Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0F01661g1.319ON68768736390.0
Ecym_62901.319ON6717076352e-72
AEL168C1.319ON6736966282e-71
ZYRO0G20680g1.319ON6927165854e-65
Suva_6.1371.319ON7187365793e-64
Skud_10.1581.319ON7167225681e-62
SAKL0D06930g1.319ON6907145531e-60
Smik_10.1791.319ON7137415434e-59
YJL061W (NUP82)1.319ON7137295232e-56
Kwal_14.25801.319ON6876895054e-54
TDEL0D018801.319ON6917044951e-52
KNAG0C058401.319ON7477384732e-49
TBLA0F013101.319ON7427354642e-48
KAFR0A017201.319ON7167014599e-48
NCAS0A092101.319ON7106754591e-47
KLTH0H10692g1.319ON6916674511e-46
NDAI0G057501.319ON7346284511e-46
TPHA0O014601.319ON7217294351e-44
CAGL0J05214g1.319ON7166974262e-43
Kpol_1035.241.319ON7177114112e-41
YLL011W (SOF1)5.201ON489166940.011
KLTH0B03410g5.201ON47772920.019
Kwal_33.151365.201ON47363910.022
Suva_10.645.201ON49063900.031
Kpol_2002.995.201ON48786900.032
Skud_12.565.201ON48963890.043
NDAI0I021805.201ON47963880.062
TPHA0E030805.201ON48869870.065
KNAG0M017505.201ON48569870.081
SAKL0G12892g5.201ON47680860.10
NCAS0D027305.201ON47563850.11
KAFR0J009805.201ON48063850.12
Smik_12.525.201ON489166850.12
KLLA0F15598g5.201ON47863840.17
AAL157C5.201ON47963800.46
TBLA0H020005.201ON47380790.59
CAGL0D05588g5.201ON47769790.68
TDEL0E042805.201ON48163780.87
ZYRO0B10450g5.201ON48263761.4
Suva_13.418.821ON165182771.4
NCAS0A024504.238ON1928187762.1
Smik_12.605.215ON946117752.2
Kwal_33.14157na 1ON431121742.3
TDEL0B022605.696ON662126742.6
Kpol_483.204.259ON78390733.7
Kpol_361.38.817ON627140733.9
Suva_2.3038.316ON377105724.1
NDAI0D023005.126ON270163714.3
SAKL0G11902g5.235ON906170734.4
Kwal_56.238958.316ON367105715.2
Skud_13.388.821ON1653127725.3
KLTH0F11484g3.389ON324137715.3
NCAS0C026608.443ON943139716.7
KAFR0E040105.414ON905181717.0
TPHA0K006907.418ON2785153709.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0F01661g
         (687 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {...  1406   0.0  
Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar t...   249   2e-72
AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON} S...   246   2e-71
ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]...   229   4e-65
Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON...   227   3e-64
Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {...   223   1e-62
SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {...   217   1e-60
Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061...   213   4e-59
YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Link...   206   2e-56
Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {O...   199   4e-54
TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.3...   195   1e-52
KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON} Anc_1...   186   2e-49
TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {O...   183   2e-48
KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {O...   181   9e-48
NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa] ...   181   1e-47
KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {...   178   1e-46
NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON} Anc_1...   178   1e-46
TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {...   172   1e-44
CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa] ...   168   2e-43
Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {O...   162   2e-41
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    41   0.011
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    40   0.019
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    40   0.022
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    39   0.031
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    39   0.032
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    39   0.043
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    39   0.062
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    38   0.065
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    38   0.081
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    38   0.10 
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     37   0.11 
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    37   0.12 
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    37   0.12 
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    37   0.17 
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    35   0.46 
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    35   0.59 
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    35   0.68 
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    35   0.87 
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    34   1.4  
Suva_13.41 Chr13 complement(62311..64194,64223..67294) [4956 bp,...    34   1.4  
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    34   2.1  
Smik_12.60 Chr12 (130182..133022) [2841 bp, 946 aa] {ON} YLL003W...    33   2.2  
Kwal_33.14157 s33 (550912..552207) [1296 bp, 431 aa] {ON} [conti...    33   2.3  
TDEL0B02260 Chr2 (408913..410901) [1989 bp, 662 aa] {ON} Anc_5.6...    33   2.6  
Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}...    33   3.7  
Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON} co...    33   3.9  
Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON...    32   4.1  
NDAI0D02300 Chr4 complement(535895..536707) [813 bp, 270 aa] {ON...    32   4.3  
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    33   4.4  
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    32   5.2  
Skud_13.38 Chr13 complement(62064..67025) [4962 bp, 1653 aa] {ON...    32   5.3  
KLTH0F11484g Chr6 (973231..974205) [975 bp, 324 aa] {ON} weakly ...    32   5.3  
NCAS0C02660 Chr3 complement(495031..497862) [2832 bp, 943 aa] {O...    32   6.7  
KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {O...    32   7.0  
TPHA0K00690 Chr11 complement(135928..144285) [8358 bp, 2785 aa] ...    32   9.0  

>KLLA0F01661g Chr6 complement(156609..158672) [2064 bp, 687 aa] {ON}
           weakly similar to uniprot|P40368 Saccharomyces
           cerevisiae YJL061W NUP82 Subunit of the nuclear pore
           complex (NPC) forms a subcomplex with Nup159p and Nsp1p
           interacts with Nup116p and is required for proper
           localization of Nup116p in the NPC
          Length = 687

 Score = 1406 bits (3639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 687/687 (100%), Positives = 687/687 (100%)

Query: 1   MLLFNTEDLKAIFQEVSLNPSDRLVCNNSNTIYLWQDNILRVQSDHETQYRSYNVELPFV 60
           MLLFNTEDLKAIFQEVSLNPSDRLVCNNSNTIYLWQDNILRVQSDHETQYRSYNVELPFV
Sbjct: 1   MLLFNTEDLKAIFQEVSLNPSDRLVCNNSNTIYLWQDNILRVQSDHETQYRSYNVELPFV 60

Query: 61  PEQMVISPSGGLVAFHANSELYVMEVNEQSRLRKHFNTSLGIKKLLWHPLATYGLSFVIL 120
           PEQMVISPSGGLVAFHANSELYVMEVNEQSRLRKHFNTSLGIKKLLWHPLATYGLSFVIL
Sbjct: 61  PEQMVISPSGGLVAFHANSELYVMEVNEQSRLRKHFNTSLGIKKLLWHPLATYGLSFVIL 120

Query: 121 HDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFNYCD 180
           HDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFNYCD
Sbjct: 121 HDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFNYCD 180

Query: 181 IYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDPDV 240
           IYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDPDV
Sbjct: 181 IYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDPDV 240

Query: 241 ESDYLTLKHDLLKQIQFFDNYKKNDGIDTFTSKAIRNSVPQGPFIIKKFPTALNAKEVTG 300
           ESDYLTLKHDLLKQIQFFDNYKKNDGIDTFTSKAIRNSVPQGPFIIKKFPTALNAKEVTG
Sbjct: 241 ESDYLTLKHDLLKQIQFFDNYKKNDGIDTFTSKAIRNSVPQGPFIIKKFPTALNAKEVTG 300

Query: 301 LTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFNNLSVITMFNAKGQCQL 360
           LTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFNNLSVITMFNAKGQCQL
Sbjct: 301 LTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFNNLSVITMFNAKGQCQL 360

Query: 361 LNSSEPKLVFTGDSSTTIMEMPWLEPLAQCIRLHDFSIIDDVKFENKIRTVSGTFLGVLS 420
           LNSSEPKLVFTGDSSTTIMEMPWLEPLAQCIRLHDFSIIDDVKFENKIRTVSGTFLGVLS
Sbjct: 361 LNSSEPKLVFTGDSSTTIMEMPWLEPLAQCIRLHDFSIIDDVKFENKIRTVSGTFLGVLS 420

Query: 421 TLSGDILYNGNSFKVIESNDKSTTQKPINRTDEVKYTYKPSLPTSGKELDMLLTKYKTEA 480
           TLSGDILYNGNSFKVIESNDKSTTQKPINRTDEVKYTYKPSLPTSGKELDMLLTKYKTEA
Sbjct: 421 TLSGDILYNGNSFKVIESNDKSTTQKPINRTDEVKYTYKPSLPTSGKELDMLLTKYKTEA 480

Query: 481 NGFISGIPDSLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAEL 540
           NGFISGIPDSLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAEL
Sbjct: 481 NGFISGIPDSLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAEL 540

Query: 541 HRQLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRT 600
           HRQLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRT
Sbjct: 541 HRQLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRT 600

Query: 601 SSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDTQLRSTTKGDDFFSELEFSSL 660
           SSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDTQLRSTTKGDDFFSELEFSSL
Sbjct: 601 SSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDTQLRSTTKGDDFFSELEFSSL 660

Query: 661 QQMLLNDKKVINSCMNELSASIEDLAV 687
           QQMLLNDKKVINSCMNELSASIEDLAV
Sbjct: 661 QQMLLNDKKVINSCMNELSASIEDLAV 687

>Ecym_6290 Chr6 (543547..545562) [2016 bp, 671 aa] {ON} similar to
           Ashbya gossypii AEL168C
          Length = 671

 Score =  249 bits (635), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 216/707 (30%), Positives = 341/707 (48%), Gaps = 70/707 (9%)

Query: 6   TEDLKAIFQEVSLNPSDRL---VCNNSNTIYLWQDNILRVQSDHETQYRSYNVELPFVPE 62
           T D   IFQ        +L   VC N+  I    D  LR     E  ++S ++++    E
Sbjct: 2   TGDPHPIFQVPPFRTLSKLHVHVCKNATQIVTCFDKNLRYARVTEHTFKSKHLDIKH-SE 60

Query: 63  QMVISPSGGLVAFHANSELYVMEVN-EQSRLRKHFNTSLGIKKLLWHPLATYGLSFVILH 121
             +++ SG L+AF+ ++++ + +++ ++S LR      LGIK++LWHPLA      V+L 
Sbjct: 61  HSILNNSGTLIAFYGSNDVELFDMDGKKSCLR----VELGIKQVLWHPLAYLDSCLVVLT 116

Query: 122 DDSTIRIYDLED---LEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFNY 178
            ++TI +Y+L     + P    V N K    G+S HV  +C +AF P GLTLYLLS    
Sbjct: 117 KENTIELYELAKANFMYP--TVVLNEKLPQLGISSHVSEICSMAFSPDGLTLYLLSLEEG 174

Query: 179 CDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDP 238
            D+YA+HP LP    ++              S  +   +K+ +LY S+DK        D 
Sbjct: 175 GDVYALHPLLPSRLRIKR-------------SFWESQWYKATALYESIDK--------DT 213

Query: 239 DVESDYLTLKH-DLLKQI-QFFDNYKKNDGIDTFTSKAIRNSVPQGPFIIKKFPTALNAK 296
             E     ++H D + +I +  D  K ++  D    +  R   P+GPF I  FP  L   
Sbjct: 214 PNEKKIAMIEHFDFVSKIYKMID--KDSEFFDVNIPEHKRMVTPRGPFSIYGFPEELYNT 271

Query: 297 EVTGLTIIPVG-ERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFNNLSVITMFNAK 355
             T L  +PV  E   +L L F DGT + LF D E++MSWS RS     +  +I  F A 
Sbjct: 272 TATKLITLPVNDEGAYVLILSFDDGTILSLFPDIELLMSWS-RSLNNACSFVLIEKFRAG 330

Query: 356 GQCQLLNSSEPKLVFTGDSSTTIMEMPWLEPLAQCIRLHDFSIIDDVKFENKIRTVSGTF 415
           G+   + + E  +     ++  I+  P+L+ L +CI+  D + + DVK  + I  ++G++
Sbjct: 331 GE---IFAIESGVAILEKNNAHIVRFPYLKALGECIKEGDIAPMVDVKLTSDITPLAGSY 387

Query: 416 LGVLS---TLSGDILYNGNS-FKVIESNDKSTTQKPINRTDEV-----KYTYKPSLPTSG 466
             V++     +  IL+ GNS  + I  +   ++ KP  R D       KYT     P++ 
Sbjct: 388 HTVVTWNEPSTKGILFIGNSVIRSIPDDVGLSSFKP--RVDPAISQNGKYTV--CFPSTM 443

Query: 467 KELDMLLTKYKTEANGFISGIPDSLAPL-----PLKNNSNERQLEVVSELYKETMKRVKL 521
           +EL   L   K   +     +P  L PL     PL +  NE QL  ++++  E M R+ L
Sbjct: 444 EEL---LKTNKALQHTLRQPLP--LVPLEQKNVPLNSEFNEHQLATLTKISTEVMDRIIL 498

Query: 522 GQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKR 581
            Q + + M+N++  +  EL RQL   +++      L  N   L  R     +K   L  R
Sbjct: 499 AQSLGYLMYNRAATQQFELCRQLETVSKLNDRSVTLKQNTKSLTCRLDSVSKKDIALRSR 558

Query: 582 LDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDTQ 641
           L+KL+++   +  + K     +S  E  WF+ +KN VL FN YV   +KL EEL FL  +
Sbjct: 559 LEKLQQSLDKVNESPKFNELPLSMKERAWFRELKNDVLAFNEYVLQNSKLCEELNFLKKE 618

Query: 642 LR--STTKGDDFFSEL-EFSSLQQMLLNDKKVINSCMNELSASIEDL 685
           L    +  G+    EL  F  LQ +L  D K+I  C ++L A+ +DL
Sbjct: 619 LELIESNHGNIPNEELFNFEKLQDLLTLDSKMIGDCNDQLLAAAKDL 665

>AEL168C Chr5 complement(320121..322142) [2022 bp, 673 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL061W
           (NUP82)
          Length = 673

 Score =  246 bits (628), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 197/696 (28%), Positives = 336/696 (48%), Gaps = 46/696 (6%)

Query: 6   TEDLKAIFQEVSLNPSDRLVCN---NSNTIYLWQDNILRVQSDHETQYRSYNVELPFVPE 62
           T +L  IF   +L  S RL  +   +   I  + +  LR+    E  Y+S++ E+     
Sbjct: 2   TGELHPIFNADALGASHRLHAHTHGDGTKIVGYYNKHLRLGRFTEQTYKSWHAEVD-AKA 60

Query: 63  QMVISPSGGLVAFHANSELYVMEVNEQSRLRKHFNTSLGIKKLLWHPLATYGLSFVILHD 122
             +++ SG L+AF+ +   +++EV ++   +     + GIK++LWHPLA      V+L  
Sbjct: 61  SSILNGSGSLLAFYGD---HIIEVVDREGKKITLTVNGGIKQVLWHPLAYLDSCLVVLTG 117

Query: 123 DSTIRIYDLEDLEPESIT-VFNRKSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFNYCDI 181
             TI IY+L +   E  T V N  +   G+S  V  + +IAF P GL+LYL S+    D+
Sbjct: 118 QETIEIYELNEPRYEKPTLVLNEPTSQLGISSRVIDITNIAFAPDGLSLYLFSTSEGGDV 177

Query: 182 YAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDPDVE 241
           + I P LP               R K         +K+ +LY++L K     +  D  V 
Sbjct: 178 HVICPLLPSRIK---------ADRAKWAR----QWNKATALYSTLTKD----TPDDAKVA 220

Query: 242 S-DYLTLKHDLLKQIQFFDNYKKNDGIDTFTSKAIRNSVPQGPFIIKKFPTALNAKEVTG 300
           + +YL     LL+ I+     K     +    +  R ++ QGP+ I  FP  L +   T 
Sbjct: 221 TIEYLEFVTQLLQAIE-----KNGSDGELVIPEHRRRTISQGPYNIHGFPEKLYSAVGTK 275

