP 541
                     P A+ YL  I     +G  + ++I ER+AY Y + +D RV        + 
Sbjct: 537 LSLSDTWTATPYAIKYLETILDQCTVGALSEIVIWERLAYCYALRVDPRVKSRLTASEIQ 596

Query: 542 KPDEENKAD-ESEAAENSKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQL 600
             D+  K D ESE ++N    E+ +          ++K+ Q+ + S GLTR RK +L++L
Sbjct: 597 SSDQNEKLDEESEGSDNDSGDESQV---------CQHKMSQSCIASSGLTRKRKATLFRL 647

Query: 601 VAAKKWVELHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRL 642
           +A KKW E  +  QA W        Y  L  + R D +  +L
Sbjct: 648 IATKKWTESKQWRQACWSFQDLEVMYSHLVFANREDLILKKL 689

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  496 bits (1278), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 282/682 (41%), Positives = 401/682 (58%), Gaps = 60/682 (8%)

Query: 3   LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62
           ++ SYE YMNL+ + +H  + +P +I+K+++ N +SP ICV S  ELD H+++ +++DS+
Sbjct: 2   VKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSL 61

Query: 63  SMLFRYFGDYIQDRDQIPSTTDLKDPG-------------SVSSG--RHRSDSLFQRQA- 106
            ML R+FGD + DRDQ    T    P              +V+SG  R RS+SLFQR A 
Sbjct: 62  YMLLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRDAT 121

Query: 107 -SECVRFTRSLEDLI-SIDSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHSIY 164
            S+ +RFTR L DL+ S D+ D +     ++SFL   L  +E   N+  TP KLLK S+Y
Sbjct: 122 QSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDK-TPHKLLKKSLY 180

Query: 165 HRFF-ITLSSIN-LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLENFPE 222
           HRFF + +SS   LS Y +F+HPVV+L+ LDI  GQGYE AR++L  FKNLN+T +NFP 
Sbjct: 181 HRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTTKNFPV 240

Query: 223 FININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFTPHDNQKSTT--- 279
           F+N ND+LPVF+LCY+ +S EQ+E  Q+LTK LKKQLFVE + + L+   DN K+ T   
Sbjct: 241 FLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLW--KDNYKTATQVI 298

Query: 280 LHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWDETVL 339
           LH PI  SL E ++ +  P+ I +   L+  IYD +  ++  +MIPFM RK+ FW+ET+L
Sbjct: 299 LHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFWEETIL 358

Query: 340 QPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLADWSFM 399
           QPR+S+F  +KF +RF+S  ++    H+       A G   F +SS EFL+RKLADWS M
Sbjct: 359 QPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLADWSMM 418

Query: 400 LSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPLMTRA 459
           LSD+K AYS YD L+ D E YP+YLA CLE+ ++S+LMGAQNI+TAK +KT++DPL+ RA
Sbjct: 419 LSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRA 478

Query: 460 IEQY-------------KKQDEKHSLRV--IHCIXXXXXXXXXXXXXXXXXPLAVNYLTY 504
           +E Y             KK +    +R     C+                 P A+  L  
Sbjct: 479 VETYENCALYDTQLSGSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYALRNLET 538

Query: 505 IQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAENSKKGENG 564
           I     LGP + ++I ER++  Y+  ID R+           +K ++  A  N +K EN 
Sbjct: 539 ILAECRLGPCSQIMIWERLSNCYQQRIDHRI----------RHKVNDG-AMSNEEKVENE 587

Query: 565 LEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKWCIYHAAP 624
              DD     +E +    ++ + GLTR RK + +QL+AA KW E  +  QA WC+     
Sbjct: 588 ---DD-----SEKEHTHADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTED 639

Query: 625 AYEKLSLSKRPDGLFHRLSMEL 646
           AY  +    R D    +L   L
Sbjct: 640 AYAGIEFVNRKDLALAKLKETL 661

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  470 bits (1209), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 273/691 (39%), Positives = 399/691 (57%), Gaps = 72/691 (10%)

Query: 2   SLQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDS 61
           SLQFSYE YMNL+ + +  + P+P +ISK+++ N ++P I V S  ELD H++D YNIDS
Sbjct: 3   SLQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDS 62

Query: 62  ISMLFRYFGDYIQDRDQI-------------------------PSTTDLKDPGSVSSGRH 96
           + +L RYFG  I DRDQ                           ++  L+ P S    R 
Sbjct: 63  LYLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRS 122

Query: 97  RSDSLFQRQASEC--VRFTRSLEDLI-SIDSEDHILQSTDIDSFLSQYLQNLEPIMNENG 153
           RS+SLFQR +++   +RFT+ +EDLI S DS D +     ++ +L + L  ++   N+  
Sbjct: 123 RSNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDE- 181

Query: 154 TPSKLLKHSIYHRFFITL--SSINLSRYHSFHHPVVALLPLDITKGQGYENAREILIHFK 211
           T  K LK S++HRFF +   S+  LS Y SF+HP+++L+ LDI+KGQ YE+AR++LI FK
Sbjct: 182 TDHKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFK 241

Query: 212 NLNNTLENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFT- 270
           N NN +E FP F++ NDIL VF+LCYD +S EQ E  Q + K LKKQLF ES+ + L+  
Sbjct: 242 NQNNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNK 301

Query: 271 PHDNQKSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRK 330
            H       LH P   SL E ++    P+   +P  L+  IYD +  +V ++MIPFM RK
Sbjct: 302 SHSEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRK 361

Query: 331 LVFWDETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLL 390
           + FW+ET+LQPRKS+F  NK FR+F++ +S+   A++ N+    + G+  F +SSPEFLL
Sbjct: 362 ISFWEETILQPRKSLFHGNKLFRKFMN-RSSSQTANQYNNIVKDSRGNEYFTSSSPEFLL 420

Query: 391 RKLADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKT 450
           RKLADWS M+SDFK AYS Y+ L  D E++P+YLA CLE+  IS+LMGAQNI+TAK IK 
Sbjct: 421 RKLADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKN 480

Query: 451 EVDPLMTRAIEQYKK----------QDEKHSLRV----IHCIXXXXXXXXXXXXXXXXXP 496
           +V+PL+ R+++ Y++           DE  S  V      C+                 P
Sbjct: 481 DVNPLIERSLDTYEQCSILAQNSLENDELLSEPVRSYETRCMLLTSELFLSLNDTWTSTP 540

