Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F01683g1.318ON98985033e-67
KLTH0H10714g1.318ON106973445e-43
SAKL0D06952g1.318ON107983315e-41
Kwal_14.25861.318ON106903161e-38
Kpol_1035.251.318ON106983115e-38
AEL167C1.318ON101933091e-37
Ecym_62891.318ON103853012e-36
ZYRO0G20702g1.318ON140812877e-34
TDEL0D018701.318ON1001002821e-33
TPHA0O014701.318ON100802793e-33
NDAI0B047701.318ON1131002544e-29
YBR268W (MRPL37)1.318ON1051042456e-28
Suva_4.5291.318ON1051022457e-28
CAGL0I09372g1.318ON103852403e-27
KAFR0C042101.318ON1011012395e-27
Smik_2.4111.318ON1051042327e-26
Skud_2.4001.318ON1051022203e-24
NCAS0B074401.318ON110812204e-24
KNAG0C017701.318ON101832161e-23
TBLA0F013201.318ON111761971e-20
Skud_15.551na 1ON69459623.0
Suva_9.1537.233ON88375614.3
KAFR0A01750singletonON53930605.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F01683g
         (98 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON...   198   3e-67
KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {O...   137   5e-43
SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {O...   132   5e-41
Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON...   126   1e-38
Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON...   124   5e-38
AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON} Sy...   123   1e-37
Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to...   120   2e-36
ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa] ...   115   7e-34
TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.31...   113   1e-33
TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {O...   112   3e-33
NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {...   102   4e-29
YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}  MRPL37Mitoc...    99   6e-28
Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W (...    99   7e-28
CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar...    97   3e-27
KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.31...    97   5e-27
Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W (...    94   7e-26
Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W (...    89   3e-24
NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {...    89   4e-24
KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.31...    88   1e-23
TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON...    80   1e-20
Skud_15.551 Chr15 (1000691..1002775) [2085 bp, 694 aa] {ON} YOR3...    28   3.0  
Suva_9.153 Chr9 complement(253920..256571) [2652 bp, 883 aa] {ON...    28   4.3  
KAFR0A01750 Chr1 complement(360823..362442) [1620 bp, 539 aa] {O...    28   5.2  

>KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON}
          similar to uniprot|P36532 Saccharomyces cerevisiae
          YBR268W MRPL37 Mitochondrial ribosomal protein of the
          large subunit
          Length = 98

 Score =  198 bits (503), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 98/98 (100%), Positives = 98/98 (100%)

Query: 1  MLRVTRVLFNQVKSEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVL 60
          MLRVTRVLFNQVKSEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVL
Sbjct: 1  MLRVTRVLFNQVKSEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVL 60

Query: 61 DANVQAEKLAADPIKLRKKQLRIANRANIKQNNFLAKI 98
          DANVQAEKLAADPIKLRKKQLRIANRANIKQNNFLAKI
Sbjct: 61 DANVQAEKLAADPIKLRKKQLRIANRANIKQNNFLAKI 98

>KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 106

 Score =  137 bits (344), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 68/97 (70%), Positives = 76/97 (78%), Gaps = 4/97 (4%)

Query: 2   LRVTRVLFNQVKSEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLD 61
           L V+R  F   K+  SG    +VSSCPAGTPLNLQIKKSGKEPVALED EYPEWLWTVLD
Sbjct: 14  LSVSRATFQGQKASPSG----VVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVLD 69

Query: 62  ANVQAEKLAADPIKLRKKQLRIANRANIKQNNFLAKI 98
           +  Q +KL  DP+KLRKKQLR ANR  IKQNNFL++I
Sbjct: 70  SRAQLKKLQEDPLKLRKKQLRSANRNKIKQNNFLSEI 106

>SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 107

 Score =  132 bits (331), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 71/98 (72%), Gaps = 2/98 (2%)

Query: 1   MLRVTRVLFNQVKSEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVL 60
            L  TR+   Q    A+   +K+ SSCPAGTPLNLQIKKSGKE VALED EYPEWLWTVL
Sbjct: 12  FLSTTRITLQQ--QAATATVSKVKSSCPAGTPLNLQIKKSGKETVALEDHEYPEWLWTVL 69

Query: 61  DANVQAEKLAADPIKLRKKQLRIANRANIKQNNFLAKI 98
           D   Q+ KLA DP KL+KKQLR  NR  IKQNNFL KI
Sbjct: 70  DEKAQSAKLAQDPAKLKKKQLRKMNREKIKQNNFLTKI 107

>Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON}
           YBR268W (MRPL37) - Probable mitochondrial protein L37
           [contig 224] FULL
          Length = 106

 Score =  126 bits (316), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 61/90 (67%), Positives = 69/90 (76%)