Query: 301 LTIIPVGE-RLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFNNLSVITMFNAKGQCQ 359
           LT++P+GE    LL L F D TN++LF  +E++MSW+      +  L ++  F A G   
Sbjct: 276 LTVVPLGESEAHLLLLSFDDSTNILLFPSTEVLMSWTKDLKNAYT-LMLVEEFTATGTA- 333

Query: 360 LLNSSEPKLVFTGDSSTTIMEMPWLEPLAQCIRLHDFSIIDDVKFENKIRTVSGTFLGVL 419
              + +   V   DS+  + E+P+L+ L  CIR  + + + D+ F + I  + G F  V 
Sbjct: 334 -FATCDGVAVLGIDSAQRV-EIPYLQALEDCIRDCNLAALQDINFTSSICKIPGKFHSVA 391

Query: 420 STLS----GDILYNGNSFKVIESND--KSTTQKPINRTDEVKYTYKPSLPTSGKELDMLL 473
              +    G IL   +  K++ S +  KS T+  ++     + TY    P S +E+    
Sbjct: 392 RFNAPGNKGIILVGDHHAKIVPSTEAAKSDTETELDSQPGKEPTYTVCFPNSLEEILNTN 451

Query: 474 TKYKTEANGFISGIPDSLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKS 533
            + +   +  +  +P +L  +PL ++ NE+ L  ++ + KE M R+ L Q     M N+ 
Sbjct: 452 KELQRRKHQPLPLVPPALKNIPLNSDLNEQHLATLTNISKEVMDRIILSQSAGLLMHNRL 511

Query: 534 NEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIE 593
           + +  ELHRQ+    +I    + L  +   +  R +   ++ + L++RL  L+ T + I 
Sbjct: 512 SLQQYELHRQVETVADICSRHSVLRDSSEAMSSRLTSVLKRDRRLKQRLCMLQSTLNRIN 571

Query: 594 NNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDTQLRSTTKGDDFFS 653
           ++ K     +S+ E  WF+ +KNQ + FN+YV  + +LR+EL FL  +L S  +      
Sbjct: 572 SSHKFSDLPLSKKEADWFRELKNQAISFNDYVLQSAQLRDELAFLKNELESLPEHRQHDR 631

Query: 654 ELE----FSSLQQMLLNDKKVINSCMNELSASIEDL 685
           + E    F  LQ++L  D K+I  C + LSA+  +L
Sbjct: 632 QEEEPFDFRRLQELLKLDSKIITECTDNLSAAAREL 667

>ZYRO0G20680g Chr7 complement(1703031..1705109) [2079 bp, 692 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 692

 Score =  229 bits (585), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 198/716 (27%), Positives = 339/716 (47%), Gaps = 83/716 (11%)

Query: 11  AIFQEVSLNPSDRLVC--NNSNTIYLWQDNILRVQSDHETQYRSYNVELPFVP--EQMVI 66
           +IF+  S   S R +C   + + + ++QD+ +R  +  +++Y    +E P +   E +V+
Sbjct: 7   SIFKRAS-GSSKRFLCTSQDGSKVVIYQDSSIRWCNAFDSKYEFMLLE-PTIEDVEHVVL 64

Query: 67  SPSGGLVAFHANSELYVMEVN-----------EQSRLRKHFNTSLGIKKLLWHPLATYGL 115
           SP+G L+  + + E+ ++E+            ++ R          IKK+L+HPLA    
Sbjct: 65  SPTGTLLLLYNSREVRIVEIPWGYSQVSYEGFQKFRYSVDSRQDPLIKKVLFHPLAYREH 124

Query: 116 SFVILHDDSTIRIYDLE---DLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYL 172
             VIL  D+TI + D     D +P+ + V N+   +FG+   V  +  I F   GLTLY 
Sbjct: 125 CIVILKTDNTIHLLDRYYPYDKQPK-LLVLNQHDGAFGMEGLVTDIESITFSQDGLTLYA 183

Query: 173 LSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKL 232
           LS    CDIYA +PCLP +  + S+               D ++HKSL  Y +L      
Sbjct: 184 LSVAEGCDIYAFYPCLPCSIEIDSHKL-------------DLLMHKSLVQYENL------ 224

Query: 233 ISGSDPDVESDYLTLKHDLLKQIQFFDNYKKNDGIDTFTSKAIRNSVP--------QGPF 284
            S   PD        K + +KQ QF    ++  G++   +K     +P        QGPF
Sbjct: 225 -SVETPDA------TKRNTIKQFQFISKLRQ--GLENDQTKI---DIPMDWLRVRGQGPF 272

Query: 285 IIKKFPTALNAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFN 344
            I  FP     +    L I+P+G    LL + F DGT VVL+ D E+ M W  +  +  N
Sbjct: 273 TIAPFPDRYYDRTAVQLKILPIGANNDLLLMSFDDGTIVVLYQDLELTMCWDSKGYSYNN 332

Query: 345 NLSVITMFN-AKGQCQLLNSSEPKLVFTGDSSTTIM--EMPWLEPLAQCIRLHDFSIIDD 401
           +L ++      +G+  L   +  +    G +S   +    PW + L+ CI   D   I D
Sbjct: 333 SLVLVESIRLERGELVLKQGTLSQFFVLGGTSDIYLVDTSPWSKILSNCIDNSDLEPIAD 392

Query: 402 VKFENKIRTVSGT------FLGVLSTLSGDILYNGNSF--KVIESNDKSTTQKPINRTDE 453
           ++F+++I  + G        +    T   D+  + ++   K    ND+ +T K   + + 
Sbjct: 393 LQFKSEISKIEGVSQIDSYAMWKKDTEPKDVFVSKDTVFVKSTAVNDQPSTVKDEKKANV 452

Query: 454 VKYTYKPSLPTSGKELDMLLTKYKTEANGFISGIPD-SLAPLPLKNNSNERQLEVVSELY 512
               Y+ +L     E+  L   ++TEA   +S + + S     L N SNE QLE+++ + 
Sbjct: 453 DIPRYEVALNQPMSEILSLNASFQTEAKKPLSKLVEPSKRQTKLNNESNEEQLEILTTVS 512

Query: 513 KETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEI----EMLRNKLNGNLGDLQERY 568
           KE ++++   Q + F + N+  E+  EL RQL+ ++EI    + LR+K      + + + 
Sbjct: 513 KEFLQKIVKAQALGFNLHNRCLEQQYELTRQLQYSSEILSKQDKLRSKAQSQSSECESKI 572

Query: 569 SRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLT 628
            R ++    L +R + L E    I  + K R  +I++ E+ WFK I+NQVL FN YVH  
Sbjct: 573 QRQDK----LLQRFNSLSEKLGRINESPKFREMNITDKEMAWFKEIRNQVLVFNQYVHHQ 628

Query: 629 NKLREELEFLDTQLRSTTKGDDFFSEL---EFSSLQQMLLNDKKVINSCMNELSAS 681
              +++L +L  +L + +  D    E    E++ L  +L +D K+I  C N+L+ +
Sbjct: 629 KNQQDQLRYLQKELENISLEDKDVGEKSKSEWTELLSILESDTKIIKECNNQLAHA 684

>Suva_6.137 Chr6 complement(228953..231109) [2157 bp, 718 aa] {ON}
           YJL061W (REAL)
          Length = 718

 Score =  227 bits (579), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 214/736 (29%), Positives = 354/736 (48%), Gaps = 110/736 (14%)

Query: 12  IFQ-EVSLNPSDRLV--CNNSNTIYLWQDNILRVQSD-HETQYRSYNVELPFVPE---QM 64
           IFQ  +S N S R +   +N   + + QD+I+R  S   +  Y S N     V +     
Sbjct: 12  IFQASLSANQSPRYIFSSHNGTRLVVIQDDIIRWCSLLTDPSYHSLNFSRHLVLDDTFHA 71

Query: 65  VISPSGGLVAFHANSELYVME----------VNEQSRLRK-HFNT---SLG----IKKLL 106
           + S SG L+ F+++ E++VME          V+ Q   +  H++     LG    IKK+L
Sbjct: 72  ISSASGDLLCFYSDQEIFVMEIPWGYLNLGDVSIQDAFQVFHYSVDELELGSNSPIKKVL 131

Query: 107 WHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPT 166
           +HP +      V+L +D TI ++D+ + + E+  + N+++ SFGL   V  + D AF   
Sbjct: 132 FHPKSYNDSCIVVLKNDDTITMFDILN-QQEAPIILNKRNSSFGLDARVNDITDFAFSKD 190

Query: 167 GLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSL 226
           GLTLY L++    DI+A +P LP   SL   D               ++L+KSL +Y SL
Sbjct: 191 GLTLYCLNTTEGGDIFAFYPFLPSVLSLSEKDLG-------------WILNKSLVMYESL 237

Query: 227 DKQLKLISGSDPDVESDYLTLKHDLLKQIQFFDNYKKNDGIDTFTSKAIRNSVP------ 280
                       +  +DY  +K ++ KQ+QF     KN     + SK  +  +       
Sbjct: 238 ------------NATTDY-KVKRNITKQLQFVSKLHKN-----WDSKLAKVKIDDEYRLV 279

Query: 281 --QGPFIIKKFPTALNAKEVTGLTIIPV-GERLGLLNLQFIDGTNVVLFSDSEIVMSWSL 337
             QGPF I  FP  L     + +T IP+  ++  ++ + F DG+ ++LF D E+ MSW +
Sbjct: 280 KMQGPFTINPFPNELYDFTASKITTIPIDNQQNEIVCVSFDDGSLIILFQDLEMSMSWDV 339

Query: 338 RSNTTFNNLSVITMFNAKGQCQLLNSSEP------KLVFTGDSSTTIMEM-PWLEPLAQC 390
             N  +NN S+I +   K Q + + S         KL  T +SS   ++   W   L++C
Sbjct: 340 -DNYVYNN-SLILIERIKLQQKEMKSLTALPDQLGKLYVTLESSVHQLDCTSWTSVLSKC 397

Query: 391 IRLHDFSIIDDVKFENKIRTVSGTFLGVLSTLSGDILYNGNSFKVIESNDKSTTQKPINR 450
           I   D + + DVKF +K   ++   +  LS  +  I +N  S   + S +K T Q   N 
Sbjct: 398 IDESDLNALADVKFVSKFEDIAT--IHQLSNFAY-INWNDKSSLALISKEKLTIQNISNH 454

Query: 451 TDEVKYTYKPSLPT--------SGKE---------LDMLLTKYKTEANGFISG----IPD 489
             E        L T        +GK          ++ +L+  ++     +S     IP 
Sbjct: 455 KKEQSLNAPAELDTNVNSDKSDTGKRGYEISFTQPINEILSLNESFQKVCLSPCERIIPP 514

Query: 490 SLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNE 549
           +   LPLKN +NE QLE+ +++ KE ++++   Q +   ++N+ +E+  EL RQL+ T++
Sbjct: 515 ADRQLPLKNEANENQLEIFTDISKEFLRKIIKAQSLGVSIYNRIHEQQFELTRQLQSTSK 574

Query: 550 I----EMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISE 605
           I    E+L+ KL        E+++    +   L  R  KL E  S +  ++K +  +IS 
Sbjct: 575 IIAKDEILQKKLEAQ----TEKWNSQSSRQAELMTRFGKLTENLSKVAESDKFKEQNISH 630

Query: 606 AELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDTQL---RSTTKGDDFFSELEFSSLQQ 662
            E+ WFK I+NQ+L+FN +VH    ++++L +L  +L    S T   D  S+ E+  L++
Sbjct: 631 GEMEWFKEIRNQILQFNGFVHSQKSIQQDLSYLKRELIRIESETINADKKSQNEWDELRK 690

Query: 663 MLLNDKKVINSCMNEL 678
           ML  D K+I  C  EL
Sbjct: 691 MLEVDSKIIKECNEEL 706

>Skud_10.158 Chr10 complement(296754..298904) [2151 bp, 716 aa] {ON}
           YJL061W (REAL)
          Length = 716

 Score =  223 bits (568), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 210/722 (29%), Positives = 348/722 (48%), Gaps = 87/722 (12%)

Query: 12  IFQ---EVSLNPSDRLVCNNSNTIYLWQDNILR-VQSDHETQYRSYNVELPFVPE---QM 64
           IFQ     S +PS     +N   +   QDNI+R   S  E+ Y+S +     + +   ++
Sbjct: 12  IFQASLSASQSPSYIFSSHNGTRVVFIQDNIIRWCNSLTESSYQSLDFSRHLILDDTFRV 71

Query: 65  VISPSGGLVAFHANSELYVMEVN------EQSRLR---KHFNTSLG---------IKKLL 106
           + S SG L+ F    E++VMEV       E++ ++   + F+ S+G         IKK+L
Sbjct: 72  ISSASGDLLGFFNVQEIFVMEVPWGYNNIEEASVQDAFQLFHYSVGQVENGSRSLIKKVL 131

Query: 107 WHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPT 166
           +HP + +    V+L +D TI ++D+ + + + I V N++S SFGL   V  + D+AF   
Sbjct: 132 FHPKSYHDSCIVVLKEDDTITMFDILNQQHKPI-VLNKRSNSFGLDARVNDITDLAFSRD 190

Query: 167 GLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSL 226
           GLTLY L++    D++A +P LP    L   D               ++L+KSL +Y SL
Sbjct: 191 GLTLYCLNTTEGGDVFAFYPLLPPVLLLGEKDLG-------------WILNKSLVMYESL 237

Query: 227 DKQLKLISGSDPDVESDYLTLKHDLLKQIQFFDNYKKNDGIDTFTSKA-----IRNSVPQ 281
           D      S +D       +T+K +++KQ+Q      +N  +D+   K       R    Q
Sbjct: 238 D------STTD-------ITVKRNIIKQLQLVSKLHEN--LDSQLGKVEIDEEYRLVKMQ 282

Query: 282 GPFIIKKFPTALNAKEVTGLTIIPVGERLG-LLNLQFIDGTNVVLFSDSEIVMSWSLRSN 340
           GPF I  FP  L       +T IP+      ++ + F DG+  +LF D E+ MSW + + 
Sbjct: 283 GPFTINPFPDELYEYTAANITTIPIDNMQNEIVCVGFDDGSLNLLFQDLEMSMSWDVDNY 342

Query: 341 TTFNNLSVITMFNAK----GQCQLLNSSEPKL-VFTGDSSTTIMEMPWLEPLAQCIRLHD 395
              N+L +I     +       + L     KL VF+ +S   +    W   L++CI   D
Sbjct: 343 VHNNSLVLIERIKIQETDIKSLKTLPEELGKLYVFSENSVHQLDSTNWSAILSRCIEESD 402

Query: 396 FSIIDDVKFENKIRTVSGTFLGVLSTLSGDILYNGNSFKVIESNDKSTTQKPIN----RT 451
            + + DVKFE+K+  +    +   S L+  I +N  S  V+ +  K T Q   N    +T
Sbjct: 403 LNALGDVKFESKLENI--VTIEHPSNLAY-ISWNDTSNLVLTARGKLTFQNISNDKELQT 459

Query: 452 DEVKYTYKPSLPTSGKELDMLLTKYKTE--------ANGFISG----IPDSLAPLPLKNN 499
            +     K     +GK  +M  T+   E            IS     IP +   +PLKN 
Sbjct: 460 TKFDANNKSDRIDAGKHYEMSFTQPINEILSLNESFQKACISPCEKIIPPAYRQMPLKNE 519