Query: 497 LAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAE 556
            A++ L  I     LG  + ++I ER++  Y +  D R+           ++ +     E
Sbjct: 541 YALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRI----------RHRVETVTKIE 590

Query: 557 NSKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAK 616
           N++ G+  L+ DD              + S+GL R RK + ++L+AAKKW E  +  Q  
Sbjct: 591 NNEGGQQ-LQTDD--------------IVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVS 635

Query: 617 WCIYHAAPAYEKLSLSKRPDGLFHRLSMELS 647
           WC+      Y+ LS SKRP+ ++ +L  EL+
Sbjct: 636 WCLRDVEYIYDDLSFSKRPELIYQKLKDELN 666

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  471 bits (1213), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 281/721 (38%), Positives = 415/721 (57%), Gaps = 85/721 (11%)

Query: 3   LQFSYEKYMNLIQYPEHWSNPIP--HEISKKVIYNTLSPCICVQSNLELDNHLKDMYNID 60
           +  SYE YMNL+ + +H    +    E++KK++ N +SP + V S   LD+HL++ Y + 
Sbjct: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 61  SISMLFRYFGDYIQDRDQIPST-TDLKDPGSVSSGRHRSDSLFQRQASECVRFTRSLEDL 119
           S+ ML R+FGD + DRDQ   T T+ K       GR RS+SLFQR++S  VRFTR L DL
Sbjct: 61  SMYMLLRFFGDCVTDRDQENETETNFK-------GRPRSNSLFQRESSTFVRFTRPLIDL 113

Query: 120 ISIDSEDH--ILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHSIYHRFFITL--SSIN 175
           + +   DH  +     ++ FL +YL+ ++  ++ N TP +LLKHSIYH+FF     S+  
Sbjct: 114 VDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSAN-TPHRLLKHSIYHKFFTAAISSTAY 172

Query: 176 LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLEN---FPEFININDILPV 232
           LS Y SF+HPV++LL LDI++G  YENAR++LI FKN+N+  ++   FP FININDILPV
Sbjct: 173 LSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKNMNSATKSAASFPTFININDILPV 232

Query: 233 FVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFTPHDN----QKSTTLHSPITVSL 288
           F+LCY+++S EQ+E+ Q+L K LKKQLFVES+ + L+   ++    +    LH PI  SL
Sbjct: 233 FLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWRDSEDYDAEEPRRILHPPIMSSL 292

Query: 289 HEQVF----------NMSHPTSIN------IPSRLLTHIYDTISFIVEEMMIPFMHRKLV 332
            E ++          N+S+  S N      +P  L+  IYD ++ ++ E+MIPFM RK+ 
Sbjct: 293 EEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVETIYDRLNLLITELMIPFMKRKIS 352

Query: 333 FWDETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPA-EGDIMFPASSPEFLLR 391
           FW+ET+LQPRKSIF + KF RRF+S  +    A  +N   D A +    FPASS EFLLR
Sbjct: 353 FWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPINSKSDGAVQRSNFFPASSNEFLLR 412

Query: 392 KLADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTE 451
           KLADWSFMLSD++ AY+ YD L+KD E + +YLAPCLE+  +S+LMGAQ+I+T K IK +
Sbjct: 413 KLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPCLEWCAVSVLMGAQSIVTVKMIKND 472

Query: 452 VDPLMTRAIEQYKKQDEK----HSLRV-------------IHCIXXXXXXXXXXXXXXXX 494
           +DPL++++++ Y+K   K    H                   C+                
Sbjct: 473 IDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPAQSYETRCMLLSAELFLSLSDTWTA 532

Query: 495 XPLAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVN-------------DHFLP 541
            P A+ YL  I ++  LGP + V++ E++AY YE+ +D RV+             +  + 
Sbjct: 533 TPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELRVDPRVSHIHAKQRHLQYEREEVIS 592

Query: 542 KPDEENKADESEAAENSKKGENGLEVD----------------DMHEWRNENKLIQNNLR 585
           K +E      SE+  +++K + G + +                +  ++ N NKL   ++ 
Sbjct: 593 KSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDEALSNREKEHADFVNPNKLPYKDIA 652

Query: 586 SEGLTRFRKYSLYQLVAAKKWVELHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRLSME 645
             GLTR RK + ++L+AA KW E  +  QA W +      Y  L  S R   +  RL  E
Sbjct: 653 LLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRDVDTVYSGLVFSYRKGLILERLVGE 712

Query: 646 L 646
           +
Sbjct: 713 I 713

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  461 bits (1186), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 259/691 (37%), Positives = 406/691 (58%), Gaps = 59/691 (8%)

Query: 3   LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62
           + FSYE YMNL+ + ++    +P EI+K+++ N +SP I V S  ELD+H+ + YNIDS+
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 63  SMLFRYFGDYIQDRDQ-------------------IPSTTDLKDPGSVSSGRHRSDSLFQ 103
            ML R+F   + DRDQ                   +P+T+ L  P   + GR RS+SLFQ
Sbjct: 61  YMLLRFFSGCVSDRDQANELEKSQKDKISSNNTLTLPTTSPL--PKVRTRGRSRSNSLFQ 118

Query: 104 RQA--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLK 160
           R +  S+ +RFT+ L D+I+  ++ D +     ++ +L  YL  ++   ++N TP +LLK
Sbjct: 119 RDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDN-TPYELLK 177

Query: 161 HSIYHRFF-ITLSSIN-LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLE 218
            SIYH FF + +SS   LS Y  F+HPVV+L+ +DI+ GQ Y++ R++L+ FKNLN++  
Sbjct: 178 KSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNSSTH 237

Query: 219 NFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFT---PHDNQ 275
           NFP F+N ND+LPV +LCYD+   EQ+E+ QALTK +KKQLFVE +S+ L+    P D Q
Sbjct: 238 NFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSYPSDPQ 297

Query: 276 KSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWD 335
               LH P+  SL E ++ ++ P  + +P  L+  IY+ +  +V  +MIPFM RK+ FWD
Sbjct: 298 --VHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIAFWD 355

Query: 336 ETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLAD 395
           ET+LQPRKS+F   KF ++F++  +   + H+ N     A+G+  F ++S EFL+RKLAD
Sbjct: 356 ETILQPRKSLFHGAKFLKKFMTKTA---LTHQENLLTKDAQGNEYFTSASSEFLMRKLAD 412