Query: 9   FNQVKSEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQAEK 68
           F+ +     G  + I SSC AGTPLNLQIKKSGKEPVALED EYPEWLW+VLD   Q +K
Sbjct: 17  FSALLQSQKGSVSGIKSSCIAGTPLNLQIKKSGKEPVALEDHEYPEWLWSVLDDKAQLKK 76

Query: 69  LAADPIKLRKKQLRIANRANIKQNNFLAKI 98
           L  DP+KLRKKQLR ANR  IKQNNFL++I
Sbjct: 77  LQEDPLKLRKKQLRSANRQKIKQNNFLSEI 106

>Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON}
           complement(60631..60951) [321 nt, 107 aa]
          Length = 106

 Score =  124 bits (311), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 76/98 (77%), Gaps = 1/98 (1%)

Query: 1   MLRVTRVLFNQVKSEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVL 60
           +L  +R+L+ +   + SGQ+ KI SSCPAG+ L L IKK+GK+PVALED+EYP WLWTVL
Sbjct: 10  LLSSSRLLWQET-VKTSGQSLKIQSSCPAGSVLTLNIKKAGKDPVALEDAEYPTWLWTVL 68

Query: 61  DANVQAEKLAADPIKLRKKQLRIANRANIKQNNFLAKI 98
           D   QAE L+ DP+ LRKK+LR ANR NIKQNNFL +I
Sbjct: 69  DKEAQAEALSKDPLALRKKKLRQANRKNIKQNNFLKQI 106

>AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR268W
           (MRPL37)
          Length = 101

 Score =  123 bits (309), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 63/93 (67%), Positives = 68/93 (73%)

Query: 6   RVLFNQVKSEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQ 65
           R LF+        QA K VSSCPAGTPLNL IKK GKEP+ALEDS+YPEWLW VLD   Q
Sbjct: 9   RRLFSVSCRVYDQQAQKAVSSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVLDPEAQ 68

Query: 66  AEKLAADPIKLRKKQLRIANRANIKQNNFLAKI 98
           A KLA DPIK RKK LR  NR +IKQ NFLAK+
Sbjct: 69  AAKLAEDPIKARKKALRRMNREHIKQQNFLAKM 101

>Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii AEL167C
          Length = 103

 Score =  120 bits (301), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 66/85 (77%), Gaps = 1/85 (1%)

Query: 14  SEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQAEKLAADP 73
           +E  G  A I+SSCPAGTPLNLQIKK+GKEPVAL +SEYPEWLW VLD  V+A KL  DP
Sbjct: 20  AEQKGSKA-IISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLDPQVEAAKLNEDP 78

Query: 74  IKLRKKQLRIANRANIKQNNFLAKI 98
              RKKQLR  NR  IKQNNFL++I
Sbjct: 79  FAARKKQLRKMNREKIKQNNFLSRI 103

>ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa]
           {ON} similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 140

 Score =  115 bits (287), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 64/81 (79%), Gaps = 2/81 (2%)

Query: 18  GQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQAEKLAADPIKLR 77
           GQA K  SSCPAGT +N+  KKSGK+PVALED+EYP+WLW VLD   Q +KL ADP+KLR
Sbjct: 62  GQAVK--SSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWEVLDPEAQMKKLQADPMKLR 119

Query: 78  KKQLRIANRANIKQNNFLAKI 98
           KKQLR  NR  IKQNNFL +I
Sbjct: 120 KKQLRKDNREKIKQNNFLKQI 140

>TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.318
           YBR268W
          Length = 100

 Score =  113 bits (282), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 72/100 (72%), Gaps = 2/100 (2%)

Query: 1   MLR-VTRVLFNQVKSEASGQAAKIV-SSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWT 58
           M R V + LF+  +       + IV SSCPAGT L++ +KKSGK+PVALEDSEYP WLW 
Sbjct: 1   MFRFVPKRLFSNCRVFLQETPSTIVKSSCPAGTVLSVNVKKSGKDPVALEDSEYPAWLWE 60

Query: 59  VLDANVQAEKLAADPIKLRKKQLRIANRANIKQNNFLAKI 98
           VLD   +A KLA DP+KLRKKQ+R ANR  IKQNNFL ++
Sbjct: 61  VLDPEARARKLAEDPMKLRKKQIRKANRMQIKQNNFLQQL 100

>TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {ON}
           Anc_1.318 YBR268W
          Length = 100

 Score =  112 bits (279), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 63/80 (78%)

Query: 19  QAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQAEKLAADPIKLRK 78
           QA  + SSC AGTPL + + K+GK+P+ALEDSEYP WLWTVLD   QA +L  DP+KLR+
Sbjct: 21  QANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGAQAARLENDPLKLRR 80

Query: 79  KQLRIANRANIKQNNFLAKI 98
           K+LR  NRANIKQNNFL +I
Sbjct: 81  KELRRKNRANIKQNNFLKQI 100

>NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {ON}
           Anc_1.318 YBR268W
          Length = 113

 Score =  102 bits (254), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 71/100 (71%), Gaps = 8/100 (8%)

Query: 6   RVLFNQVKSEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLD---A 62
           +VL  +VK  AS  A++I SSC AGTPLNL IKK+GKEP+ALED EYPEWLWTVLD   A
Sbjct: 15  KVLNAEVKV-ASTIASEIKSSCLAGTPLNLNIKKTGKEPIALEDKEYPEWLWTVLDTKTA 73

Query: 63  NVQAEKLAADPIK----LRKKQLRIANRANIKQNNFLAKI 98
           N +A+      ++     RK+QLR+  R  IKQNNFL++I
Sbjct: 74  NGRAKSGKGTSVEESLLARKRQLRVETRKKIKQNNFLSQI 113

>YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}
           MRPL37Mitochondrial ribosomal protein of the large
           subunit
          Length = 105

 Score = 99.0 bits (245), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 70/104 (67%), Gaps = 14/104 (13%)

Query: 1   MLRVTRVLFNQ--VKSEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWT 58
           ++  +R+L+N+  VKS        +VSSCPAGT LNL I KSGK+ VALED EYP WLW+
Sbjct: 10  LISTSRILYNKPTVKS--------VVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWS 61

Query: 59  VLDANVQAEKLAADP----IKLRKKQLRIANRANIKQNNFLAKI 98
           VLD++   E  A DP    +  R+K +R ANR  IKQNNFL+++
Sbjct: 62  VLDSDHVVEHAAEDPEGQALLKRRKNIRKANRQRIKQNNFLSQL 105

>Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 99.0 bits (245), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 54/102 (52%), Positives = 66/102 (64%), Gaps = 12/102 (11%)

Query: 2   LRVTRVLFNQVKSEASGQAAKIV-SSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVL 60
           L  +RV +N+       QA K+V SSCPAGT LNL I KSGK+  ALED EYP WLW+VL
Sbjct: 11  LSTSRVFYNK-------QAVKVVASSCPAGTSLNLNIWKSGKDAQALEDREYPSWLWSVL 63

Query: 61  DANVQAEKLAADP----IKLRKKQLRIANRANIKQNNFLAKI 98
           DA    +  A DP    +  RKK +R ANR  IKQNNFL+++
Sbjct: 64  DAKQAVDHAAKDPEGEALSQRKKNIRKANRQQIKQNNFLSQL 105

>CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar to
           uniprot|P36532 Saccharomyces cerevisiae YBR268w MRPL37
          Length = 103

 Score = 97.1 bits (240), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 62/85 (72%), Gaps = 4/85 (4%)

Query: 18  GQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQAEK----LAADP 73
            +A +I SSC AGTPL+L +KK+GK+PVALEDSEYPEWLWTVLD    A      ++ + 
Sbjct: 19  NEAKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLWTVLDQTNTAAAAKAPVSEES 78

Query: 74  IKLRKKQLRIANRANIKQNNFLAKI 98
           +K RKKQ+R +NR  IKQ NFL ++
Sbjct: 79  LKARKKQIRQSNREKIKQRNFLNQL 103

>KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 96.7 bits (239), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 65/101 (64%), Gaps = 3/101 (2%)

Query: 1   MLRVTRVLFNQVKSEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVL 60
           MLR++R  F+  +S        +VSSCP GTPL L ++K  K P+AL+D EYP WLW+VL
Sbjct: 1   MLRLSRRFFSHSRSVLQSTKCLLVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVL 60

Query: 61  D---ANVQAEKLAADPIKLRKKQLRIANRANIKQNNFLAKI 98
           +   AN Q E      ++LR+KQLR  NR  IKQ NFL+++
Sbjct: 61  NEESANTQKELSPIQELELRRKQLRKLNRDKIKQKNFLSEL 101

>Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 94.0 bits (232), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 65/104 (62%), Gaps = 14/104 (13%)

Query: 1   MLRVTRVLFNQ--VKSEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWT 58
            +  +RVLFN+  VKS        +VSSCPAGT LNL I KSGK+ VALED EYP WLW 
Sbjct: 10  FISTSRVLFNKPAVKS--------VVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWG 61

Query: 59  VLDANVQAEKLAADP----IKLRKKQLRIANRANIKQNNFLAKI 98
           +L+     E    DP    +  R+K +R ANR  IKQNNFL+++
Sbjct: 62  ILNNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105

>Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score = 89.4 bits (220), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 65/102 (63%), Gaps = 12/102 (11%)