Query: 500 SNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNG 559
           ++E QLE+ + + KE ++++   Q + F ++N+  E+  EL RQL+ T++I      L  
Sbjct: 520 ASENQLEIFTGISKEFLQKIIKAQSLGFSIYNRIQEQQFELTRQLQATSKIISKDADLQE 579

Query: 560 NLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVL 619
            LG   +++     +   L +R  KL E  S I  ++KLR  +I+  E+ WFK I+NQ+L
Sbjct: 580 KLGAQNKKWDAQVSRQVKLMERFKKLTENLSQIAESKKLREKNINRGEMKWFKEIRNQIL 639

Query: 620 KFNNYVHLTNKLREELEFLD---TQLRSTTKGDDFFSELEFSSLQQMLLNDKKVINSCMN 676
           +FNN+V     L+++L ++    T++ + T   D  ++ E+  L++ML  D K+I  C  
Sbjct: 640 QFNNFVRSQKSLQQDLSYMKKELTRIEAETIKTDEKTQNEWDELRKMLEEDSKIIKECNE 699

Query: 677 EL 678
           EL
Sbjct: 700 EL 701

>SAKL0D06930g Chr4 complement(573700..575772) [2073 bp, 690 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 690

 Score =  217 bits (553), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 186/714 (26%), Positives = 332/714 (46%), Gaps = 75/714 (10%)

Query: 12  IFQEVSLN----PSDRLVCNNSNTIYLWQDNILRVQSDHETQYRSYNVELPFVPEQMVIS 67
           IFQ +S+     P   L   +   + + Q + +R+ S   +QY+     +  V     ++
Sbjct: 8   IFQNISVGKESYPKKLLTTQDGCRVVVIQGDTIRLCSSGNSQYQIIECGINTVA-GAALN 66

Query: 68  PSGGLVAFHANSELYVMEV------NEQSRLRKH-FNTSLG--IKKLLWHPLATYGLSFV 118
            SG L+  +  +EL V+ +      +    L+ H +N ++   IK++ WHP        V
Sbjct: 67  NSGTLLCAYNETELQVIVLPSPFVSSHGGILKPHTYNITVKSPIKQVQWHPRGKLDSVPV 126

Query: 119 ILHDDSTIRIYDL--EDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYLLSSF 176
           +LH D TI +Y+L  ED + +   V N      G++ H+  +  + F   GL LYLL+S 
Sbjct: 127 VLHKDDTIAMYELYNEDFQ-QPTAVLNTMQNQLGVTSHITDIESMCFSKDGLALYLLNSS 185

Query: 177 NYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGS 236
              D+YA++P LP    +                      H  +  Y S      L S  
Sbjct: 186 EGGDVYALYPFLPSVLVIPEQ-------------------HLEMCFYKSCINYENLSSDD 226

Query: 237 DPDVESDYLTLKHDLLKQIQFFDNYKKNDGIDTF-----------TSKAIRNSVPQGPFI 285
            P       T+K +++KQ+QF     K    +T              ++ RN+  QGPF 
Sbjct: 227 SP-------TVKRNVIKQLQFVSRLHKQYKSETVDKARNGDLVFNIQESYRNAKIQGPFT 279

Query: 286 IKKFPTALNAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFNN 345
           I  F   L +   T +T +P+ E   L+ + F +GT +  F D ++ M W    +++ N+
Sbjct: 280 INPFAEKLYSATATQITTMPIDEFNELILVYFDNGTILQCFQDLDLSMCWEEIDSSSNNS 339

Query: 346 LSVITMFNAKGQCQLLNSSEPKLVFTGDSSTTIMEMPWLEPLAQCIRLHDFSIIDDVKFE 405
           L V+   +     Q++  +  K    G  S  +    W + L++CI   +  ++  +  +
Sbjct: 340 LVVLESLDILSG-QIICLTPHKFAVLGPKSFVVDSSEWTKALSECINFSNLEVLSQINIK 398

Query: 406 NKIRTVSGTFLGV-LSTLSGD---ILYNGNSFKVIESNDKSTTQKPINRT----DEVKYT 457
           + I  V+G F    L   +G+   I  +  S K I   + + T+  +++T     EVKY 
Sbjct: 399 STITPVNGAFTQAGLWESNGEKQLIFMSDKSVKSITLPEPNKTKDAVSKTVQPVTEVKY- 457

Query: 458 YKPSLPTSGKELDMLLTKYKTEAN-GFISGIPDSLAPLPLKNNSNERQLEVVSELYKETM 516
            +P       E+ +L  K+++E +    + IP  L  LPL+N+SNE QL +++++ KE  
Sbjct: 458 -EPVFSQPIGEILLLNKKFQSECSRATQTVIPPHLMDLPLQNDSNEDQLALLTDISKEVF 516

Query: 517 KRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSK 576
            ++  GQ +   + N+  E+  EL RQL +++EI      L     D   R+    +K +
Sbjct: 517 SKIIQGQTLGLLIHNRLFEQRYELTRQLERSSEILHKAKCLQERYPDQNSRWEHVSKKQE 576

Query: 577 TLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELE 636
            ++ R +KL+   + I ++ KL+  +IS+ E+ WFK IK+QV  FN +V     ++E+LE
Sbjct: 577 NIDSRFEKLQSRLNEISSSGKLKDLAISQREMEWFKEIKSQVSLFNKFVMQQQDVKEQLE 636

Query: 637 FLDTQL-----RSTTKGDDFFSELEFSSLQQMLLNDKKVINSCMNELSASIEDL 685
           F+ ++L     R  +K D F    +++ LQ++L  D ++I  C   L  + ++L
Sbjct: 637 FVQSELKTAGERRVSKEDVF----DWAELQELLSVDSEIIKECNEGLVEAAKEL 686

>Smik_10.179 Chr10 (311844..313985) [2142 bp, 713 aa] {ON} YJL061W
           (REAL)
          Length = 713

 Score =  213 bits (543), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 207/741 (27%), Positives = 349/741 (47%), Gaps = 109/741 (14%)

Query: 12  IFQ---EVSLNPSDRLVCNNSNTIYLWQDNILR---VQSDHETQYRSYNVELPFVPE--- 62
           IFQ     S +P       N   I   QDNI+R   V +D    Y S ++    V +   
Sbjct: 12  IFQASLSASQSPRYIFTSQNGTRIVFIQDNIIRWYNVLTD--PCYHSLSLSRHLVLDDTF 69

Query: 63  QMVISPSGGLVAFHANSELYVMEVN------EQSRLRKHFN--------TSLG----IKK 104
            ++ S SG L+ F  + E++VMEV       E   ++  F         T LG    IKK
Sbjct: 70  HVISSTSGDLLCFFNDQEIFVMEVPWGYSNVENISIQDAFQVFHYSVDETELGPKSLIKK 129

Query: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           +L+HP + +    V+L ++ TI ++D+ + + + I + N+ + SFGL   +  + D+ F 
Sbjct: 130 VLFHPKSYHDSCIVVLKENDTIIMFDILNQQEKPI-ILNKPNNSFGLDARLNDITDLVFS 188

Query: 165 PTGLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYN 224
             GLTLY L++    DI+A +P LP    L  ND S             ++L+KSL +Y 
Sbjct: 189 KDGLTLYCLNTTEGGDIFAFYPFLPSALLLNENDLS-------------WILNKSLVMYE 235

Query: 225 SLDKQLKLISGSDPDVESDYLTLKHDLLKQIQFFDNYKKN-----DGIDTFTSKAIRNSV 279
           SLD          P  +   +T+K +++KQ+QF     +N     + +D       R   
Sbjct: 236 SLD----------PTTD---VTVKRNIIKQLQFVSKLHENWDSKLNKVDI--DSEYRLVK 280

Query: 280 PQGPFIIKKFPTAL---NAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWS 336
            QGPF I  FP  L    AK +  ++I    ++  +  + F DG+ ++L  D E+ MSW 
Sbjct: 281 VQGPFTINPFPNELYDYTAKNIATISI--DNQQNEIFCISFDDGSLILLLKDLEMSMSWD 338

Query: 337 LRSNTTFNNLSVITMFNAKGQCQL-----LNSSEPKL-VFTGDSSTTIMEMPWLEPLAQC 390
           +  N  +N+ S++ +   K Q ++     L     KL VF+ +    +    W   +++C
Sbjct: 339 V-GNYVYND-SLVLIERVKMQKEIESLITLPEQMGKLYVFSKNFVYQVNSTSWTSTISKC 396

Query: 391 IRLHDFSIIDDVKFENKIRTVSGTFLGVLSTLSGDILYNGNSFKVIESNDKSTTQ----- 445
           I   D + + D+KFE+KI  +  T  G+ +     I +N  S   + SN + T Q     
Sbjct: 397 INESDLNPLGDLKFESKIENI-ATVEGMPNL--AHIYWNNTSNLALASNKELTFQTVSVD 453

Query: 446 KPINRTD-------------EVKYTYKPSLPTSGKELDMLLTKYKTEANGFISG----IP 488
           + +  T+             + +Y  + + P     L  +LT  +      IS     IP
Sbjct: 454 QKMQSTETETDIGTEESGLAKCRYELRFTQP-----LSEILTLNENFQRACISPCEQIIP 508

Query: 489 DSLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTN 548
            +   +PLKN ++E QLE+ +++ KE ++++   Q +   ++N+ +E+  EL RQL+ T 
Sbjct: 509 STDRQIPLKNEASENQLEIFTDVSKEFLQKIAKAQSLGVSIYNRIHEQQLELTRQLQSTC 568

Query: 549 EIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAEL 608
           +I      L        +++     +   L +R  KL E  S I  + K +  +IS AE+
Sbjct: 569 KIISKDVDLRKKFEAQNKKWDAQIIRQSKLMERFSKLTENLSEISKSNKFKEKNISNAEM 628

Query: 609 VWFKSIKNQVLKFNNYVHLTNKLREELEFLD---TQLRSTTKGDDFFSELEFSSLQQMLL 665
            WFK I+NQ+L+FN YVH    L+++L +L    T++ + T   D  S+ E++ L++ML 
Sbjct: 629 EWFKEIRNQILQFNCYVHSQKSLQQDLSYLKRELTRIETETIQVDKKSQSEWNELRKMLE 688

Query: 666 NDKKVINSCMNELSASIEDLA 686
            D K+I  C  EL  + + L 
Sbjct: 689 IDSKIIKECNEELQHASQQLT 709

>YJL061W Chr10 (320016..322157) [2142 bp, 713 aa] {ON}  NUP82Linker
           nucleoporin component of the nuclear pore complex (NPC);
           also part of the NPC cytoplasmic filaments; contributes
           to nucleocytoplasmic transport and NPC biogenesis; forms
           stable associations with three FG-nucleoporins (Nsp1p,
           Nup159p, and Nup116p)
          Length = 713

 Score =  206 bits (523), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 208/729 (28%), Positives = 339/729 (46%), Gaps = 101/729 (13%)

Query: 12  IFQ-EVSLNPSDRLV--CNNSNTIYLWQDNILR---VQSDHETQYRSYNVELPFVPE--- 62
           IFQ  +S + S R +    N   I   QDNI+R   V +D  + Y S N     V +   
Sbjct: 12  IFQASLSASQSPRYIFSSQNGTRIVFIQDNIIRWYNVLTD--SLYHSLNFSRHLVLDDTF 69

Query: 63  QMVISPSGGLVAFHANSELYVMEVN------EQSRLRKHFNT--------SLG----IKK 104
            ++ S SG L+    ++E++VMEV       E   ++  F           +G    IKK
Sbjct: 70  HVISSTSGDLLCLFNDNEIFVMEVPWGYSNVEDVSIQDAFQIFHYSIDEEEVGPKSSIKK 129

Query: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           +L+HP +      V+L +D TI ++D+ + + + I V N+ + SFGL   V  + D+ F 
Sbjct: 130 VLFHPKSYRDSCIVVLKEDDTITMFDILNSQEKPI-VLNKPNNSFGLDARVNDITDLEFS 188

Query: 165 PTGLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYN 224
             GLTLY L++    DI+A +P LP    L   D              + +L+KSL +Y 
Sbjct: 189 KDGLTLYCLNTTEGGDIFAFYPFLPSVLLLNEKD-------------LNLILNKSLVMYE 235

Query: 225 SLDKQLKLISGSDPDVESDYLTLKHDLLKQIQFFDNYKKN-----DGIDTFTSKAIRNSV 279
           SLD    +I             +K +++KQ+QF     +N       +D    K  R + 
Sbjct: 236 SLDSTTDVI-------------VKRNVIKQLQFVSKLHENWNSRFGKVDI--QKEYRLAK 280

Query: 280 PQGPFIIKKFPTALNAKEVTGL-TIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLR 338
            QGPF I  FP  L     T + TI+    +  ++ + F DG+ ++LF D E+ MSW + 
Sbjct: 281 VQGPFTINPFPGELYDYTATNIATILIDNGQNEIVCVSFDDGSLILLFKDLEMSMSWDVD 340

Query: 339 SNTTFNNLSVITMFNAKGQCQLLNSSEPKL----VFTGDSSTTIMEMPWLEPLAQCIRLH 394
           +    N+L +I     + + + L +   +L    V + +    +  M W   L++CI   
Sbjct: 341 NYVYNNSLVLIERVKLQREIKSLITLPEQLGKLYVISDNIIQQVNFMSWASTLSKCINES 400

Query: 395 DFSIIDDVKFENKIRTVSGTFLGVLSTLSGDILYNGNSFKVIESNDKSTTQ------KPI 448
           D + +  +KFE+K+  ++   +  +  L+  I +N  S   + SN   T Q      KP 
Sbjct: 401 DLNPLAGLKFESKLEDIAT--IERIPNLAY-INWNDQSNLALMSNKTLTFQNISSDMKPQ 457

Query: 449 NRTDEVKYTYKPSLPTSGKELDMLLTKYKTE--------ANGFISG----IPDSLAPLPL 496
           +   E   + + S  T G    M  T+   E            IS     IP +   +PL
Sbjct: 458 STAAETSISTEKS-DTVGDGFKMSFTQPINEILILNDNFQKACISPCERIIPSADRQIPL 516

Query: 497 KNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEI----EM 552
           KN ++E QLE+ +++ KE ++R+   Q +   + N+ +E+  EL RQL+ T +I    + 
Sbjct: 517 KNEASENQLEIFTDISKEFLQRIVKAQTLGVSIHNRIHEQQFELTRQLQSTCKIISKDDD 576

Query: 553 LRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFK 612
           LR K          + SR  E    L +R  KL +  S I  + K +   IS  E+ WFK
Sbjct: 577 LRRKFEAQNKKWDAQLSRQSE----LMERFSKLSKKLSQIAESNKFKEKKISHGEMKWFK 632

Query: 613 SIKNQVLKFNNYVHLTNKLREELEFLD---TQLRSTTKGDDFFSELEFSSLQQMLLNDKK 669
            I+NQ+L+FN++VH    L+++L +L    T++ + T   D  S+ E+  L++ML  D K
Sbjct: 633 EIRNQILQFNSFVHSQKSLQQDLSYLKSELTRIEAETIKVDKKSQNEWDELRKMLEIDSK 692

Query: 670 VINSCMNEL 678
           +I  C  EL
Sbjct: 693 IIKECNEEL 701

>Kwal_14.2580 s14 complement(821497..823560) [2064 bp, 687 aa] {ON}
           YJL061W (NUP82) - 82-kDa protein, with putative
           coiled-coil domain, has carboxy-terminal domain,
           containing heptad repeats, that binds Nsp1p; nucleoporin
           [contig 224] FULL
          Length = 687

 Score =  199 bits (505), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 187/689 (27%), Positives = 308/689 (44%), Gaps = 78/689 (11%)