Query: 396 WSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPL 455
           WS MLSDFK AY+ Y+ LT D ES+P+Y A CLE+  +SLLMGAQNI+T K +K +++PL
Sbjct: 413 WSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDINPL 472

Query: 456 MTRAIEQYK-------KQDEKHSLRVI---------HCIXXXXXXXXXXXXXXXXXPLAV 499
           + +A+  Y+       + D++++  +I          C+                 P A+
Sbjct: 473 IEKALSTYENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPYAI 532

Query: 500 NYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAENSK 559
           +YL  I     LG  + ++I ER++  YE+ +D R+           N +   +++E+  
Sbjct: 533 SYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHK--AAGTIANTSSPKKSSESDM 590

Query: 560 KGE----NGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQA 615
           +G     + L  +D+    + N     ++ S+G TR RK + ++L+AAKKW E  +  Q 
Sbjct: 591 QGHVMTPSPLTKEDVS--NDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQV 648

Query: 616 KWCIYHAAPAYEKLSLSKRPDGLFHRLSMEL 646
            WC+      Y K+ L+ R D +  ++  +L
Sbjct: 649 SWCLQSIDDTYSKIGLADRDDLILKKIQNKL 679

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  456 bits (1173), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 262/694 (37%), Positives = 393/694 (56%), Gaps = 67/694 (9%)

Query: 5   FSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSISM 64
           FSYE YMNL+ + +H    +P EI+K+++ N ++P I V S  +LDNH+++ YNIDS+ M
Sbjct: 3   FSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSLYM 62

Query: 65  LFRYFGDYIQDRDQ--------------------------IPSTTDLKDPGSVSSGRHRS 98
           L RYFG  + DRDQ                          +PS    + P     GR RS
Sbjct: 63  LLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQ-QPPLKARRGRSRS 121

Query: 99  DSLFQRQA--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTP 155
           +SLFQR +  S+ +RFT+ ++D+++I  S D +     ++ +L QYLQ +    N N TP
Sbjct: 122 NSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTN-NSTP 180

Query: 156 SKLLKHSIYHRFF--ITLSSINLSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNL 213
            +LLK+SIYH FF     S+  LS Y +F+HP+V+L+ +DI+ GQ Y++ R++L+ FKNL
Sbjct: 181 YELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNL 240

Query: 214 NNTLENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFTP-H 272
           N T  NFP F+N ND+LP+F+LCYD N +EQ+E  Q+LTK LKKQLFVES+ + L+   +
Sbjct: 241 NTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQY 300

Query: 273 DNQKSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLV 332
           +      LH PI  SL E ++ +  P S  +   L+  IY+ +  ++ ++M+PFM RKL+
Sbjct: 301 EIDIKVDLHQPIMSSLEEMIYFLQTPFSAKLSISLINSIYNILDSLIYDLMLPFMKRKLL 360

Query: 333 FWDETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRK 392
           FW+ET+LQPR+S+F   KF ++F++  +N P   + N     +EG+  F  SS E L+RK
Sbjct: 361 FWEETILQPRRSLFHGAKFLKKFMTKNNNGP---QENILTKDSEGNEYFAFSSTELLMRK 417

Query: 393 LADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEV 452
           LADWS M+SDFK AYS Y+ L++D +++P+YLA CLE+   SLLMGAQ+I+T K IK ++
Sbjct: 418 LADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDI 477

Query: 453 DPLMTRAIEQYKK------QDEKHSLRV-----------IHCIXXXXXXXXXXXXXXXXX 495
           +PL+ RA++ Y+       QD  + +               C+                 
Sbjct: 478 NPLIERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTST 537

Query: 496 PLAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRV----NDHFLPKPDEENKADE 551
           P A+ YL  I     LGP + + I ER++  Y++ ID R+    ND             +
Sbjct: 538 PYAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINDTATTTTTVTTTTAD 597

Query: 552 SEAAENSKKGENGLEVDDMHEWRN--ENKLIQN-NLRSEGLTRFRKYSLYQLVAAKKWVE 608
              A  S      ++      W +  E+KL    N+ S+G TR RK + ++L+AAKKW E
Sbjct: 598 KVVATPSTDKPKTIQ------WESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAE 651

Query: 609 LHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRL 642
             +  Q  WC+      Y+   L KR D +  +L
Sbjct: 652 QKQWRQVAWCLKDMESIYDATDLGKRDDLIVAKL 685

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score =  454 bits (1169), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 258/679 (37%), Positives = 386/679 (56%), Gaps = 79/679 (11%)

Query: 5   FSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSISM 64
           FSYE YMNL+ + ++    +P EI+K++I N ++P I V S    D H+++ Y +DS+ M
Sbjct: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSLYM 62

Query: 65  LFRYFGDYIQDRDQ----------------------IPSTTDLKDPGSVSSG-RHRSDSL 101
           L R+FG  + DRDQ                      IP   +L+ P     G R RS+SL
Sbjct: 63  LLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSNSL 122

Query: 102 FQRQA--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKL 158
           FQR +  S+ +RFTR L DLI   D+ D +     ++ FL  YL+ L     +   P  L
Sbjct: 123 FQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLK-LVAANTDEMVPHNL 181

Query: 159 LKHSIYHRFF-ITLSSIN-LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNT 216
           LK SIYH FF + +SS N LS Y +F+HP+++L+ LDI+ G+ YE+AR++L++FKNLN+ 
Sbjct: 182 LKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHN 241

Query: 217 LENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFTP---HD 273
            ENFP F+N N++LPVF+LCY+++S+E++E  QAL K LKKQLFVES+ ++L+     +D
Sbjct: 242 TENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDSFIYD 301

Query: 274 NQKSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVF 333
                 LH P+  SL E +F +  PT   +   L+  IYD + ++V ++MIPFM RK+ F
Sbjct: 302 ENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVSF 361

Query: 334 WDETVLQPRKSIFQSNKFFRRFISPKSNHPI--AHKVNDPQDPAEGDIMFPASSPEFLLR 391
           W+ET+LQPRKS+F   KFF++F+   + +P+   H+ N     ++G+  F +SS EFL+R
Sbjct: 362 WEETILQPRKSLFNGAKFFKKFM---NKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMR 418

Query: 392 KLADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTE 451
           KLADWS MLSDFK AYS Y+ L  D +++P+YLA C+E+  +SLLMGAQ+I+T K IK +
Sbjct: 419 KLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKND 478