Query: 2   LRVTRVLFNQVKSEASGQAAK-IVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVL 60
           +  +RVL+N+       QA K +VSSCPAGT LNL I KSGK+ +ALE+ EYP WLW+VL
Sbjct: 11  ISTSRVLYNK-------QAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLWSVL 63

Query: 61  DANVQAEKLAAD----PIKLRKKQLRIANRANIKQNNFLAKI 98
           D     E    D     +  R+K +R ANR  IKQ+NFL+++
Sbjct: 64  DNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105

>NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {ON}
           Anc_1.318 YBR268W
          Length = 110

 Score = 89.4 bits (220), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 60/81 (74%), Gaps = 7/81 (8%)

Query: 23  IVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQAEKLAAD-----PIKLR 77
           I SSC AGT LNL IKK+GK+P+ALED+EYP WLW VL++  +A K A+D      + +R
Sbjct: 31  IKSSCLAGTSLNLNIKKNGKDPIALEDNEYPAWLWKVLES--KAPKEASDLSEQEVLAMR 88

Query: 78  KKQLRIANRANIKQNNFLAKI 98
           KKQLR  NR  IKQNNFL+++
Sbjct: 89  KKQLRKENRKKIKQNNFLSQL 109

>KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 87.8 bits (216), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 57/83 (68%), Gaps = 1/83 (1%)

Query: 17  SGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQAEKLA-ADPIK 75
           + Q   + SSC AGTPL L I+K G++PVA+ D EYPEWLW VL+     +  A ADP+ 
Sbjct: 19  TAQGPAVKSSCLAGTPLKLDIRKDGRDPVAMRDEEYPEWLWHVLEPATGGDASARADPLA 78

Query: 76  LRKKQLRIANRANIKQNNFLAKI 98
            R+K+LR  +R  IKQ+N+L+++
Sbjct: 79  ARRKELRRKHRNEIKQSNYLSQL 101

>TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON}
           Anc_1.318 YBR268W
          Length = 111

 Score = 80.5 bits (197), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 40/76 (52%), Positives = 49/76 (64%)

Query: 23  IVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQAEKLAADPIKLRKKQLR 82
           I SSCPAGT L L + K GK+PVALED +YP WLW++L  +        + I  RKK LR
Sbjct: 35  IKSSCPAGTELRLNVYKDGKDPVALEDEKYPPWLWSILTPSNNKNPSPMEAIAQRKKVLR 94

Query: 83  IANRANIKQNNFLAKI 98
             NR  IKQNNFL ++
Sbjct: 95  KNNRDRIKQNNFLKQL 110

>Skud_15.551 Chr15 (1000691..1002775) [2085 bp, 694 aa] {ON} YOR384W
           (REAL)
          Length = 694

 Score = 28.5 bits (62), Expect = 3.0,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 34/59 (57%), Gaps = 10/59 (16%)

Query: 32  PLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQAEKLAADPIKLRKKQLRIANRANIK 90
           PL++ IK +G+EP + ED +  +++W++ D  +         +++ KK++ +    N++
Sbjct: 546 PLSMAIK-AGREPKSGEDHQIMKFVWSIRDVEL---------LEVYKKEIMMLKELNVE 594

>Suva_9.153 Chr9 complement(253920..256571) [2652 bp, 883 aa] {ON}
           YIL047C (REAL)
          Length = 883

 Score = 28.1 bits (61), Expect = 4.3,   Method: Composition-based stats.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 2/75 (2%)

Query: 19  QAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWTVLDANVQAEKLAADPIKLRK 78
           Q  +I SS PA T   L   +  KEP+   +++  EW  T L    + +K     +K   
Sbjct: 307 QMQQITSSQPATTA-ELSSAQRDKEPITWLETQISEWYTTALTNTPKDKKHNTHKLKKLT 365

Query: 79  KQLRIANRANIKQNN 93
            Q  I+ +  + +NN
Sbjct: 366 IQYSISEQM-VHRNN 379

>KAFR0A01750 Chr1 complement(360823..362442) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score = 27.7 bits (60), Expect = 5.2,   Method: Composition-based stats.
 Identities = 10/30 (33%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 42  KEPVALEDSEYPEWLWTVLDANVQAEKLAA 71
           ++P    D+ +P+W+W  L+ +V+ E +AA
Sbjct: 508 RQPPGFIDTNHPDWVWR-LEGDVRVEAIAA 536

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.128    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,213,214
Number of extensions: 327941
Number of successful extensions: 915
Number of sequences better than 10.0: 28
Number of HSP's gapped: 905
Number of HSP's successfully gapped: 28
Length of query: 98
Length of database: 53,481,399
Length adjustment: 69
Effective length of query: 29
Effective length of database: 45,569,445
Effective search space: 1321513905
Effective search space used: 1321513905
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)