Query: 36  QDNILRVQS--DHETQYRSYNVELPFVPEQMVISPSGGLVAFHANSELYVMEV--NEQSR 91
           Q N LR  S   HE QY  +   + +    +VI+ SG L+  + + ++ ++ V  +E   
Sbjct: 36  QGNTLRWCSAGGHEYQYLEFEPRIDYT--SVVINESGSLLCLYNSKQVQILAVSWDESKS 93

Query: 92  LRKHFNTSLGIKKLLWHPLATYGLSFVILHDDSTIRIYDL--EDLEPESITVFNRKSRSF 149
                +   GIK+ LWHP    G    +L     I +Y+L  ED   E  T+ N  ++  
Sbjct: 94  DTILISPPAGIKQALWHPRGRLGSCLAVLTTQDEICLYELLTEDY-TEPTTILNTCTKEL 152

Query: 150 GLSDHVESVCDIAFDPTGLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNG 209
           G+   V+ +  ++F   GLTLYLLS+    DIY+I+PCLP    +             +G
Sbjct: 153 GMGSVVKDITSMSFSSDGLTLYLLSTSEGADIYSIYPCLPSEMEI-------------SG 199

Query: 210 SLADYMLHKSLSLYNSLDKQLKLISGSDPDVESDYLTLKHDLLKQIQFFDNY-KKNDGID 268
           +L   + +K+L  Y  L+             ++D   L+  + KQ+QF     KKND  D
Sbjct: 200 ALLKSVFNKALLQYQDLN-------------DNDSPDLRRKVTKQLQFVSKLQKKNDYKD 246

Query: 269 TFT-----SKAIRNSVPQGPFIIKKFPTALNAKEVTGLTIIPV-GERLGLLNLQFIDGTN 322
           T +     SKA R+   QGPF I  FP  L       + +I + G    LL + F DGT 
Sbjct: 247 TESHVVTISKAHRSPRAQGPFTINPFPDNLYLATGRQVEVIKLQGCAAELLLISFDDGTI 306

Query: 323 VVLFSDSEIVMSWSLRSNTTFNNLSVITMFNAKGQCQLLNSSEPKLVFTGDSSTTIMEMP 382
           +  F D E VMSW        N+L V+   N  G+  L+N      V    +  T +   
Sbjct: 307 LECFPDREPVMSWEDEGFCENNSLIVLGSVNIGGEIALVNGY--TFVVLSSAKVTFVS-- 362

Query: 383 WLEPLAQCIRLH----DFSIIDDVKFENKIRTVSGTFLGVLSTLSGD----ILYNGNSFK 434
            L  LAQ I       D S  D+     ++   +G F   +   S +     L +  +  
Sbjct: 363 -LRKLAQVIESSLNDCDISYFDEADLSEEVVEKNGRFCSAIICASSEKSCVALLSETTTS 421

Query: 435 VIE---SNDKSTTQKPINRTDEVKYTYKPSLPTSGKELDMLLT-KYKTEA---NGFISGI 487
            I+   S D    +  +         Y+P     G+ L+ +L    K +A       +G+
Sbjct: 422 HIDIPFSLDAPKMRTALGTAKTDVEQYRP----YGQPLNEVLALNEKVQALLKKPLQTGV 477

Query: 488 PDSLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKT 547
             SL    L N SNE QL +++ + KE M R+   Q +   ++ + + +  EL + L   
Sbjct: 478 SPSLRQAKLNNESNEDQLSLLTSISKEVMTRIASAQTLALSLYLRLSCQQGELTQHLETV 537

Query: 548 NEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAE 607
           +++E L++K+   L D   R+   + K+K++  RL+++      + ++ K ++  IS  E
Sbjct: 538 SKVEELQSKVLRRLKDQSSRWEAAQAKNKSISSRLEQISSKLKQVSSSGKFQSQPISNHE 597

Query: 608 LVWFKSIKNQVLKFNNYVH--------LTNKLREELEFLDTQLRSTTKGD---DFFSELE 656
           L WFK I++QV++FN  VH        L+N L+ ELE++  + +    G    D   E+ 
Sbjct: 598 LEWFKEIRDQVIRFNRLVHEQQSLGNTLSN-LKCELEYVHVESKEGKSGSSSADNKDEVP 656

Query: 657 FSSLQQMLLNDKKVINSCMNELSASIEDL 685
           +  L+ +L  D ++I  C + L    + L
Sbjct: 657 WDELRALLAKDLRIIGECQDSLQGVAKQL 685

>TDEL0D01880 Chr4 (366715..368790) [2076 bp, 691 aa] {ON} Anc_1.319
           YJL061W
          Length = 691

 Score =  195 bits (495), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 181/704 (25%), Positives = 320/704 (45%), Gaps = 82/704 (11%)

Query: 21  SDR--LVCNNSNTIYLWQDNILRVQSDHETQYRSYNVELPFVP-EQMVISPSGGLVAFHA 77
           SDR  L  ++     + QD+ +R  +  E  Y S  +E  F   + +V+S SG  +  + 
Sbjct: 19  SDRFFLTTSDGGRAVVVQDSCIRWCNVSEPGYHSMTLERAFKDVKHVVMSNSGEFLCLYN 78

Query: 78  NSELYVMEV----NEQSRLRKHF------NTSLGIKKLLWHPLATYGLSFVILHDDSTIR 127
           + EL ++EV     E S +   F      +    IK++L+HPLA    + VIL DD +I 
Sbjct: 79  DDELRIIEVPWAYTEVSSMANAFQLFRFVSDEARIKQVLFHPLAYQQETVVILKDDDSIT 138

Query: 128 IYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFNYCDIYAIHPC 187
           I + +D       V N  + ++ L   +  V  I F   GLTLY+LS     DIYA +PC
Sbjct: 139 IMNWQDFGDSKPDVLNLSNGTYSLDSSITDVECITFSQDGLTLYVLSVSEGADIYAFYPC 198

Query: 188 LPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDPDVESDYLTL 247
           L                  K G   D +++KSL  Y+ L+       G+D +V       
Sbjct: 199 LAPRMQF-----------DKQG--LDRLMYKSLIQYDVLN------VGTDSEV------- 232

Query: 248 KHDLLKQIQFFDNYKKNDGIDTF--TSKAIRNSVPQGPFIIKKFPTALNAKEVTGLTIIP 305
           K + +KQ++F     K           +A R    QGPF I  FP  + +   TG+  +P
Sbjct: 233 KRNTIKQLKFVSGLHKQQNSQRILEIPEAQRQVRGQGPFTIAPFPKQIYSSTGTGIASLP 292

Query: 306 VGERLGLLNLQFIDGTNVVLFSDSEIVMSW-SLRSN--TTFNNLSVITMFNAKGQCQLLN 362
           + ++  LL +   DG   +L  D ++ M+W S R N   +F  + +IT+ + + Q  ++ 
Sbjct: 293 INDQNELLIMSLDDGNIAILLQDLDVTMNWDSARYNYNNSFALVELITLGSQEIQQIVVG 352

Query: 363 SSE--------PKLVFTGDSSTTIMEMPWLEPLAQCIRLHDFSIIDDVKFENKIRTVSGT 414
             +        P+ VF+ D+S       W   +A C+   D   + + K E+++     T
Sbjct: 353 DHKYGQFSVMTPEGVFSIDTSK------WSGVMASCLTESDLRPLAETKLESEV-----T 401

Query: 415 FLGVLSTLSGDILYNGNSFKVIESNDKSTTQKPIN-------------RTDEVKYTYKPS 461
           F  +  +      +N     V++ +++    K ++             R +  KY    S
Sbjct: 402 FTELKDSPKSVAWWNTTPQSVVKVSNREVKSKQVSEGVSKQDDDITGSRQEPEKYNAHYS 461

Query: 462 LPTSGKELDMLLTKYKTEANGFISG-IPDSLAPLPLKNNSNERQLEVVSELYKETMKRVK 520
            P +  E+  L  K++ E++   S  IP      PLKN ++E QL++++E  K+ + ++ 
Sbjct: 462 QPIA--EIMQLNQKFQLESSKAPSKVIPPRERQKPLKNEASEIQLDLLTEASKDFVSKIA 519

Query: 521 LGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEK 580
           +GQ +   + N+  E+  +L  QL+ + E+   +  +  +      R      +  TL  
Sbjct: 520 VGQTLGVTLHNRIYEQQLDLTHQLKASGELMEKQQTILTHFHSQSSRSDAVHARHSTLMS 579

Query: 581 RLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDT 640
           R +K K+    I+N+++ +   IS+ E+ WFK I+ QVL FN  VH   +L+++L  L  
Sbjct: 580 RFNKFKDNLGQIQNSQRFKDLEISKEEVEWFKEIRKQVLTFNRDVHNQKRLQDQLIHLKQ 639

Query: 641 QLRSTTK--GD-DFFSELEFSSLQQMLLNDKKVINSCMNELSAS 681
           ++    +  GD +  +  E+  L+ ML  D  ++  C N+L ++
Sbjct: 640 EMNRIAQVTGDQNSQARDEWHELRHMLEEDTIILQDCNNQLKSA 683

>KNAG0C05840 Chr3 (1135516..1137759) [2244 bp, 747 aa] {ON}
           Anc_1.319 YJL061W
          Length = 747

 Score =  186 bits (473), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 188/738 (25%), Positives = 336/738 (45%), Gaps = 121/738 (16%)

Query: 10  KAIFQEVSLNPSD---RLV-CNNSNTIYLWQD---NILRVQSDHETQYRSYNVELPFVPE 62
           + I Q  +  PSD   R V   +  T Y++ D    +LR  S  E +Y S  +++    +
Sbjct: 23  RPILQPTAGLPSDLSSRYVFTTDKGTKYVYLDKTNGLLRWGSVSEDEYNSMPLKISNFAD 82

Query: 63  Q---MVISPSGGLVAFHANSELYVMEVNEQSR----LRKHFNTSLG-------IKKLLWH 108
           +   +++S SG  +  ++   + V+EV  + R    +   F TS         IKK+L+H
Sbjct: 83  KSVNVILSDSGEFLCVYSKDCVTVIEVPWRYRNPEEMSYVFQTSFKEIRKDSFIKKVLFH 142

Query: 109 PLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGL 168
           P A      VIL +D TI ++D+ED    +    N  S + G+ D + S+ DI F   GL
Sbjct: 143 PRAIKKTCMVILFEDDTIYLFDVED---NNKIALNVPSGNIGIEDRITSIADIEFSQDGL 199

Query: 169 TLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDK 228
           TLY+LS+ +  D+YAI+PCLP   ++   +  +             ++++S+ LY+SL  
Sbjct: 200 TLYVLSAEDCGDVYAIYPCLPPILAMSQKELKS-------------LMNRSVLLYDSL-- 244

Query: 229 QLKLISGSDPDVESDYLTLKHDLLKQIQFFD-----NYKKNDGIDTFTSKAI-RNSVPQG 282
                       E+    +K  ++KQ++F       ++ K +  +      I R + PQG
Sbjct: 245 -----------TETTPSAVKKGVIKQVEFISQLQNISHGKEEISNVLEIDTIYRLAKPQG 293

Query: 283 PFIIKKFPTALNAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTT 342
           PF I  FP  L +   T +  + +G    +L + + +GT + LF D E+ M+W +     
Sbjct: 294 PFTIAPFPEKLYSATATEICPLNIGGGNEILCIAYDNGTALFLFKDLELSMAWDV-GGIY 352

Query: 343 FNN---------------LSVITMFNAKG--------QCQLLNSSEPKLVFTGD----SS 375
           +NN               +S++  F   G          Q ++ S+   +  GD     S
Sbjct: 353 YNNSLVLMEEFDLQTESAVSILKSFKMDGLILFKVSDSVQHIDVSK-SFIQDGDLLVQQS 411

Query: 376 TTIMEM---PWLEPLAQCIRLHDFSIIDDVKFENKIRTVSGTFLGVLSTLSGDILYNGNS 432
           + I  +    W   ++ CI  HD + +  V F++K  T +     + S  + +   +G +
Sbjct: 412 SMIRCVDTKAWSSVVSDCIDRHDINALITVSFKSKGHTWAIAGSDITSCGAWN---HGGT 468

Query: 433 FKVIESNDKSTTQKPINRTDEVKYTYKPSLPTSGK----------------ELDMLLTKY 476
             V    +KS T K + +    + ++KP   TS +                EL+ L   Y
Sbjct: 469 EGVTWITNKSVTCKELKK----QVSWKPEQSTSSEKKKQAFPKPEFSVPISELNALNINY 524

Query: 477 KTEANGFISGIPDSLAPL----PLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNK 532
           +        G  D ++PL    PL N SNE+QL+V++ L    +  V  GQ +   ++N+
Sbjct: 525 QDTCR---IGFHDIISPLDRQKPLLNPSNEKQLQVMTSLSNYLLATVGKGQGLGMTLYNR 581

Query: 533 SNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSI 592
             E+  EL +QL+ +N+I M +  +   L + +  ++    K   L++R   L++  ++I
Sbjct: 582 LLEQQLELTKQLQCSNKILMKQPAIAKKLEEQKSVWNEKLAKQNKLKERFSSLQQKLAAI 641

Query: 593 ENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDTQLRSTTKGDDFF 652
           +  +K     I++ E VWFK +K + L FN+ V+    ++++L FL  +L +        
Sbjct: 642 DKTKKSTDLVITDEESVWFKEVKKEALTFNDLVYKQESVQDDLRFLKRELSTFVSDSQRL 701

Query: 653 ---SELEFSSLQQMLLND 667
              +  E+ SLQ+ML +D
Sbjct: 702 PGTANTEWHSLQEMLKHD 719

>TBLA0F01310 Chr6 complement(329569..331797) [2229 bp, 742 aa] {ON}
           Anc_1.319 YJL061W
          Length = 742

 Score =  183 bits (464), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 202/735 (27%), Positives = 318/735 (43%), Gaps = 97/735 (13%)

Query: 3   LFNTEDLKAIFQEVSLNPSDRLVCNNSNTIYLWQDNILRVQSDHETQYRSYNV-ELPFVP 61
           +F    L + FQE S  P      N  N + + QD  +R        Y SY +    F  
Sbjct: 20  IFKRNYLSSSFQETS--PRFFFTTNRDNRVVVVQDGSIRWCYTFSQNYHSYTIASRNFDI 77

Query: 62  EQMVISPSGGLVAFHANSELYVME--------VNEQS-----RLRKHFNT-SLGIKKLLW 107
           +  +IS SG  V +++++++ +ME        VN  S     + R  F   SL +K++L+
Sbjct: 78  KDSLISNSGSFVCYYSDTDISIMEIPWSHSNSVNASSSHCIQKYRYSFKKYSLTVKQVLF 137

Query: 108 HPLATYGLSFVILHDDSTIRIYDLE---DLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           HPLAT     V+L  D TI   D     DL   S  + N+KS+S GLS  +  +  + F 
Sbjct: 138 HPLATLESCLVVLLSDDTIVFIDFSKSFDL-LSSDYILNKKSKSIGLSSQISDIQSLTFS 196

Query: 165 PTGLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYN 224
             GLTLY LSS    D+YA +PCLP +         N             +++KS+  Y 
Sbjct: 197 QDGLTLYALSSSAATDVYAFYPCLPPSAQFSLEQLEN-------------LVNKSVVQYE 243

Query: 225 SLDKQLKLISGSDPDVESDYLTLKHDLLKQIQFF-DNYKKN-----DGIDTFTSK----- 273
            L              E D   LK +++KQ++F  D YKK      +  D+ T K     
Sbjct: 244 ELR-------------EDDPTALKINIIKQLKFTSDLYKKGKRALEEDTDSKTWKYDVPL 290