Query: 452 VDPLMTRAIEQYK--------KQDEKHSLRV--------IHCIXXXXXXXXXXXXXXXXX 495
           ++PL+ RA+  Y+        K  E +SL V          C+                 
Sbjct: 479 INPLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTST 538

Query: 496 PLAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAA 555
           P A+ YL  I     LGP + +++ ER++  Y + +D R+                    
Sbjct: 539 PYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRI-------------------- 578

Query: 556 ENSKKGENGLEVDDMHEWRNENK-----LIQNNLRSEGLTRFRKYSLYQLVAAKKWVELH 610
              + G    +  D  + R E+K         ++ SEGLTR RK + ++L+AAKKW E  
Sbjct: 579 -KHRVGAMKKDAKDTEDLRGEHKYSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQK 637

Query: 611 KRNQAKWCIYHAAPAYEKL 629
           +  Q  WC+      Y ++
Sbjct: 638 QWRQVSWCLKDIESTYSEI 656

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  452 bits (1163), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 269/704 (38%), Positives = 392/704 (55%), Gaps = 83/704 (11%)

Query: 3   LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62
           ++ SYE YMNL+ + +H    +P +I+++++ N +SP I V S  ELD H++D Y++DS+
Sbjct: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 63  SMLFRYFGDYIQDRDQI------------------PSTTD----------LKDPGSVSSG 94
            M  R+FGD + DRDQ                   PS  D          LK P + S  
Sbjct: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPSTSSDT 120

Query: 95  --------------RHRSDSLFQRQA--SECVRFTRSLEDLI-SIDSEDHILQSTDIDSF 137
                         R RS+SLFQR    S+ VRFTR ++DLI S DS D +     ++ F
Sbjct: 121 KNTTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180

Query: 138 LSQYLQNLEPIMNENGTPSKLLKHSIYHRFF-ITLSSIN-LSRYHSFHHPVVALLPLDIT 195
           L   L+ +E   ++N TP +LLK S+YH+FF + +SS   LS Y +F+HPVV+L+ +DI+
Sbjct: 181 LENTLRLVEEYTDDN-TPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDIS 239

Query: 196 KGQGYENAREILIHFKNLNNTLENFPEFININDILPVFVLCYDENSREQWESVQALTKSL 255
            GQGYE AR++LI FKNLN+T+ENFP F++  DILPVF+LCY++ S ++  + Q L   L
Sbjct: 240 AGQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQL 299

Query: 256 KKQLFVESVSISLFT-PHDNQKSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDT 314
           KKQLFVES+ + L+   + +     LH PI  SL E ++ +  PT   +P +L+   Y+ 
Sbjct: 300 KKQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNI 359

Query: 315 ISFIVEEMMIPFMHRKLVFWDETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDP 374
           +  +V+++M+PFM RK+ FW+ET+LQPRKS+F    FF++ +S  SN    H+       
Sbjct: 360 LEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKD 419

Query: 375 AEGDIMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTIS 434
             G+  F ASS EFL+RKLADWS MLSDFK AYS Y+ L  D E++P+YLA C E+  +S
Sbjct: 420 KNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVS 479

Query: 435 LLMGAQNIITAKTIKTEVDPLMTRAIEQYKK--QDEKHSLRVIH---------CIXXXXX 483
           +LMGAQNI+T K IK ++DPL+ RA+E Y+    DE  +   ++         C+     
Sbjct: 480 VLMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEELYVPVRSYETRCMFLASE 539

Query: 484 XXXXXXXXXXXXPLAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKP 543
                       P A+N L  I     LGP + ++I ER++  Y   ID R+        
Sbjct: 540 LFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIR------- 592

Query: 544 DEENKADESEAAENSKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAA 603
                     +A+ +K   + L  D   E  NE       + + GLTR RK + ++L+AA
Sbjct: 593 -------HKTSAQGAKAMTDELAPD---EESNE------EIVTRGLTRKRKAAFFRLIAA 636

Query: 604 KKWVELHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRLSMELS 647
            KWVE  +  QA WC+     AY  L    R D +  RL  +++
Sbjct: 637 NKWVEQKQWKQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMN 680

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  448 bits (1153), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 259/690 (37%), Positives = 392/690 (56%), Gaps = 65/690 (9%)

Query: 5   FSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSISM 64
           FSYE YMNL+ + ++    +P EI+K+++ N ++P I V S    D H+++ YN+DS+ M
Sbjct: 3   FSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSLYM 62

Query: 65  LFRYFGDYIQDRDQ----------------------IPSTTDLKDPGSVSSG-RHRSDSL 101
           L R+FG  + DRDQ                      +    +L  P ++  G R RS+SL
Sbjct: 63  LLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSNSL 122

Query: 102 FQRQA--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKL 158
           FQR +  S+ +RFTR L DLI   D+ D +     ++ +L  YL+ +    NE   P  L
Sbjct: 123 FQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETA-PHDL 181

Query: 159 LKHSIYHRFF-ITLSSIN-LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNT 216
           LK SIYH FF + +SS N LS Y +F+HP+++L+ LDI+ G+ YE+AR++L++FKNLN+ 
Sbjct: 182 LKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHN 241

Query: 217 LENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFTPH---D 273
            ENFP F+N N++LPVF++CY++ S+E++E  QAL K LKKQLFVES+ + L+      D
Sbjct: 242 TENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKESFIDD 301

Query: 274 NQKSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVF 333
              S  LH P+  SL E +F +  PT   +   L+  IYD + ++V ++MIPFM RK+ F
Sbjct: 302 ENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVSF 361

Query: 334 WDETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKL 393
           W+ET+LQPRKS+F   KFF++F++ K+    +H+ N      +G+  F +SS EFL+RKL
Sbjct: 362 WEETILQPRKSLFNGAKFFKKFMN-KNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420

Query: 394 ADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVD 453
           ADWS MLSDFK AYS Y+ L  D +++P+YLA C+E+  +SLLMGAQ+I+T K IK +++
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480

Query: 454 PLMTRAIEQYKK--QDEKHSLRVI--------------HCIXXXXXXXXXXXXXXXXXPL 497
           PL+ RA+  Y+K  Q ++H  + +               C+                 P 
Sbjct: 481 PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY 540

Query: 498 AVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAEN 557
           A+ YL  I     LGP + ++I ER++  Y + +D R+                    + 
Sbjct: 541 AIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRV-------------GVMKK 587

Query: 558 SKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKW 617
           S K    L   D H     +  I+ ++ SEGLTR RK + ++L+AAKKW E     Q  W
Sbjct: 588 SFKETEDLRNGDEHY---TDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSW 644

Query: 618 CIYHAAPAYEKLSLSKRPDGLFHRLSMELS 647
           C+      Y ++      D +  +L  +L+
Sbjct: 645 CLKDIESTYSEIKFLHCNDSILSKLKSQLN 674

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score =  444 bits (1142), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 257/660 (38%), Positives = 386/660 (58%), Gaps = 64/660 (9%)

Query: 5   FSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSISM 64
           FSYE YMNL+ + +H    +P EI+K+++ N ++P I V S    D H+++ Y++DS+ M
Sbjct: 3   FSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSLYM 62

Query: 65  LFRYFGDYIQDRDQ----------------IPSTT---DLKDPGSVSSG-RHRSDSLFQR 104
           L R+FG  + DRDQ                I S++   +L  P ++  G R RS+SLFQR
Sbjct: 63  LLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLFQR 122

Query: 105 QA--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKH 161
            +  S+ VRFTR L DLI   D+ D +     ++ FL  YL+ +    +E   P  LLK 
Sbjct: 123 DSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEK-VPHDLLKK 181

Query: 162 SIYHRFF-ITLSSIN-LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLEN 219
           SIYH FF + +SS N LS Y +F+HP+++L+ LDI+ G+ YE+AR++L++FKNLN+  E+
Sbjct: 182 SIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNHNTES 241

Query: 220 FPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISL----FTPHDNQ 275
           FP F+N N++LPVF+LCY++ S+E++E  QAL K LKKQLFVES+ + L    F   +N 
Sbjct: 242 FPIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDSFVDVENS 301

Query: 276 KSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWD 335
            +  LH P+  SL E +F +  PT   +   L+  IYD + ++V ++MIPFM RK+ FW+
Sbjct: 302 -NIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKISFWE 360

Query: 336 ETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLAD 395
           ET+LQPRKS+F   KFF++F++ K+     H+ N      +G+  F +SS EFL+RKLAD
Sbjct: 361 ETILQPRKSLFNGAKFFKKFMN-KAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLAD 419

Query: 396 WSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPL 455
           WS MLSDFK AYS Y+ L  D +++P+YLA C+E+  +SLLMGAQ+I+T K IK +++PL
Sbjct: 420 WSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPL 479

Query: 456 MTRAIEQY--------KKQDEKHSLRVI--------HCIXXXXXXXXXXXXXXXXXPLAV 499
           + RA+  Y        +   E  S  V+         C+                 P A+
Sbjct: 480 IERALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPYAI 539

Query: 500 NYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAENSK 559
            YL  I     LGP + +++ ER++  Y + +D RV         +       ++ +N++
Sbjct: 540 QYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRV---------KHKVGGMKKSVKNTE 590

Query: 560 KGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKWCI 619
              N  E D  H         + ++ SEGLTR RK + ++L+AAKKW E  +  Q  WC+
Sbjct: 591 DLRNDDEYDTDH-------FTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCL 643

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  439 bits (1130), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 257/678 (37%), Positives = 386/678 (56%), Gaps = 54/678 (7%)

Query: 3   LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62
           + FSYE YMNL+ + E     IP EI+++++ + ++P I V S  ELD H++D Y+IDS+
Sbjct: 2   INFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSL 61

Query: 63  SMLFRYFGDYIQDRDQI-------PSTTDLKDPGSVSSGRHRSDSLFQRQA--SECVRFT 113
            ML R+FG  + DRDQ        P ++        +  R RS+SLFQR +  S+ +RFT
Sbjct: 62  YMLLRFFGGCVSDRDQASESKANAPHSSSSLTTTKTTRARSRSNSLFQRDSTQSQYIRFT 121

Query: 114 RSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKHSIYHRFF--IT 170
           R L DL+   D  D +     ++S+L QYL+ +E     + T  +LLK S+YH FF    
Sbjct: 122 RPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKF-TFDSTSHQLLKKSLYHNFFSLAI 180

Query: 171 LSSINLSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLENFPEFININDIL 230
            S+  LS + SF+HP+++L+ LDIT  Q YE+A+ +LI FKNL+NT++ FP +IN  D+L
Sbjct: 181 SSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTIDKFPIYINTYDML 240

Query: 231 PVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLF-TPHDNQKSTTLHSPITVSLH 289
           PVF+LCY+ +S E+ +  + L+  +KKQLFVES+S+ L+   +  +    LH P+  SL 
Sbjct: 241 PVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSYQTEPFIKLHQPVMSSLD 300

Query: 290 EQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWDETVLQPRKSIFQSN 349
           E ++ +       +P  L    YD +  +V  ++IPFM RK+ FW+ETVLQP+KSIF  +
Sbjct: 301 EMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFWEETVLQPKKSIFHGS 360

Query: 350 KFFRRFIS--PKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLADWSFMLSDFKKAY 407
           KF ++ +S    S+H   + +    D   G+  F +SSPE LLRKLADWS MLSDFK  Y
Sbjct: 361 KFLKKLMSRASTSSHQQQNILTKDHD---GNEYFASSSPELLLRKLADWSIMLSDFKTGY 417

Query: 408 SIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPLMTRAIEQYKK-- 465
           + Y++L+ D E +P+YLA CLE++ +SLLMGAQNI+T K +K ++ PL+ RA++ Y    
Sbjct: 418 ATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPLIDRALDAYDACA 477

Query: 466 ------------QDEKHSLRVI-----HCIXXXXXXXXXXXXXXXXXPLAVNYLTYIQKS 508
                        +E  SL  +      C+                 P A+NYL  I + 
Sbjct: 478 ANTHLSNKKIGPTNESTSLEPVLSYETRCLILSSELFLSLSDTWTSTPYAINYLESILEE 537

Query: 509 HLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADE-SEAAENSKKGENGLEV 567
             LGP + ++I ER++     C DLRV+     K ++  K D   E A+N  +  N    
Sbjct: 538 SRLGPCSRIMIWERLS----DCYDLRVDPRIKSKVEQVQKQDNLEEPADNEHRILNS--- 590

Query: 568 DDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKWCIYHAAPAYE 627
                   ++ L  +N+ S+GLTR RK + ++L+AAK W E  +  Q KWC+ +    Y 
Sbjct: 591 --------QDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYS 642