Query: 274 AIRNSVPQGPFIIKKFPTALNAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVM 333
             R   PQGPF I  FP +L     T +  +P+     LL L F DG+ V LF D E+ M
Sbjct: 291 EYRLIRPQGPFTISPFPDSLYYSSPTHIVSVPIDTTNELLVLSFSDGSVVSLFQDLELTM 350

Query: 334 SWSLRSNTTFNNLSVITMFNAKGQC--QLLNSSEPKLVFTGDSSTTIMEM---PWLEPLA 388
           SW   +    N+L ++ +   K Q   +L   +     F    S    E+    W   LA
Sbjct: 351 SWDQDNFNENNSLVLLELIKTKEQNIRKLTTYAHQYGTFYILGSVKNFEVLTSHWSSTLA 410

Query: 389 QCIRLHDFSIIDDV-------KFENKIRTVSGTFLGVLSTLSGDILYNGNSFKVIESNDK 441
            CI+  D   + ++        F+N    ++        T+S  +  N ++  VIE N+K
Sbjct: 411 ICIKSSDIRDLSNLLIKSVIKPFDNAAYELTSGGWWCSPTISSLLFINKST--VIELNEK 468

Query: 442 -------STTQKPINRTDEVKYTYKPSLPTSGKELDMLL-----------TKYKTEANGF 483
                   TT      T E+   Y P L     ++++ +           T +K E+N  
Sbjct: 469 PKLLLSDDTTHL---LTSELAQKYIPPLEDKIFKIELPMGILISDLNNMNTVFKEESNKQ 525

Query: 484 IS-GIPDSLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHR 542
           ++  IP     + L N +NE QLE ++++ K    ++ +GQ + F ++NK  ++   +  
Sbjct: 526 LTIPIPSQERNVTLFNKTNENQLETLTKISKVIGIKISMGQSLGFGIYNKILDQQNIVEL 585

Query: 543 QLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSS 602
           QLR+T  +      LN    +  ++   + E+ + L  RL  + E     + +  L   S
Sbjct: 586 QLRQTQRLLEKEKILNTKYNEQADKLRAFTERQEKLMSRLLIMNEKLKKADLDTNLLNIS 645

Query: 603 ISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDTQLRSTTKGDDFFSELEFSS--- 659
           IS+ EL +FK I+ QVL FN +VH      + L F+  +L      +    E +F     
Sbjct: 646 ISKKELEFFKEIRKQVLLFNEFVHKQKDQHDTLLFIKKELIRIKGENAIVDENDFKQWDR 705

Query: 660 LQQMLLNDKKVINSC 674
           L+ ML +D   I +C
Sbjct: 706 LRDMLHDDATTIETC 720

>KAFR0A01720 Chr1 complement(349779..351929) [2151 bp, 716 aa] {ON}
           Anc_1.319 YJL061W
          Length = 716

 Score =  181 bits (459), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 180/701 (25%), Positives = 322/701 (45%), Gaps = 93/701 (13%)

Query: 34  LWQDNILRVQSDHETQYRSYNVELPFV------PEQMVISPSGGLVAFHANSELYVMEV- 86
           +++ N LR  S   +QY S    LP +       E ++IS SG  +  +    L ++E+ 
Sbjct: 48  IYKKNQLRWGSVASSQYHS----LPLLFFDDSAYENVIISNSGQFLCLYDKKSLSLIEIP 103

Query: 87  -----------NEQSRLRKHFNTSLGIKKLLWHPLATYGLSFVILHDDSTIRIYDLEDLE 135
                      +   R+ +  N S  IKK+L+HP A      VIL ++  I ++DL   E
Sbjct: 104 WGYDGAVTSIKSSFQRVFRDVNKSSDIKKILFHPKAADDGCVVILFENDVICLFDLRKSE 163

Query: 136 PESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFNYCDIYAIHPCLPKNFSLR 195
                  N+ +   G+   V  + D+ F   GLTLY+LS  +  DIYA +PCLP   SL+
Sbjct: 164 K---LFLNKTANKLGIETRVTDIEDMEFSQDGLTLYMLSVTDGGDIYAFYPCLPPKLSLK 220

Query: 196 SNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDPDVESDYLTLKHDLLKQI 255
                         S+ + + +KS  LY+SLD  + +              ++ ++LKQI
Sbjct: 221 K-------------SVLEDLFNKSRILYDSLDSTVSI-------------EVRKNVLKQI 254

Query: 256 QFFDNYKKNDGIDTFTS-----KAIRNSVPQGPFIIKKFPTALNAKEVTGLTIIPVGERL 310
           +F  + + +   +T  S        R    QGPF +  +P  L       +  + +G   
Sbjct: 255 KFIASLRDSSSDETKNSCLEISNDFRQVKAQGPFTVAPYPEKLYEATAKEIYTLDIGNNN 314

Query: 311 GLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFNNLSVITMFNAKG--QCQLLNSSE-PK 367
            L  + F +GT  +L  D E+ MSW+   N  +NN  V+      G    +LL SS    
Sbjct: 315 ELFAITFDNGTVTLLLKDLELSMSWNA-DNYVYNNSFVLIESVEMGPESIKLLKSSSLTG 373

Query: 368 LVFTGDSSTTIMEM---PWLEPLAQCIRLHDFSIIDDVKFENKIRTV----SGTFLGVLS 420
            +F   + +++ ++    W   +++CI   D + + DV F++KI  +    +    GV S
Sbjct: 374 QMFISQNHSSVRKIDTTAWSFKVSKCITNSDLTSLIDVDFKSKISDLDIKENVDCYGVWS 433

Query: 421 TLSGD--ILYNGNS---------------FKVIESNDKSTTQKPINRTDEVKYTYKPSLP 463
            L G+  IL+  NS                K+ E +     + P+ +  EV +T     P
Sbjct: 434 -LRGERGILFVSNSSVISRTLPESDSSFVIKLDEMSRSKNIEDPVTKKYEVSFTQ----P 488

Query: 464 TSGKELDMLLTKYKTEANGFISGIPDSLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQ 523
            S + +++  +  +   + F   I        L N+SNE QL  ++E+  + +  +  GQ
Sbjct: 489 IS-EIMNLNDSFQRICRHPFKKIISPEERQTVLSNDSNETQLATLTEISNDLVSNIVEGQ 547

Query: 524 MILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLD 583
            +   + N+  E+  EL +QL+++ ++   ++ L  +  D   R+++  +K   L +R +
Sbjct: 548 SLGLVLRNRLYEQQYELTKQLKESIQLIEKQSLLKSSYDDKMVRWNKNLKKQDELIQRFN 607

Query: 584 KLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDTQL- 642
            L    + I  ++++  + ISE E+ WFK ++NQ+LKFN++VH+   ++E++ FL   L 
Sbjct: 608 ALNGNLAKIHESKEISKTPISEKEVEWFKEVRNQILKFNDFVHVHRNMQEQINFLRKGLS 667

Query: 643 RSTTKGDDFFSEL--EFSSLQQMLLNDKKVINSCMNELSAS 681
           R  +K     S L  E++  +++L  D  +I  C  EL+ +
Sbjct: 668 RIESKVGQRSSHLTSEWAEFKKILETDTNIIKECNEELTKA 708

>NCAS0A09210 Chr1 complement(1820713..1822845) [2133 bp, 710 aa]
           {ON} Anc_1.319 YJL061W
          Length = 710

 Score =  181 bits (459), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 181/675 (26%), Positives = 321/675 (47%), Gaps = 81/675 (12%)

Query: 60  VPEQMVISPSGGLVAFHANSELYVMEV---------NEQSRLR------KHFNTSLGIKK 104
            P++ ++S SG  +  + N  + V+E+         +  S+ +      K  +    IK+
Sbjct: 68  APQKAILSNSGEFICVYTNHTIEVIEIPWGYVTPSPSMVSKFQLFSYNNKDDDGYSPIKQ 127

Query: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           +L+HP A      V+L+D+ TI + D+  +  ++IT+ N++  +FG+   +  +  I F 
Sbjct: 128 VLFHPEAYKDSCLVVLYDNGTISLMDVTQI-TKTITL-NKRVATFGIDTQITDIESICFS 185

Query: 165 PTGLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYN 224
             G TLY LS  +  DIYA +PCLP+   ++         R K  SL    LH+S+ LY 
Sbjct: 186 KDGWTLYALSISDGGDIYAFYPCLPQQLEVK---------REKITSL----LHESVLLYE 232

Query: 225 SLDKQLKLISGSDPDVESDYLTLKHDLLKQIQFFDNY-------KKNDGIDTF-TSKAIR 276
           SL    KL   +D DV       K ++++Q+QF +         +KN   D     +  R
Sbjct: 233 SL----KL--DTDRDV-------KRNVIRQVQFVNKLNGLLTENEKNSNEDFIEIEQEYR 279

Query: 277 NSVPQGPFIIKKFPTALNAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWS 336
               QGPF I  +P  L +     ++ +P+     L+ + F DG+  +LF D  + MSW 
Sbjct: 280 LIRGQGPFTIDPYPERLYSATALEISTLPINSNNELMCMIFDDGSIALLFKDLPLTMSWD 339

Query: 337 LRSNTTFNNLSVITMFNAKGQCQLLNSSEP----KLVFTGDSSTTIMEMP-WLEPLAQCI 391
           + +    N+ S++ +   K        S P    +    GDSS  ++    W + LA+ I
Sbjct: 340 VDNYVHNNSFSLVELMQLKDTDVKRIVSYPDTYGQFFIFGDSSLFLVHTHIWSDLLAKAI 399

Query: 392 RLHDFSIIDDVKFENKI---RTVSGT-------FLG--VLSTLSGDILYNGNSFKVIESN 439
              + + + ++ F +K+    T +G        + G  V+  ++ + +Y  +  ++ +S 
Sbjct: 400 DNSNLNELLEMNFTSKLDFFETTNGITKCSPCKWRGRDVILFITKEDVY-MHPVEMRKSG 458

Query: 440 DKSTTQKPINRTDEVKYT-YKPSLPTSGKELDMLLTKYKTEANGFISGIPDSLAP----L 494
                +  +   +E+K+  YK S     +EL  L   ++ + +    G+   +AP    +
Sbjct: 459 ILGNNKPVLVNNEELKHQEYKTSFKQPVEELMALNKLFQQQCS---MGVSKLIAPEERQV 515

Query: 495 PLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLR 554
            L N +NE QLE++S++ KE + ++  GQ +   + ++  E+  EL RQL+  + I   +
Sbjct: 516 LLNNENNEVQLELLSDVSKEVISKIGQGQNLALNLHHRLLEQQYELTRQLKIVHTIMSKQ 575

Query: 555 NKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSI 614
           + L     +   R+     +S  L KRL  L      I N+ KL+   I++ EL WFK I
Sbjct: 576 SDLRRKSEEQSRRWDDQTSRSSQLIKRLQDLDAKILEINNSPKLKEYPINDKELEWFKEI 635

Query: 615 KNQVLKFNNYVHLTNKLREELEFLDTQL----RSTTKGDDFFSELEFSSLQQMLLNDKKV 670
           +NQVLKFN++VH     +EEL  L   L    + T++  D  S+ E+  L+ +L +D ++
Sbjct: 636 RNQVLKFNSFVHNQRDAQEELNHLKKDLARISKETSQLRDEKSDKEWDELRDILKHDAQI 695

Query: 671 INSCMNELSASIEDL 685
           I  C  EL ++ E L
Sbjct: 696 IQECNKELLSTTEAL 710

>KLTH0H10692g Chr8 complement(921787..923862) [2076 bp, 691 aa] {ON}
           similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061W NUP82 Subunit of the nuclear pore complex (NPC)
           forms a subcomplex with Nup159p and Nsp1p interacts with
           Nup116p and is required for proper localization of
           Nup116p in the NPC
          Length = 691

 Score =  178 bits (451), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 177/667 (26%), Positives = 295/667 (44%), Gaps = 88/667 (13%)

Query: 65  VISPSGGLVAFHANSELYVMEVN-EQSRLRKH-FNTSLGIKKLLWHPLATYGLSFVILHD 122
           V++ SG L+  +   E+ V+ ++ +Q+R   +      G+K++LWHP         +L+ 
Sbjct: 65  VLNDSGTLLCLNNVDEIQVLALSWDQTRPESYRIKVPAGVKQVLWHPRGRLDSCLTVLNK 124

Query: 123 DSTIRIYDL--EDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFNYCD 180
              I +Y+L  ED    + TV N  +   G+   V+ +  + F   GLTLYL+S     D
Sbjct: 125 RDEILLYELLSEDFSAPT-TVLNASTNELGMGSSVKDIESVCFSADGLTLYLMSVSEGAD 183

Query: 181 IYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDPDV 240
           +++I+PC+P   S+           T+      Y  +K+L  Y  L +      G  P+ 
Sbjct: 184 VFSIYPCMPSELSI-----------TRKA--LKYNFNKALLQYQELSE------GDSPE- 223

Query: 241 ESDYLTLKHDLLKQIQFFDNY--KKNDGIDTFTS--------KAIRNSVPQGPFIIKKFP 290
                 LK    +Q+ F  +   + +D  D+ T+        KA RN+  QGPF I  FP
Sbjct: 224 ------LKLKATRQLHFMSSLYNQPHDADDSQTNLLQTFHIRKAYRNARAQGPFTISPFP 277

Query: 291 TAL---NAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFNNLS 347
             L    AK++  + +    E   LL + F D T +  F D   VMSW    ++  N+L 
Sbjct: 278 EKLYLATAKQIKAIAL--EDETTELLLITFDDDTILECFPDLTPVMSWEDSGSSEKNSL- 334

Query: 348 VITMFNAK---------GQCQLLNSSEPKLVFTGDSSTTIMEMPWLEPLAQCIRLHDFSI 398
            I++ + K         G C +L S+E   V      T  +E      L  C    D + 
Sbjct: 335 -ISVGSLKLPGSISLIYGSCFVLISAEKAAVVNLSRLTRSIE----RSLDDC----DATE 385

Query: 399 IDDVKFENKIRTVSGTF----LGVLSTLSGDILYNGNSFKVIESNDKSTTQKPINRTDEV 454
           + +     +I    GTF    L   S +   +L    S K I S D S+ Q P + T E 
Sbjct: 386 LSEEDLTEEITEKKGTFQSAGLWPESGMQKIVLL---SEKEITSIDISSMQTPASSTTEK 442

Query: 455 --KYTYKPSLPTSG--KELDMLLTKYKTEANGFISG-IPDSLAPLPLKNNSNERQLEVVS 509
             K       P S    E+  L  K ++     +S  IP +L    L N  NE QL +++
Sbjct: 443 IEKSETNRQRPYSQPLSEVQTLNQKVQSLLKSPLSTVIPAALRQKTLNNTDNEDQLSLLT 502

Query: 510 ELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQERYS 569
           ++ KE + RV L Q +   +  +   +  EL + LR  +E+   + +++ +L   + R+ 
Sbjct: 503 DISKEVLSRVTLAQTLGLSLHLRLLGQQDELAQHLRDVSELRTKKERVSAHLASQKPRWE 562

Query: 570 RYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTN 629
             +EK+K++  R + L    + I  + +L++  I++AE+ WFK ++NQV++FN  VH   
Sbjct: 563 AIQEKNKSIALRFESLHRNMTQISKSSQLQSQPIAKAEMEWFKELRNQVVRFNRLVHEQQ 622