Query: 628 KLSLSKRPDGLFHRLSME 645
           ++ L  R D +  RL  E
Sbjct: 643 RVGLVNRDDLILTRLREE 660

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  438 bits (1127), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 252/681 (37%), Positives = 379/681 (55%), Gaps = 66/681 (9%)

Query: 5   FSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSISM 64
           FSYE YMNL+ + ++    +P EI+K+++ N ++P I V S    D H+++ Y +DS+ M
Sbjct: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSLYM 62

Query: 65  LFRYFGDYIQDRDQ----------------------IPSTTDLKDPGSVSSG-RHRSDSL 101
           L R+FG  + DRDQ                         + +L+ P     G R RS+SL
Sbjct: 63  LLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSNSL 122

Query: 102 FQRQA--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKL 158
           FQR +  S+ +RFTR L+DLI   D+ D +     ++ FL  YL+ +    +E   P  L
Sbjct: 123 FQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDE-MVPHDL 181

Query: 159 LKHSIYHRFF-ITLSSIN-LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNT 216
           LK SIYH FF + +SS N LS Y +F+HP+++L+ LDI+ G+ YE+AR++L++FKNLN+ 
Sbjct: 182 LKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHN 241

Query: 217 LENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFTP---HD 273
            ENFP F+N N++LPVF+LCY++ S+E++E  QAL K LKKQLFVESV +SL+       
Sbjct: 242 TENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDSFIEA 301

Query: 274 NQKSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVF 333
           N  +  LH P+  SL E +F +  PT  ++   L+  IYD + ++V ++MIPFM RK+ F
Sbjct: 302 NNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVSF 361

Query: 334 WDETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKL 393
           W+ET+LQPRKS+F   KFF++F++   ++   H  N      +G+  F +SS EFL+RKL
Sbjct: 362 WEETILQPRKSLFNGAKFFKKFMNKNPSNG-NHHHNSLTSDNQGNEYFASSSSEFLMRKL 420

Query: 394 ADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVD 453
           ADWS MLSDFK AYS Y+ L  D +++P+YLA C+E+  +SLLMGAQ I+T K IK +++
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480

Query: 454 PLMTRAIEQYKKQDEKHSLRV----------------IHCIXXXXXXXXXXXXXXXXXPL 497
           PL+ +A+  Y+   +    +                   C+                 P 
Sbjct: 481 PLIEKALATYENCSKIQRSKSEKSSSSNTVEPVRSYETRCMILASELFLSLSDKWTSTPY 540

Query: 498 AVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAEN 557
           A+ YL  I     LGP   ++I ER++  Y + +D R+                      
Sbjct: 541 AIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHR----------------VGA 584

Query: 558 SKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKW 617
            KKG    E     +  + +    +++ SEGLTR RK + ++L+AA+KW E  +  Q  W
Sbjct: 585 MKKGIRDTEDLRGGDGNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSW 644

Query: 618 CIYHAAPAYEKLSLSKRPDGL 638
           C+      Y  +      DGL
Sbjct: 645 CLKDIESIYSDIKF-LNGDGL 664

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  424 bits (1091), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 254/684 (37%), Positives = 386/684 (56%), Gaps = 63/684 (9%)

Query: 5   FSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSISM 64
           FSYE YMNLI + +  +  +P +I+K+V+ N ++P I V S + LD H+++ Y IDS+ M
Sbjct: 3   FSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSLYM 62

Query: 65  LFRYFGDYIQDRDQ---IPSTTD--------LKDPGSVSSG---------RHRSDSLFQR 104
           L R+FG  + DRDQ   +   TD        +++    ++G         R  S+SL+QR
Sbjct: 63  LLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLYQR 122

Query: 105 QA--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKLLKH 161
            A  S+ VRFT+ L DLI+  D+ D +     ++ +L +YL  ++   + +  P  LLK 
Sbjct: 123 DATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPH-IPHHLLKT 181

Query: 162 SIYHRFF-ITLSSIN-LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNTLEN 219
           SIYH FF + +SS + LS +  F+HP+V+LL +DIT+ + YE A E L  FK++NN + +
Sbjct: 182 SIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNNNIPS 241

Query: 220 FPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLF-TPHDNQKST 278
           FP FIN NDILPVF+LCY++++  ++E  Q L   LKKQLFVES+ + L+ T   +    
Sbjct: 242 FPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTDNLVV 301

Query: 279 TLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVFWDETV 338
           +LH P+  S+ E +F + +P    +P +L+  IYD I  IV ++M PFM RK+ FW+ET+
Sbjct: 302 SLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEETI 361

Query: 339 LQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLADWSF 398
           L PRKS+F   KFF++F++ KS   ++   N       G     ++SPEFL+RKLADWS 
Sbjct: 362 LTPRKSLFHGAKFFKKFMN-KSTQALSQP-NSLLKENHGSNYLSSTSPEFLMRKLADWSM 419

Query: 399 MLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPLMTR 458
           M+SDFK AY+ Y+ L +DFE  P+YLA C E+  +SLLMGAQNI+TAK +K E++P + R
Sbjct: 420 MVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIER 479

Query: 459 AIEQY----------KKQDEKHSLRV------IHCIXXXXXXXXXXXXXXXXXPLAVNYL 502
           A+  Y          +K  +   L          C+                 P A+ YL
Sbjct: 480 ALGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAIAYL 539

Query: 503 TYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAENSKKGE 562
             I     LGP + ++I ER++  Y + ID R+          +++    E  +  KK E
Sbjct: 540 ETILNECKLGPLSEIMIWERLSDCYGMRIDPRI----------KHRIGNLELLQ--KKEE 587

Query: 563 NGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKWCIYHA 622
           N      M + +N +     ++ S+GLTR RK +L++L+AA+KW E  +  +  WC+   
Sbjct: 588 N------MDDPKNADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDL 641

Query: 623 APAYEKLSLSKRPDGLFHRLSMEL 646
              Y  L    + + L+ RL  EL
Sbjct: 642 ESTYSDLKCFNKENLLYTRLRNEL 665

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  409 bits (1052), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 246/685 (35%), Positives = 365/685 (53%), Gaps = 83/685 (12%)

Query: 3   LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62
           + FSYE YMNL+ + E  S  +P +I+++++ + ++P I V S+L LD+H+ + Y + S 
Sbjct: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 63  SMLFRYFGDYIQDRDQIPSTTDLKDPGSVSSGRHRSDSLFQRQA--SECVRFTRSLEDLI 120
            +LFR FG  I DRDQ+     L D  +    R RS+SLFQR A  S+ +RF + L DL+
Sbjct: 61  YLLFRLFGGCISDRDQLMEHYTLDDSSTGGRTRKRSNSLFQRDATQSQFIRFAQPLPDLL 120