Query: 630 KLREELEFLDTQLR-----------STTKGDDFFSELEFSSLQQMLLNDKKVINSCMNEL 678
            L E L  L   L             + K  +    + +  LQ ML  D ++I  C  EL
Sbjct: 623 DLAEALSSLKLSLEYVRVDSAEAASRSKKSAESAGGVPWDELQAMLAKDSRIIKECQAEL 682

Query: 679 SASIEDL 685
             + ++L
Sbjct: 683 QCTTQEL 689

>NDAI0G05750 Chr7 (1424856..1427060) [2205 bp, 734 aa] {ON}
           Anc_1.319 YJL061W
          Length = 734

 Score =  178 bits (451), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 170/628 (27%), Positives = 284/628 (45%), Gaps = 71/628 (11%)

Query: 102 IKKLLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDI 161
           IK++L+HP + +    VIL++DS I++ D      E+IT+ N+ + + G+   V  +  I
Sbjct: 130 IKQVLFHPKSYHETCLVILYEDSIIQLIDTT-ASTETITI-NQPTGTLGVETRVIDIESI 187

Query: 162 AFDPT-GLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSL 220
            FD T GL LY LS  +  DIYA++PCLP    +   +              D +L KS+
Sbjct: 188 CFDKTTGLILYALSISDGGDIYALYPCLPTRLDVSKKE-------------VDLLLQKSI 234

Query: 221 SLYNSLDKQLKLISGSDPDVESDYLTLKHDLLKQIQF-------FDNYKKNDGIDTFTSK 273
            LY+SL + +        DV       K +++KQ+QF       F    K +  +  T  
Sbjct: 235 VLYDSLKENMS------NDV-------KRNVIKQLQFATKLQGQFLEQLKGEKDEERTRH 281

Query: 274 AIRNSVP-------------QGPFIIKKFPTALNAKEVTGLTIIPVGERLGLLNLQFIDG 320
           A ++                QGPF I  FP  L +        + + E   LL + F DG
Sbjct: 282 AQKDLKLILDVDLEYRLVNFQGPFTISPFPNELYSATAKESQCMKINENNELLIMTFDDG 341

Query: 321 TNVVLFSDSEIVMSWSLRSNTTFNNLSVITMFNAK----GQCQLLNSSEPKLVFTGDSST 376
           +  +LF D E+ MSW + +    N+ +++ +   K    G+  +   +  K     D   
Sbjct: 342 SVALLFRDLELTMSWDIANYIHDNSFALVELIKLKPTDIGRLIIYQDNFGKFFLLSDDVI 401

Query: 377 TIMEM-PWLEPLAQCIRLHDFSIIDDVKFENKIR--TVSGTFLGVLST----------LS 423
            ++    W + LA+ I   + +I+ ++ FE++I    V G F                +S
Sbjct: 402 MLVHTNSWSDKLAKAIDDSNLNILSEIGFESEITWFDVMGKFNNCTPCKYHGKESIIFVS 461

Query: 424 GDILYNGNSFKVIESNDKSTTQKPINRTDEVKYTYKPSLPTSGKELDMLLTKYKTEAN-G 482
            D ++  N  K    N+   +    +  +  +  YK +      EL  L   ++ +    
Sbjct: 462 SDNVFVENLTKKHSMNNIKGSSTSNSNEETAESEYKVTFKQPIDELMTLNELFQKQCRMP 521

Query: 483 FISGIPDSLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHR 542
           F   I      + L N SNE QLE++++L KE + ++  GQ + F + N+  E+  EL R
Sbjct: 522 FSKLIKPEDRQIELSNESNEIQLEILTDLSKELITKIIDGQTLGFNLHNRLKEQQLELTR 581

Query: 543 QLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSS 602
           QL+ T  +   ++ +     ++ +R++    +S  L  RL  L E   +I ++  L +  
Sbjct: 582 QLKHTQIVFEKQDCIKNKNKEILKRWNEQLNRSVKLTDRLQNLNEKLITINDSPNLSSYP 641

Query: 603 ISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDTQL----RSTTKGDDFFSELEFS 658
           I+  EL WFK I+NQV KFN++VH      EEL FL  +L       T   D  S+ E+ 
Sbjct: 642 ITSVELEWFKEIRNQVHKFNSFVHTQRDANEELSFLKKELDRISNDVTSVVDEKSKKEWE 701

Query: 659 SLQQMLLNDKKVINSCMNELSASIEDLA 686
            L+ +L  D K+I  C  EL+ + E +A
Sbjct: 702 ELRAILEQDSKIIKECNIELTKTTESMA 729

>TPHA0O01460 Chr15 complement(293395..295560) [2166 bp, 721 aa] {ON}
           Anc_1.319 YJL061W
          Length = 721

 Score =  172 bits (435), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 186/729 (25%), Positives = 331/729 (45%), Gaps = 107/729 (14%)

Query: 24  LVCNNSNTIYLWQDNILRVQ--SDHETQYRSYNVELPFVPEQMVISPS-GGLVAFHANSE 80
           +  +N   I L+Q+N +R    +D +  ++S  +E   + +  +I+   G  +      E
Sbjct: 25  ITVDNGLKIILYQNNTVRYGFVNDADGNFKSITLEKEMIGDVSIIADQIGNYLCLFNEFE 84

Query: 81  LYVMEV---------------NEQSRLRKHFNTSLG--IKKLLWHPLATYGLSFVILHDD 123
           + V+E+               +   ++R +   S G  I+K+L+HPL       V+L  +
Sbjct: 85  IRVIELPWKLWDAKEDSSFQLDNMVQIRSYDLKSFGTTIQKILFHPLGLAYPCLVVLLKN 144

Query: 124 STI------RIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFN 177
           S I      RI  +E++    IT F+ K    GLS  ++ + DI+F    L+LY L+   
Sbjct: 145 SNICSIDIKRILKVEEIPSTCITTFHTKG-VMGLSSCIDDIIDISFSSDKLSLYALTE-- 201

Query: 178 YCDIYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLD---------- 227
             DIY  +P L    S+  N+              D +  KS+ L+ +L+          
Sbjct: 202 -TDIYLFYPFLIPTISVTKNEI-------------DQLFQKSIILFENLENDSSEAVRRN 247

Query: 228 --KQLKLISGSDPDVESDYLTLKHDLLKQIQFFDNYK-KNDGIDTFTSKAIRNSVPQGPF 284
             KQL+L+S    D+++         +KQ++  D  K  N  I+T      R+   QG F
Sbjct: 248 IIKQLQLLSTLSGDIKTQ--------MKQVKNTDETKIYNIDINT----EYRSVNAQGSF 295

Query: 285 IIKKFPTALNAKEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFN 344
            I  FP  L  +    L++I +G    L  + + DGT ++L+ D E  MSW   ++ TFN
Sbjct: 296 SIAPFPEELYKQSAVNLSVIQIGHGNELYVITYDDGTVLILYRDLESSMSWD-SNDYTFN 354

Query: 345 NLSVIT---MFNAKGQCQLLNSSEPKLVFT--GDSSTTIMEMP-WLEPLAQCIRLHDFSI 398
           N  ++     FN      +L+      +F   GD +  +++   W + L+QCI+ +D   
Sbjct: 355 NSFILLEKLKFNPDETKSILDIPFKNGIFAIAGDQTVNLIDTSCWSDILSQCIKDNDIRN 414

Query: 399 IDDVKFENKIRTVSGTFLGVLSTLSGDILYNGNSFK--------------VIESNDKSTT 444
           +  +  E+  +T++      L   +  IL+N ++ K              ++ESN++S  
Sbjct: 415 LAGLSIESHKQTIN-----TLEEPNSCILWNEHNKKELLFITETKLISSDILESNNESAE 469

Query: 445 QKPINRTDEVKYTYKPSLPTSG---KELDMLLTKYKTEAN-GFISGIPDSLAPLPLKNNS 500
           + P+   +++K   K  L       KE+++ + +YK      +   IP ++   P  N+ 
Sbjct: 470 KLPVPAINDIKKIEKLQLKNYSQPIKEINIAVQRYKDSCKVPYSKVIPANIRQKPFANDE 529

Query: 501 NERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGN 560
           NE QL  ++E+ +E   ++  GQ I   M  +  E+      QL  TN+ E+L NK    
Sbjct: 530 NEDQLAYITEISQEIGSKILQGQTIALMMHTRLREQQDVFAEQLMHTNK-ELLHNKTIKQ 588

Query: 561 LGDLQE-RYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVL 619
             D+Q  +     E++  L +R  KL E    I+ +++ +   I+++E   FK IK QVL
Sbjct: 589 TYDIQSTKIKHITERNTKLNERTSKLIEMMEKIKQSQQYKNMPINDSESKLFKEIKKQVL 648

Query: 620 KFNNYVHLTNKLREELEFLDTQLRST----TKGDDFF---SELEFSSLQQMLLNDKKVIN 672
            FN+ V+   + +E ++FL T+L +      +  D      E E++ L  +L  D K+I 
Sbjct: 649 IFNDAVNRQQEQQEAIKFLQTELNNIIEQPAQSHDAIIDSDEDEWNELCDLLNRDAKIIE 708

Query: 673 SCMNELSAS 681
            C  ELS++
Sbjct: 709 DCNAELSSA 717

>CAGL0J05214g Chr10 complement(501919..504069) [2151 bp, 716 aa]
           {ON} similar to uniprot|P40368 Saccharomyces cerevisiae
           YJL061w NUP82 nuclear pore protein
          Length = 716

 Score =  168 bits (426), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 185/697 (26%), Positives = 318/697 (45%), Gaps = 104/697 (14%)

Query: 40  LRVQSDHETQYRSYNVELPFVP--EQMVISPSGGLVAFHANSELYVMEV-----NEQSRL 92
           LR      T Y+S + +L F    E  V S +   V  +   EL+V+EV      E++ L
Sbjct: 40  LRWCHSTSTTYKSLDFDLQFEGKVEGAVSSTTADYVCIYNRDELHVLEVPWMYSGEENGL 99

Query: 93  RK-------HFNTSLGIKKLLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITV-FNR 144
           +         F+ +  IK++L+HP +    + ++L +D +I + + +D   +   +  N 
Sbjct: 100 KHLCHIYSHKFDENHSIKQVLFHPKSYLDSTILVLTNDDSIFMINTDDNRSDKNMINLNS 159

Query: 145 KSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFNYCDIYAIHPCLPKNFSLRSNDTSNVTS 204
           K+ + GL D +  +  I F   GL+L +LS+   CDI+ I+PCLP+ + +  ++      
Sbjct: 160 KNSALGLYDRINDIQKIIFSQDGLSLLILSAEEGCDIFTIYPCLPRRWDISLHE------ 213

Query: 205 RTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDPDVESDYLTLKHDLLKQIQFFDNYK-- 262
                   D +  KSL LYN+++        + P         K +++KQ+ F +  +  
Sbjct: 214 -------VDTLFAKSLLLYNNMN------VNTTPQE-------KRNIVKQLNFMEKIRGQ 253

Query: 263 ----KNDGIDTFTSKAIRNSVPQGPFIIKKFPTALNAKEVTGLTIIPVGERLGLLNLQFI 318
               +ND        A  N+ PQGPF +  +P  L     T + II + + + LL + F 
Sbjct: 254 KTAFRNDKKPLILEDAYLNAQPQGPFSMTPYPNELYDFMATDINIIQITQNISLLAIAFS 313

Query: 319 DGTNVVLFSDSEIVMSWSLRSNTTFNNLSVITMF------NAKGQCQLLNSSEPKLVFTG 372
           +GT ++  SD E +MSW +      N+L+++         NAK     +  +  K V T 
Sbjct: 314 NGTVLLFLSDLEPIMSWDISRFPGSNSLALLEQIKLEITDNAKFLS--IPGTYGKFVVTD 371

Query: 373 D--SSTTIMEMPWLEPLAQCIRLHDFSIIDDVKFENKIRTVSGTFLGVLSTLSGDILYNG 430
           +  S+  +    W   LAQ I   D  ++ ++K ++ I       L  L+T    I+Y  
Sbjct: 372 NVKSNFFVNTCDWSTILAQIIDDSDIKLLANLKVKSNIEN-----LQQLATTFKSIIYWK 426

Query: 431 N---------SFKVIESND------KSTTQKPINRTD----------EVK---YTYKPSL 462
           N         S K IE  D       +T  K I++++          E+K   Y  K + 
Sbjct: 427 NENISCNYIISDKKIEELDMLDGISSTTKHKLIDQSNSQVESKLDLPELKNGLYEVKFAR 486

Query: 463 P-TSGKELDMLLTKYKTEANGFISGIPDSLAPLPLKNNSNERQLEVVSELYKETMKRVKL 521
           P T  +  + +   YK   N   + IP  +   PLKN+SNE QLE ++++ +  MK + +
Sbjct: 487 PLTEIQHYEQIY--YKNLQNQNFTKIPLEIRSAPLKNSSNENQLESLTKISESYMKMISM 544

Query: 522 GQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQE----RYSRYEEKSKT 577
            Q + +    +  + + E  RQ+  T +I    NK   N   ++E    +  + +EK + 
Sbjct: 545 AQTLGYIYRKRMIDSIEEFSRQIETTYQI----NKFWDNFEQIREVQNTKIDKVKEKQQK 600

Query: 578 LEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEF 637
           L +RL  L +     +    +  S+IS AE  WF  IK  V++FN+YV   +   +ELEF
Sbjct: 601 LMERLSSLYDKVEGQKEMGSMNNSNISAAESEWFAEIKRSVIEFNSYVRKASTNHQELEF 660

Query: 638 L-DTQLRSTTKGDDFFSE--LEFSSLQQMLLNDKKVI 671
           + + Q +   +  D  SE   E++ LQQ+L  D K+I
Sbjct: 661 IKEQQAQIANQKPDISSENGKEWNDLQQLLRTDLKII 697

>Kpol_1035.24 s1035 complement(57897..60050) [2154 bp, 717 aa] {ON}
           complement(57897..60050) [2154 nt, 718 aa]
          Length = 717

 Score =  162 bits (411), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 167/711 (23%), Positives = 325/711 (45%), Gaps = 91/711 (12%)

Query: 26  CNNSNTIYLWQDNILR----VQSDHETQYRSYNVELPFVPEQMVISPSGGLVAFHANSEL 81
            NN   I L+QD+ +R      +DH       + ++       +IS  G  +  + + ++
Sbjct: 26  ANNGTRIILFQDSTIRWSFSSDNDHYQSMALRDSDMDVTG--AIISDPGDYLCLYNSHQI 83

Query: 82  YVMEV----------------NEQSRLRKHFNTSLGIKKLLWHPLATYGLSFVILHDDST 125
            V+E+                + Q R+       L +K++L+HPL+      V+L   S 
Sbjct: 84  RVIEIPWGLTNVDEISNSMASSLQERVYNFNEDKLSVKQVLFHPLSKSSPFLVVLFSGSQ 143

Query: 126 IRIYDLEDLEPES---ITVFNR--KSRSFGLSDHVESVCDIAFDPTGLTLYLLSSFNYCD 180
           I   DL+++   S   I  F     S   G+ + VE++  + F    L+LY L+     D
Sbjct: 144 IAFVDLKNVFKSSDIPIDCFLNLTDSNVMGIDNRVENIQYVVFADDCLSLYSLTD---TD 200

Query: 181 IYAIHPCLPKNFSLRSNDTSNVTSRTKNGSLADYMLHKSLSLYNSLDKQLKLISGSDPD- 239
           +Y  +PCLP            V S +KN    D +++KS+ LY +L        G D D 
Sbjct: 201 VYCFYPCLPP-----------VASLSKNR--VDELINKSIVLYENL--------GIDADD 239

Query: 240 -VESDY---LTLKHDLLKQIQFFDNYKKNDGIDTFTSKAIRNSVPQGPFIIKKFPTALNA 295
            V  +    L L   L K+I+ F+N      ++       R +  QG F I  +P +L  
Sbjct: 240 IVRKNVIKQLQLASSLRKKIEEFENANGEVEVNVEIDLEFRQTKAQGYFSISPYPESLYT 299

Query: 296 KEVTGLTIIPVGERLGLLNLQFIDGTNVVLFSDSEIVMSWSLRSNTTFNNLSVITMFNAK 355
                ++++P+GE   L  + F +GT +V+F D E  MSW +   +  N+ +++ +   K
Sbjct: 300 CTGKQISVLPIGEGNELFLVSFDNGTVLVVFKDKESTMSWDVNDYSFNNSFTLVEIIKFK 359

Query: 356 GQ----CQLLNSSEPKLVFTGDSSTTIME-MPWLEPLAQCIRLHDFSIIDDVKFENKIRT 410
            +      +L     K V +G+ ST +++   W   +++CIR +D   +  ++ ++ I  
Sbjct: 360 PEELSNMVVLQGELGKFVVSGEKSTILVDTTKWSSVISKCIRDNDLRPLVGLEMKSTITH 419

Query: 411 VSGTFLGVLSTLSGDILYNGNSFKVIESNDKSTTQKPINRTDEVKYTYKPSLPTSGKELD 470
           ++         ++   ++N    K +   D +          EV++  + +   S +  +
Sbjct: 420 INSDM-----QINSCGIWNSGEAKSLLLVDTNVVVGYQLFKKEVEFKPESAEEISTELEN 474

Query: 471 MLLTKYKTEANGFISG---------------IPDSLAPLPLKNNSNERQLEVVSELYKET 515
             L K+    N   +                IP ++  +P  +N+ E QL++++++ ++ 
Sbjct: 475 FTLDKFTVPENELKAANYKFQEAVSVPYSKVIPANIKQVPFGSNAMEEQLKILNDISRDV 534

Query: 516 MKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLRNKLNGNLGDLQERYSRYEEKS 575
             ++  GQ +   ++++  E+  +L  QL  TN+I +   K+    GD   + S+ +EK 
Sbjct: 535 GSKIVQGQSLGLMLYDRLLEQQDKLSEQLIITNKILIRAKKVQ---GDYPAQLSKLDEKL 591

Query: 576 KT---LEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNKLR 632
           K    LEK L K++   ++I+ ++KL++  +SE E+  FK +++Q+L FNN+VH     +
Sbjct: 592 KKQEHLEKILLKMESNLNTIQESQKLKSLPLSEKEIQLFKELRSQILLFNNFVHKQKDQK 651

Query: 633 EELEFLDTQLRS---TTKGDDFFSEL-EFSSLQQMLLNDKKVINSCMNELS 679
           + ++FL  +L+     ++ +     L E+  L+Q+L +D K+I  C  +L+
Sbjct: 652 QNIQFLKKELQKIIDISRSESSKGMLNEWEELRQILADDAKIIKECNEQLT 702

>YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}
           SOF1Essential protein required for biogenesis of 40S
           (small) ribosomal subunit; has similarity to the beta
           subunit of trimeric G-proteins and the splicing factor
           Prp4p
          Length = 489

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 73/166 (43%), Gaps = 21/166 (12%)

Query: 3   LFNTEDLKAIFQEVSLNPSDRLVCNNSNTIYLWQDNILRVQSDHETQYRSYNV-ELPFVP 61
           L  T D ++ FQ +  +  +         I+LW  N L+  SD    + + N+  L F  
Sbjct: 172 LIRTFDGESAFQGIDSHRENSTFATGGAKIHLWDVNRLKPVSD--LSWGADNITSLKFNQ 229

Query: 62  EQMVISPSGGLVAFHANSELYVMEVNEQSRLRKHFNTSLGIKKLLWHPLATYGLSFVILH 121
            +  I  S G     +++ + + ++   S  +K   T +    + W+P+  +  +FV  +
Sbjct: 230 NETDILASTG-----SDNSIVLYDLRTNSPTQKIVQT-MRTNAICWNPMEAF--NFVTAN 281

Query: 122 DDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTG 167
           +D     YD+ +L   S+ VF          DHV +V D+ F PTG
Sbjct: 282 EDHNAYYYDMRNLS-RSLNVF---------KDHVSAVMDVDFSPTG 317

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 12/72 (16%)

Query: 96  FNTSLGIKKLLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHV 155
           F   +    L W+P+  Y  +FV+  +D     YD+ +L   ++ VF          DHV
Sbjct: 252 FTQRMRTNALCWNPMEAY--NFVVASEDHNAYYYDMRNLS-RALHVF---------KDHV 299

Query: 156 ESVCDIAFDPTG 167
            +V D+ F PTG
Sbjct: 300 SAVMDVDFSPTG 311

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 12/63 (19%)

Query: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           L W+P+  Y  +FV+ ++D     YD+ +L   ++ VF          DHV +V D+ F 
Sbjct: 262 LCWNPMEAY--NFVVANEDHNAYYYDMRNLS-RALHVF---------KDHVSAVMDVDFS 309

Query: 165 PTG 167
           PTG
Sbjct: 310 PTG 312

>Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W
           (REAL)
          Length = 490

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 12/63 (19%)

Query: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           + W+P+  +  +FVI ++D     YD+ +L   S+ VF          DHV +V D+ F 
Sbjct: 267 ICWNPMEAF--NFVIANEDHNAYYYDMRNLS-RSLNVF---------KDHVSAVMDVDFS 314

Query: 165 PTG 167
           PTG
Sbjct: 315 PTG 317

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 40/86 (46%), Gaps = 12/86 (13%)

Query: 99  SLGIKKLLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESV 158
           S+    + W+P+  +  +FVI ++D     YD+ ++   ++ VF          DHV +V
Sbjct: 255 SMRSNAICWNPMEAF--NFVIANEDHNAYYYDMRNMS-RALNVF---------KDHVSAV 302

Query: 159 CDIAFDPTGLTLYLLSSFNYCDIYAI 184
            D+ F PTG  L   S      IY I
Sbjct: 303 MDVDFSPTGTELVTGSYDKTIRIYDI 328

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 12/63 (19%)

Query: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           + W+P+  +  +FV  ++D     YD+ +L   S+TVF          DHV +V D+ F 
Sbjct: 267 ICWNPMEAF--NFVTANEDHNAYYYDMRNLS-RSLTVF---------KDHVSAVMDVDFS 314

Query: 165 PTG 167
           PTG
Sbjct: 315 PTG 317

>NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {ON}
           Anc_5.201 YLL011W
          Length = 479

 Score = 38.5 bits (88), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 12/63 (19%)

Query: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           + W+P+  +  +FVI ++D     YD+ ++   +I VF          DHV +V D+ F 
Sbjct: 261 ICWNPMEAF--NFVIGNEDHNAYYYDMRNM-SRAINVF---------KDHVSAVMDVDFS 308

Query: 165 PTG 167
           PTG
Sbjct: 309 PTG 311

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 38.1 bits (87), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 12/69 (17%)

Query: 99  SLGIKKLLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESV 158
           S+    + W+P+  +  +FVI ++D     YD+ ++   ++ VF          DHV +V
Sbjct: 255 SMRTNAICWNPMEAF--NFVIANEDHNAYYYDMRNM-SRALNVF---------KDHVSAV 302

Query: 159 CDIAFDPTG 167
            D+ F PTG
Sbjct: 303 MDVDFSPTG 311

>KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {ON}
           Anc_5.201 YLL011W
          Length = 485

 Score = 38.1 bits (87), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 12/69 (17%)

Query: 99  SLGIKKLLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESV 158
           S+    + W+P+  +  +FV+ ++D     YD+ ++   S+ VF          DHV +V
Sbjct: 261 SMRTNAICWNPMEPF--NFVVANEDHNAYYYDMRNMS-RSLNVF---------KDHVSAV 308

Query: 159 CDIAFDPTG 167
            D+ F PTG
Sbjct: 309 MDVDFSPTG 317

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 38/80 (47%), Gaps = 12/80 (15%)

Query: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           + W+P+  +  +FVI ++D     YD+ ++   ++ VF          DHV +V D+ F 
Sbjct: 261 ICWNPMEAF--NFVIANEDHNAYYYDMRNMS-RALNVF---------KDHVSAVMDVDFS 308

Query: 165 PTGLTLYLLSSFNYCDIYAI 184
           PTG  +   S      IY +
Sbjct: 309 PTGDEIVTGSYDKTVRIYQV 328

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 12/63 (19%)

Query: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           + W+P+  +  +FV+ ++D     YD+ ++   ++ VF          DHV +V D+ F 
Sbjct: 261 ICWNPMEAF--NFVVANEDHNAYYYDMRNMS-RALNVF---------KDHVSAVMDVDFS 308

Query: 165 PTG 167
           PTG
Sbjct: 309 PTG 311

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 12/63 (19%)

Query: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           + W+P+  +  +FVI ++D     YD+ ++   ++ VF          DHV +V D+ F 
Sbjct: 260 ICWNPMEAF--NFVIANEDHNAYYYDMRNM-SRALHVF---------KDHVSAVMDVDFS 307

Query: 165 PTG 167
           PTG
Sbjct: 308 PTG 310

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 73/166 (43%), Gaps = 21/166 (12%)

Query: 3   LFNTEDLKAIFQEVSLNPSDRLVCNNSNTIYLWQDNILRVQSDHETQYRSYNV-ELPFVP 61
           L  T D ++ FQ +  +  +         I+LW  N L+  S+    + + N+  + F  
Sbjct: 172 LVRTFDGESAFQGIDSHRENSTFATGGAKIHLWDVNRLKPVSN--LSWGADNITSVKFNQ 229

Query: 62  EQMVISPSGGLVAFHANSELYVMEVNEQSRLRKHFNTSLGIKKLLWHPLATYGLSFVILH 121
            +  I  S G     +++ + + ++   S  +K   T +    + W+P+  +  +FV  +
Sbjct: 230 SETDILASTG-----SDNSIVLYDLRTNSPTQKIVQT-MRTNAICWNPMEAF--NFVTAN 281

Query: 122 DDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFDPTG 167
           +D     YD+ +L   S+ VF          DHV +V D+ F PTG
Sbjct: 282 EDHNAYYYDMRNLS-RSLNVF---------KDHVSAVMDVDFSPTG 317

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%), Gaps = 12/63 (19%)

Query: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           + W+P+  +  +FVI ++D     YD+ ++  +++ VF          DHV +V D+ F 
Sbjct: 260 ICWNPVEAF--NFVIANEDHNAYYYDMRNMS-KALHVF---------KDHVSAVMDVDFS 307

Query: 165 PTG 167
           PTG
Sbjct: 308 PTG 310

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 12/63 (19%)

Query: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           L W+P+  +  +F I ++D     YD+ ++   ++ VF          DHV +V D+ F 
Sbjct: 264 LCWNPMEPF--NFAIANEDHNAYYYDMRNMS-RALHVF---------KDHVSAVMDVDFS 311

Query: 165 PTG 167
           PTG
Sbjct: 312 PTG 314

>TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {ON}
           Anc_5.201 YLL011W
          Length = 473

 Score = 35.0 bits (79), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 36/80 (45%), Gaps = 12/80 (15%)

Query: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           L W+P+  +  +FV  ++D     YD+  +   ++ VF          DHV +V D+ F 
Sbjct: 260 LCWNPMEAF--NFVTANEDQNSYYYDMRYMS-RALNVF---------KDHVSAVMDVDFS 307

Query: 165 PTGLTLYLLSSFNYCDIYAI 184
           PTG  +   S      IY I
Sbjct: 308 PTGQEIVTGSYDKTIRIYNI 327

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 34/69 (49%), Gaps = 12/69 (17%)

Query: 99  SLGIKKLLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESV 158
           ++ +  + W+P+  +  +FV+  +D     YD+ ++   ++ VF          DHV +V
Sbjct: 258 TMRVNSMCWNPMEAF--NFVVASEDHNAYYYDMRNMS-RALNVF---------KDHVSAV 305

Query: 159 CDIAFDPTG 167
            D+   PTG
Sbjct: 306 MDVDISPTG 314

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 34.7 bits (78), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 12/63 (19%)

Query: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           + W+P+  +  +FV  ++D     YD+ ++   ++ VF          DHV +V D+ F 
Sbjct: 261 ICWNPMEAF--NFVTANEDHNAYYYDMRNMS-RALNVF---------KDHVSAVMDVDFA 308

Query: 165 PTG 167
           PTG
Sbjct: 309 PTG 311

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 12/63 (19%)

Query: 105 LLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDIAFD 164
           L W+P+  +  +FV  ++D     YD+  +   ++ VF          DHV +V D+ F 
Sbjct: 260 LCWNPMEPF--NFVTGNEDHNAYYYDMRKMN-RALNVF---------KDHVSAVMDVDFA 307

Query: 165 PTG 167
           PTG
Sbjct: 308 PTG 310

>Suva_13.41 Chr13 complement(62311..64194,64223..67294) [4956 bp,
           1651 aa] {ON} YML103C (REAL)
          Length = 1651

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 43/82 (52%), Gaps = 7/82 (8%)

Query: 106 LWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCDI-AFD 164
           ++HP+  Y  S ++ H    + + + E LE   I  F R + S  +   ++++ +I +FD
Sbjct: 318 IFHPMIHYAWSCILYH---RLALQESESLEDPEIAKFARFAESRDIFPELDTLAEILSFD 374

Query: 165 PTG---LTLYLLSSFNYCDIYA 183
           PT    +T++L  S N+  I A
Sbjct: 375 PTYTTIITIFLEFSLNFISITA 396

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
           Anc_4.238 YDL058W
          Length = 1928

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 88/187 (47%), Gaps = 28/187 (14%)

Query: 484 ISGIPDSLAPLPLKN-NSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHR 542
           I+   D+L  L  +N N  E+  E++ E YKE ++ ++     +     K+ E V +++R
Sbjct: 779 ITEERDTLDALKKENENKIEKNEELLKE-YKEKLQNIETQLQTIILAKQKAEEGVNKMNR 837

Query: 543 QL----RKTNEIEMLRNKLNGN----LGDLQERYSRYEEKSKTL-------EKRLDKLKE 587
           +L    R+  E+E       GN    L DLQ++ +  E++ + L       EK + +L E
Sbjct: 838 ELFALSREKQELE-------GNQKIALKDLQKKTAVLEKEKRQLSDKLNEKEKDITRLNE 890

Query: 588 TFSSIENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNKLREELEFLDTQLRSTTK 647
             +++EN  K   S  +E      K ++    KF N+ +L  KL ++L+ L T  +   K
Sbjct: 891 ELATLENTVKSLESEKNEKR----KEVEEWKSKFQNHDNLVPKLTDKLKSLATSFKELEK 946

Query: 648 GDDFFSE 654
             D   E
Sbjct: 947 ERDSLQE 953

>Smik_12.60 Chr12 (130182..133022) [2841 bp, 946 aa] {ON} YLL003W
           (REAL)
          Length = 946

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 53/117 (45%), Gaps = 5/117 (4%)

Query: 554 RNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFKS 613
           RNK+  +    +      EE +K  E+ + K+KETF  I  + + + S ++  E   F++
Sbjct: 201 RNKIRRHFSHWKTACELNEEANKFAEQAVMKIKETFFYIWCDRRSKYSQMANNEAESFRN 260