Query: 121 SIDSEDHILQSTD-IDSFLSQYLQNLE---------------------PIMNENGTPSKL 158
              +E   L   D ++ +L+ YL  ++                     P       P KL
Sbjct: 121 RSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLPHKL 180

Query: 159 LKHSIYHRFFITL--SSINLSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNT 216
           L++++YH FF     S+  +S + +F+ PV+ L+ +D+++GQ YE  R+++  FKNLN  
Sbjct: 181 LRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLNKF 240

Query: 217 LENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFTPHDNQK 276
           LE+FP FIN+NDILP+ VLCYD     Q  + + L + +KK LFV+S+ ++L+       
Sbjct: 241 LEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDEDPESP 300

Query: 277 STTLHSPITVSLHEQVFNMSHPTSIN-------------IPSRLLTHIYDTISFIVEEMM 323
              LH PI  SL E V   S  +S               +P  ++TH+Y  +  +V+EM+
Sbjct: 301 LVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPLNIITHMYQALDVLVDEML 360

Query: 324 IPFMHRKLVFWDETVLQPRKSIFQ-SNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFP 382
           IPFMHRK  +W+E +LQPRKSIF  SN FF++FI          K    +DP++    FP
Sbjct: 361 IPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIG---------KTTTQRDPSDTQ-FFP 410

Query: 383 ASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNI 442
           ASS E LLRKLADWS MLSDFK AY  YD L+ D ++ P YLA CLE+  +SLL+GAQNI
Sbjct: 411 ASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQNI 470

Query: 443 ITAKTIKTEVDPLMTRAIEQYKKQDEKHSLRVIHCIXXXXXXXXXXXXXXXXXPLAVNYL 502
           +T K IKTE+ PL+ RA+  Y++Q    S     C+                 P A+ YL
Sbjct: 471 VTVKMIKTEITPLIERAVATYRQQ--GRSSYETRCMILSAELFLALRDTWTSTPYAIRYL 528

Query: 503 -TYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAENSKKG 561
            T ++    LG  + V+I ER++  Y+   D RV                S  + N+  G
Sbjct: 529 ETILRDCPQLGACSQVMIWERLSDCYQSRTDPRV---------------ASALSTNTSPG 573

Query: 562 ENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKWCIYH 621
                          +    N + ++G TR RK + ++L+AAKKW E  +  Q +WC++ 
Sbjct: 574 ---------------SAQPGNEILAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHD 618

Query: 622 AAPAYEKLSLSKRPDGLFHRLSMEL 646
               Y   +L  +   L  RL+ E+
Sbjct: 619 IKDIYTASALYDKKGLLIDRLNTEV 643

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  353 bits (905), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 212/583 (36%), Positives = 320/583 (54%), Gaps = 43/583 (7%)

Query: 85  LKDPGSVSSGRHRSDSLFQRQA--SECVRFTRSLEDLI-SIDSEDHILQSTDIDSFLSQY 141
           L      +  R RS+SLFQR +  S+ +RFTR +EDL+ S  + D +     ++ FL   
Sbjct: 148 LPKSSQTTRNRSRSNSLFQRDSTQSQFIRFTRPIEDLLYSGGTGDMLFDYHTLEIFLGSC 207

Query: 142 LQNLEPIMNENGTPSKLLKHSIYHRFFIT-LSSIN-LSRYHSFHHPVVALLPLDITKGQG 199
           L+ +E    ++    K L+ S+YHRFF + +SS N LS Y SF+HP+V+L+ +DITKGQ 
Sbjct: 208 LKMVEKYTTDD-IDHKTLQKSLYHRFFSSAISSTNCLSPYESFNHPIVSLIAIDITKGQN 266

Query: 200 YENAREILIHFKNLNNTLENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQL 259
           YE AR++LI FKN N T+ NFP F++ NDILPVFVLCY+ +S E+ E    L+K +KKQL
Sbjct: 267 YELARDLLIAFKNQNTTINNFPIFMSTNDILPVFVLCYNGSSAEESEKSTELSKKIKKQL 326

Query: 260 FVESVSISLFTP-HDNQKSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFI 318
           F E + + L+   + +  +  LH P   SL E ++      +  +P  L+  IYD +  +
Sbjct: 327 FAECIRMPLWDKRYSDDITVKLHQPAMSSLDEMLYVFQTSKTDKLPLTLINLIYDQLEIL 386

Query: 319 VEEMMIPFMHRKLVFWDETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGD 378
             ++MIPFM RK+ FW+ET+LQP+KS+FQ  K FR+F+  + +     + N P    +G+
Sbjct: 387 TNDLMIPFMQRKITFWEETILQPKKSLFQGTKLFRKFMG-RPSMTNGRQENIPIKDNQGN 445

Query: 379 IMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMG 438
             F ++S  FLLRKLADWS M+SDFK AY+ ++ L +D E YP+YLA CLE+  + +LMG
Sbjct: 446 EYFASTSNVFLLRKLADWSMMISDFKTAYTTFESLLEDIEMYPKYLASCLEWCAVCILMG 505

Query: 439 AQNIITAKTIKTEVDPLMTRAIEQY-------------KKQDEKHSLRV--IHCIXXXXX 483
           AQNI+T K IK +V+PL+ R+++ Y             ++  +   +R     C+     
Sbjct: 506 AQNIVTTKMIKNDVNPLIERSLDVYGNCALLLNSIAESEESPDTEPVRSYETRCMLITSE 565

Query: 484 XXXXXXXXXXXXPLAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKP 543
                       P A++ L  I     LG  + ++I ER++  Y +  D RV  H L   
Sbjct: 566 LFLSLSDTWTSTPYALSNLETILSECKLGACSQIMIWERLSDCYNLRTDPRVK-HKLRSN 624

Query: 544 DEENKADESEAAENSKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAA 603
              +   E    E  K+  + + +                   +GLTR RK S ++L+AA
Sbjct: 625 ISTSSVSEVSEEEIKKQDVSSIVL-------------------KGLTRQRKASFFRLLAA 665

Query: 604 KKWVELHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRLSMEL 646
           KKW E H+  Q  WC+   +  Y+     KR   ++ +L   L
Sbjct: 666 KKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNL 708