Query: 614 IKNQVLKFNNYVHLTNKLREELE-----FLDTQLRSTTKGDDFFSELEFSSLQQMLL 665
                  F  ++ LT  L+E+       FL+   R   K  + +  LE  S++ + L
Sbjct: 261 TWLLFRSFQQWIALTQTLKEQARLADQAFLNKMFRRIIKAQENWKHLETISIESIKL 317

>Kwal_33.14157 s33 (550912..552207) [1296 bp, 431 aa] {ON} [contig
           105] FULL
          Length = 431

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 56/121 (46%), Gaps = 24/121 (19%)

Query: 342 TFNNLSVITMFNAKGQCQLLNSSEPKLVFTGDSSTTIMEMPWLEPLAQCIRLHDFSIIDD 401
           TF  LS+I +F       LLN     L      ST+I     L PL  C+  +  +I + 
Sbjct: 266 TFVCLSLIQLF-------LLNKGLRHL------STSI-----LYPLVFCVY-NLVNIFNG 306

Query: 402 VKF----ENKIRTVSGTFL-GVLSTLSGDILYNGNSFKVIESNDKSTTQKPINRTDEVKY 456
           + F    ++ +R V    L G  S + G +L + + + + +  D S++Q P NRT  + Y
Sbjct: 307 IVFFHDQDSSLRHVLAIILPGATSLIVGVVLLSHDQYIMFQHEDTSSSQDPSNRTSRLSY 366

Query: 457 T 457
           T
Sbjct: 367 T 367

>TDEL0B02260 Chr2 (408913..410901) [1989 bp, 662 aa] {ON} Anc_5.696
           YIL144W
          Length = 662

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 68/126 (53%), Gaps = 13/126 (10%)

Query: 498 NNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNE-EVAELHRQLR-KTNEIEMLRN 555
           +N+ E+  + +S+LYKE  +RVK  Q     M N + E +V +L R++R KTN IE    
Sbjct: 499 HNTAEKAQQELSKLYKEIQERVKNCQ-----MENSTIEAKVVDLQREIREKTNAIE---- 549

Query: 556 KLNGNLGDLQERYS-RYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAE-LVWFKS 613
           +L   L D +  Y  + +E   +L  +  ++++    I ++ +L    ++EAE LV    
Sbjct: 550 RLELQLSDAKSNYELKLQENESSLLSQKIEIEKLEKKISDSSRLTKERLAEAEQLVQVTK 609

Query: 614 IKNQVL 619
           IK++ L
Sbjct: 610 IKHEEL 615

>Kpol_483.20 s483 complement(51934..54285) [2352 bp, 783 aa] {ON}
           complement(51934..54285) [2352 nt, 784 aa]
          Length = 783

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 42/90 (46%)

Query: 489 DSLAPLPLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTN 548
           DSLAP    ++S E +  VV+ L          G++++    N+ N     L R  R   
Sbjct: 349 DSLAPNRANDDSGEVESRVVATLLTLMDGMGGSGRLVVVAATNRPNSVDPALRRPGRFDQ 408

Query: 549 EIEMLRNKLNGNLGDLQERYSRYEEKSKTL 578
           E+E+    ++     L++++SR  E+  TL
Sbjct: 409 EVEIGIPDVDARFDILKKQFSRMSEERHTL 438

>Kpol_361.3 s361 complement(3792..5675) [1884 bp, 627 aa] {ON}
           complement(3792..5675) [1884 nt, 628 aa]
          Length = 627

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 59/140 (42%), Gaps = 20/140 (14%)

Query: 91  RLRKHFNTSLGIKKLLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSRSFG 150
           RLR +  +   I  + W P   Y    V    D++IRI+D++  +           + F 
Sbjct: 132 RLRSNSASISEIYDICWSPDDRY---IVAASMDNSIRIFDVDSTK-----------QIFA 177

Query: 151 LSDHVESVCDIAFDPTGLTLYLLSSFNYCDIYAI-----HPCLPKNFSLRSN-DTSNVTS 204
            +DH   V  +++DP    ++ LS+     IY I      P L  N  L++     ++  
Sbjct: 178 TNDHNHYVQGVSWDPLNKYIFSLSADRSLAIYEIIFDPNDPVLITNLKLKNRISKGDLPQ 237

Query: 205 RTKNGSLADYMLHKSLSLYN 224
             +NG+L   ++  S   +N
Sbjct: 238 LDENGTLNHEIVKSSYLFHN 257

>Suva_2.303 Chr2 complement(535706..536839) [1134 bp, 377 aa] {ON}
           YDR142C (REAL)
          Length = 377

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 48/105 (45%), Gaps = 7/105 (6%)

Query: 46  HETQYRSYNVEL-PFVPEQMVISPSGGLVAFHANSELYVMEVNEQSRL--RKHFNTSLGI 102
           H   +  Y V+  PF   ++ ++ +G       N +LY++E+N   ++  R  F T   +
Sbjct: 5   HMQGFSGYGVQYSPFFDNKLAVA-AGSNFGLVGNGKLYILEINRDGKIEERNSFLTQDCL 63

Query: 103 KKLLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSR 147
             + W+   ++    ++   D T+R++D   L+   I +F    R
Sbjct: 64  FDVAWN--ESHENQVLVAQGDGTLRLFDTT-LKEYPIAIFKEHER 105

>NDAI0D02300 Chr4 complement(535895..536707) [813 bp, 270 aa] {ON}
           Anc_5.126 YGR207C
          Length = 270

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 70/163 (42%), Gaps = 41/163 (25%)

Query: 507 VVSELYKETMKRVKLGQMILFRM-----FNKSNEEVAEL--------------------H 541
           +++++ KE +K+  +G +I+ +      FN + + +A L                     
Sbjct: 111 IIAKILKEMVKKEDIGLVIMGKQAIDDDFNNTGQMLAGLLNWPQITNVTKLEFLDATGDQ 170

Query: 542 RQLRKTNEI----EMLRNKLNG----NLGDLQERYSRYEEKSKTLEKRLD--KLKETFSS 591
            ++R   EI    E L  KL G    +LG    RY + +   K  +K ++   LKETF  
Sbjct: 171 LKVRAVREIDGGNETLVMKLPGLITVDLGLNTPRYVKLQNMMKAKKKPIEILDLKETFPQ 230

Query: 592 IENNEKLRTSSISEAELVWFKSIKNQVLKFNNYVHLTNKLREE 634
           ++   KL   ++ E       ++K Q +  N+   L  KL+EE
Sbjct: 231 VDLTSKLELKAVEEP------AVKKQGIILNSVDELITKLKEE 267

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 906

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 75/170 (44%), Gaps = 31/170 (18%)

Query: 404 FENKIRTVSGTFLGVLSTLSGDILYNGNSFKVIESNDKSTTQKP---INRTDEVKYTYKP 460
           FE K+R  S   L   + ++G I+ NG S +   S D+S+T+KP    N T   +     
Sbjct: 128 FEQKLR--SEHELSDDNAMAGYIINNGTSMQKGVSIDESSTEKPRKSTNSTISNQTATSL 185

Query: 461 SLPTSGKELDML--LTKYKTEAN----------GFISGI-------------PDSLAPLP 495
            L  S ++L+ L  + + K + N          G  SGI             PD++ P  
Sbjct: 186 ELGESSRDLESLGAMKQNKKQKNSMGNASNSYLGDSSGIPFAKLMFTAVKFSPDAVEPDQ 245

Query: 496 LKNNSNERQLEVVSELYKETMKRVK-LGQMILFRMFNKSNEEVAELHRQL 544
            + +S + + + VSE +       K   + +LF+ F  SN ++  LHR+ 
Sbjct: 246 EQESSVDTEFDEVSESFDPLYLPTKDEAEGLLFKYFAHSNSQLPVLHREF 295

>Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {ON}
           YDR142C (PEX7) - Member of beta-transducin-related
           (WD-40) protein family [contig 171] FULL
          Length = 367

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 23/105 (21%), Positives = 50/105 (47%), Gaps = 7/105 (6%)

Query: 46  HETQYRSYNVEL-PFVPEQMVISPSGGLVAFHANSELYVMEVNEQSRL--RKHFNTSLGI 102
           H   Y  Y V+  PF   ++ ++ +G       N +L+++++N Q  +   K F T  G+
Sbjct: 5   HMQGYSGYGVQYSPFFDNRLAVA-TGSNFGLVGNGKLFIVDINNQGIMTEAKSFLTQDGL 63

Query: 103 KKLLWHPLATYGLSFVILHDDSTIRIYDLEDLEPESITVFNRKSR 147
             + W+ L  +    ++   D ++R++D + L    I +F+   +
Sbjct: 64  FDVAWNEL--HENQVLVAQGDGSLRLFDTQ-LTDYPIAIFHEHEK 105

>Skud_13.38 Chr13 complement(62064..67025) [4962 bp, 1653 aa] {ON}
           YML103C (REAL)
          Length = 1653

 Score = 32.3 bits (72), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 57/127 (44%), Gaps = 10/127 (7%)

Query: 64  MVISPSGGLVAFHANSELYVMEVNEQS---RLRKHFNTSLGIKKLLWHPLATYGLSFVIL 120
           +++  +  +  F   S LY      QS    L     T++  K  ++HP+  Y  SF++ 
Sbjct: 271 LMLGLNTSIAQFDLQSPLYADSKTFQSVNAALEGDITTNIANKDPIFHPMIHYSWSFILY 330

Query: 121 HDDSTIRIYDLEDLEPESITVFNRKSRSFGLSDHVESVCD-IAFDP---TGLTLYLLSSF 176
           H    + +   E  E   IT F + + S  +   +  + + ++FDP   T +T++L  S 
Sbjct: 331 H---RLSLQSSESFEDPDITRFAQFAESHNVFQELTILSETLSFDPIYTTIITIFLEYSS 387

Query: 177 NYCDIYA 183
           N+  I A
Sbjct: 388 NFIPITA 394

>KLTH0F11484g Chr6 (973231..974205) [975 bp, 324 aa] {ON} weakly
           similar to uniprot|P38270 Saccharomyces cerevisiae
           YBR128C ATG14 Subunit of an autophagy-specific
           phosphatidylinositol 3-kinase complex (with Vps34p
           Vps15p and Vps30p) required for organization of a pre-
           autophagosomal structure ATG14 transcription is
           activated by Gln3p during nitrogen starvation
          Length = 324

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 65/137 (47%), Gaps = 9/137 (6%)

Query: 510 ELYKETMKRVKLGQMI--LFRMFNKSNEEVAEL---HRQLRKTNEIEMLRNKLNGNLGDL 564
           ELY+ T  R +L   +  + R     +E+ +++   H  + +   ++   NK+   L  L
Sbjct: 34  ELYQVTAAREELRAQVDEILRDAMNGDEQPSDVLGKHLAMLRKTHLKRRTNKIRSKLQQL 93

Query: 565 QERYSRYEEKSKTLEKRLDKLKETFS-SIENNEKLRTSSISEAELVWFKSI--KNQVLKF 621
           QE      E+ +TL+ ++++     + S+E +EK+     S+ +L   + +   ++ LKF
Sbjct: 94  QEVVQVKRERVRTLKAQMNQPNPRVAHSVETDEKIAQFRSSQQKLTMLQRVLESSKALKF 153

Query: 622 NNYVHL-TNKLREELEF 637
               HL   + RE  EF
Sbjct: 154 QALAHLFLIRQREHPEF 170

>NCAS0C02660 Chr3 complement(495031..497862) [2832 bp, 943 aa] {ON}
           Anc_8.443 YDL197C
          Length = 943

 Score = 32.0 bits (71), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 69/139 (49%), Gaps = 24/139 (17%)

Query: 553 LRNKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKETFSSIENNEKLRTSSISEAELVWFK 612
           L+ +LN    D++ER   YE    TLEK +D +K  F  IE+N + +  S+S  E  + K
Sbjct: 219 LKQELNTLKNDVKERIDEYE----TLEKSID-IK--FGRIESNAETKDLSVS-IESEYTK 270

Query: 613 SIKNQVLKFNNYVHLTNKLREELEFLDTQLRSTTKGDDFFSELEFSSLQQMLLNDKK--- 669
           S+KN++++ +  +   N +RE  E   T L+       F    E  + +Q+  N ++   
Sbjct: 271 SLKNKIMQLSREL---NHVRESKEHEVTTLK-------FLLVKETKAKEQVTANLRQTEY 320

Query: 670 ---VINSCMNELSASIEDL 685
              V N  MN+ + +I  L
Sbjct: 321 QITVANQYMNQANVTIRGL 339

>KAFR0E04010 Chr5 complement(793445..796162) [2718 bp, 905 aa] {ON}
           Anc_5.414 YDR356W
          Length = 905

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 52/181 (28%), Positives = 88/181 (48%), Gaps = 24/181 (13%)

Query: 520 KLGQMILFRMFNKSNEEVAELHRQLR-------KTNEIEMLRNKLNGNLGDLQERYSRYE 572
           K  Q IL  + NK +EE+ +L R++R       K ++I+ L+NKL     +      R+E
Sbjct: 574 KKSQEILQIIENK-DEEIRKLERKIRDYDQKFSKESDIKDLQNKLKATENEKLTLLERHE 632

Query: 573 EKSKTLEKRLDKLKETFSSIEN-NEKL--RTSSISE--AELVWFK----SIKNQVLKFN- 622
           ++ +     LDKL+E  S +    E L  +++ I E  A L+  +     I+N + K   
Sbjct: 633 KEVEEWRHELDKLQEDASQVVKLKEDLNDKSTKIEELHASLIKHQKENSKIRNDMQKLTA 692

Query: 623 NYVHLTNKLREELEFLDT--QLRSTTKGDDFFSELEFSSLQQ----MLLNDKKVINSCMN 676
            Y  L   + E  + +D   +L+ST + +DF  E + + L++     L N KK + S  N
Sbjct: 693 QYGELRKSMNESQKLIDEYYELKSTRRNEDFKQEEKLNELERNYNSNLQNLKKYVKSLEN 752

Query: 677 E 677
           E
Sbjct: 753 E 753

>TPHA0K00690 Chr11 complement(135928..144285) [8358 bp, 2785 aa] {ON}
            Anc_7.418 YBL088C
          Length = 2785

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 60/153 (39%), Gaps = 38/153 (24%)

Query: 444  TQKPINRTDEVKYTYKPSLPTSGKELDMLLTKYKTEA---------NGFISGIPDSLAPL 494
            + K + RT +    YKP    SG+++   L K+ +E+         N +I  I       
Sbjct: 2072 SNKSVTRTSKDLEDYKPLFSISGEQIKATLVKWSSESSYERADDIFNNYIKDI------- 2124

Query: 495  PLKNNSNERQLEVVSELYKETMKRVKLGQMILFRMFNKSNEEVAELHRQLRKTNEIEMLR 554
                N   R  E+ SE+Y            I    FNK  ++         KTNE + L+
Sbjct: 2125 ----NITIRDNEIRSEIY-----------YIFGEFFNKQVQKFI-------KTNEYDRLK 2162

Query: 555  NKLNGNLGDLQERYSRYEEKSKTLEKRLDKLKE 587
            NK + +  +LQ   + Y  +S    +R D  K 
Sbjct: 2163 NKCSVSYSELQALKTIYSNESLANSERKDAKKH 2195

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,680,192
Number of extensions: 3703564
Number of successful extensions: 18686
Number of sequences better than 10.0: 652
Number of HSP's gapped: 19287
Number of HSP's successfully gapped: 875
Length of query: 687
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 570
Effective length of database: 40,065,477
Effective search space: 22837321890
Effective search space used: 22837321890
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)