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 50/76 (65%)

Query: 3  LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62
          + F+YE YMNLI + +     +P +ISK+++ N ++P I V + +ELD+H+ + Y IDS 
Sbjct: 1  MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60

Query: 63 SMLFRYFGDYIQDRDQ 78
            L RYFG  I DRDQ
Sbjct: 61 YTLLRYFGGCISDRDQ 76

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  346 bits (887), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 225/646 (34%), Positives = 342/646 (52%), Gaps = 108/646 (16%)

Query: 95  RHRSDSLFQRQA--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNE 151
           R RS+SLFQR +  S+ +RFT+ + DL++  D  D +     +++ L  YL+    I+  
Sbjct: 185 RKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLK----IIET 240

Query: 152 NGTPS---KLLKHSIYHRFF--ITLSSINLSRYHSFHHPVVALLPLDITKGQGYENAREI 206
           N TP      LK S+YHRFF     S+ NL  + SF HP+V+LL +D+T  Q Y+ A+E+
Sbjct: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300

Query: 207 LIHFKNLNNTLENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSI 266
           LI FKN+++   NFP ++NINDILPVF+LCYD +S EQ +  + ++  +KKQLF ES+ +
Sbjct: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360

Query: 267 SLFTP--HDNQKSTTLHSPITVSLHEQVFNM-------SHPTSINIPSRLLTHIYDTISF 317
            L+    ++N K   LH P+  S+ E ++ +       S  T   +P  L+ +IY+ I+ 
Sbjct: 361 PLWNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIAN 420

Query: 318 IVEEMMIPFMHRKLVFWDETVLQPRKSIFQSNKFFRRFIS-------------------- 357
           +   ++IPFM RK+ FWDET+LQPRKSIF+ NK F+ F++                    
Sbjct: 421 LSVNLIIPFMQRKIRFWDETILQPRKSIFR-NKLFKSFMNRNSNVSSSTGTSSSEISNSI 479

Query: 358 PKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKDF 417
            K +H +  K       + G   F A S EF LRKLADWS M+SDFK AY+ Y+ L++D 
Sbjct: 480 SKHHHSLLTK------DSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDL 533

Query: 418 ESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVDPLMTRAIEQYKKQ----------- 466
           E+  +Y+A CLE+  +S+LMGAQNI+TAK +K +VDPL+  A+E Y+K            
Sbjct: 534 ENTSKYMASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPS 593

Query: 467 -----------------------DEKHSLRV--IHCIXXXXXXXXXXXXXXXXXPLAVNY 501
                                  +  H++R   I C+                 P A+ Y
Sbjct: 594 NNINSLNSRSSISSATKAEVSLIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPYALRY 653

Query: 502 LTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKP-----DEENKADESEAAE 556
           L  I   + LGP +  I+ ER+++    C DLRV+     KP     ++  KA  SEA+ 
Sbjct: 654 LETILSDYKLGPCSQTILWERLSF----CYDLRVDPRIKRKPTITNINKGTKATGSEASH 709

Query: 557 NSKKGENGLEVDDMHEWR----NENKLIQN-----------NLRSEGLTRFRKYSLYQLV 601
           +S K  N    +D  + +     +N LI +           ++ S+G TR RK + ++L+
Sbjct: 710 SSIKEVNEKYRNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTRKRKAAFFKLI 769

Query: 602 AAKKWVELHKRNQAKWCIYHAAPAYEKLSLSKRPDGLFHRLSMELS 647
           AAKKW E  +  Q  WC+      Y+++  S R D +  +L  +L+
Sbjct: 770 AAKKWSEQKQWRQLDWCLKDIENVYKEVGFSDRKDLILIKLKDQLN 815

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 54/76 (71%)

Query: 3  LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62
          + FSYE YMNL+ + +  +  IP +I+K+++ N+++P I V +  ELD H++D YNIDS+
Sbjct: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60

Query: 63 SMLFRYFGDYIQDRDQ 78
           ML RYFG  I DRDQ
Sbjct: 61 YMLLRYFGGCISDRDQ 76

>SAKL0A10274g Chr1 (902542..903831) [1290 bp, 429 aa] {ON} similar
           to uniprot|P47124 Saccharomyces cerevisiae YJR075W HOC1
           Alpha-1 6-mannosyltransferase involved in cell wall
           mannan biosynthesis subunit of a Golgi-localized complex
           that also contains Anp1p Mnn9p Mnn11p and Mnn10p
           identified as a suppressor of a cell lysis sensitive
           pkc1- 371 allele
          Length = 429

 Score = 31.6 bits (70), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 18/79 (22%)

Query: 9   KYMNLIQYPEHW------SNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62
           KY+  +Q+ + W       +PI  EI  K+  NTL      +S+ EL  HL++  NI   
Sbjct: 279 KYLRRLQFGD-WIIQAKPGHPIIREIVAKITENTLK----RKSDGELRMHLRNDMNIMGW 333

Query: 63  S-------MLFRYFGDYIQ 74
           +       ++F YF DY+Q
Sbjct: 334 TGSGVWTDVIFTYFNDYVQ 352

>TBLA0B02730 Chr2 complement(628543..629310) [768 bp, 255 aa] {ON}
           Anc_8.797 YOR319W
          Length = 255

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 26/109 (23%), Positives = 47/109 (43%), Gaps = 16/109 (14%)

Query: 53  LKDMYNIDSISMLFRYFGDYIQDRDQIPSTTDLKDPGSVSSGRHRSDS-----------L 101
           L D  +++ + ++F  FG+ ++D + +P  ++ +  G     R  +DS           +
Sbjct: 149 LDDTVDLNQLKIIFNKFGELVKDPELVPLKSNAQMVGIYIYFRSYTDSDNAIKSLNKKFI 208

Query: 102 FQRQASECVRFTRSLEDLISIDSEDHILQSTDIDSFLSQYLQNLEPIMN 150
           F +Q      F  S+ D IS  S+       +ID  L     N+E I N
Sbjct: 209 FNKQIQLEYAFKNSVSDTISTASKKQTRYGDEIDRVL-----NVEAIKN 252

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,001,664
Number of extensions: 3359247
Number of successful extensions: 12706
Number of sequences better than 10.0: 48
Number of HSP's gapped: 12957
Number of HSP's successfully gapped: 55
Length of query: 647
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 531
Effective length of database: 40,180,143
Effective search space: 21335655933
Effective search space used: 21335655933
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)