Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E21275g5.425ON39238118150.0
KLTH0F16280g5.425ON4732823591e-37
Ecym_55245.425ON4152793543e-37
AER251W5.425ON4072543062e-30
SAKL0G02266g5.425ON4842772906e-28
Kwal_55.214685.425ON4652762872e-27
TBLA0A037105.425ON4612492852e-27
ZYRO0F09812g5.425ON4162492772e-26
KAFR0E038705.425ON3962762744e-26
CAGL0A02706g5.425ON3692772709e-26
YDR363W (ESC2)5.425ON4563092731e-25
NCAS0F033105.425ON4423092684e-25
Smik_4.6285.425ON4583102675e-25
Suva_2.5345.425ON4523082642e-24
NDAI0B056005.425ON4572712492e-22
Skud_4.6315.425ON4583032447e-22
TPHA0E018105.425ON4533122313e-20
KNAG0C049805.425ON3452742231e-19
TDEL0E020005.425ON4362612162e-18
Kpol_1027.265.425ON4432702031e-16
Ecym_41778.390ON73571713.0
Skud_8.585.592ON52355679.2
YBR060C (ORC2)3.274ON620105679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E21275g
         (392 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]...   703   0.0  
KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]...   142   1e-37
Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar...   140   3e-37
AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic ...   122   2e-30
SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some s...   116   6e-28
Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {...   115   2e-27
TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.4...   114   2e-27
ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly...   111   2e-26
KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.4...   110   4e-26
CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} simila...   108   9e-26
YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}  ESC2Sumo...   109   1e-25
NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.4...   107   4e-25
Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363...   107   5e-25
Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W ...   106   2e-24
NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON} Anc_5...   100   2e-22
Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...    99   7e-22
TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {O...    94   3e-20
KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {O...    91   1e-19
TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {O...    88   2e-18
Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {O...    83   1e-16
Ecym_4177 Chr4 (372606..374813) [2208 bp, 735 aa] {ON} similar t...    32   3.0  
Skud_8.58 Chr8 complement(106099..107670) [1572 bp, 523 aa] {ON}...    30   9.2  
YBR060C Chr2 complement(360652..362514) [1863 bp, 620 aa] {ON}  ...    30   9.8  

>KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 392

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/381 (93%), Positives = 355/381 (93%)

Query: 12  NQNITDEENEIEKEVDISIHASNLPSLETLKNDRKRPHKNGISLALESEEPAKKLTRQXX 71
           NQNITDEENEIEKEVDISIHASNLPSLETLKNDRKRPHKNGISLALESEEPAKKLTRQ  
Sbjct: 12  NQNITDEENEIEKEVDISIHASNLPSLETLKNDRKRPHKNGISLALESEEPAKKLTRQSG 71

Query: 72  XXXXXXXXXXXXXAESSYENSVISESDDSIHSELERFKEDQTPSINTQDEMFDFLKEVTS 131
                        AESSYENSVISESDDSIHSELERFKEDQTPSINTQDEMFDFLKEVTS
Sbjct: 72  SSKSSDKNDISDDAESSYENSVISESDDSIHSELERFKEDQTPSINTQDEMFDFLKEVTS 131

Query: 132 NAKNHADTHNNGKVTKRIYNINFISTLEGSQDKRVNVKVTGNKTFESILPITIRTFIQSY 191
           NAKNHADTHNNGKVTKRIYNINFISTLEGSQDKRVNVKVTGNKTFESILPITIRTFIQSY
Sbjct: 132 NAKNHADTHNNGKVTKRIYNINFISTLEGSQDKRVNVKVTGNKTFESILPITIRTFIQSY 191

Query: 192 KIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVHSADANNYK 251
           KIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVHSADANNYK
Sbjct: 192 KIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVHSADANNYK 251

Query: 252 TEYKRIRESRLQSFLDESNIEEQDPLEQPARDXXXXXXXXXXXSAPKLAERTDDVIDLLD 311
           TEYKRIRESRLQSFLDESNIEEQDPLEQPARD           SAPKLAERTDDVIDLLD
Sbjct: 252 TEYKRIRESRLQSFLDESNIEEQDPLEQPARDEKFKLFEKELESAPKLAERTDDVIDLLD 311

Query: 312 SDIESSNSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELN 371
           SDIESSNSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELN
Sbjct: 312 SDIESSNSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELN 371

Query: 372 PAATVLSEGLEEDDILEIKIS 392
           PAATVLSEGLEEDDILEIKIS
Sbjct: 372 PAATVLSEGLEEDDILEIKIS 392

>KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 473

 Score =  142 bits (359), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 146/282 (51%), Gaps = 25/282 (8%)

Query: 119 QDEMFDFLKEVTSNAKNHADT--HNNGKVTKRIYNINFISTLEGSQDKRVNVKVTGNKTF 176
           +DE   F +E+   A   A T   ++  V +RIYNI FIS LEGS  +R+NVKV G ++F
Sbjct: 205 KDEDDKFFEELEREASRTASTVKESSPAVAQRIYNIKFISDLEGSAGRRINVKVKGKQSF 264

Query: 177 ESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSLRIPKTVSEYETT 236
           + ILP+ ++T I+ YKIP  L   Y   ++ L+R GV++L F NC+SL+IP       + 
Sbjct: 265 DQILPVALKTIIKEYKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVSD 324

Query: 237 VDLVIVHSADANNYKTEYKRIRESR---LQSFLDESNIEEQD----PLEQPARDXXXXXX 289
           V L I+      N++  Y++ + S    + +F+ E   E  D      E+  R+      
Sbjct: 325 VCLTIISKGQEQNFEALYEQSKHSNHELVPAFI-EPGTETPDFTVEEYEKELRNVDFNKN 383

Query: 290 XXXXXSAPKLAERTDDVIDLLDSDIESSNSIRLTLIDKANKRTSISVWPNTTFTEIANRY 349
                  P   +  DD             +IR+ L+ + NK+  ++  P TTF  +A  Y
Sbjct: 384 TSVQNQPP--PQSVDD-------------NIRIALMSQDNKKIIVTARPETTFAALAEHY 428

Query: 350 KTISSLSEDANVLLIFDNEELNPAATVLSEGLEEDDILEIKI 391
           + ++SL     VLL FDNEEL+  + V    +E+DDI+E+ I
Sbjct: 429 QKLTSLPPQQQVLLFFDNEELHLDSKVSDADVEDDDIVEVVI 470

>Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar to
           Ashbya gossypii AER251W
          Length = 415

 Score =  140 bits (354), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 81/279 (29%), Positives = 149/279 (53%), Gaps = 12/279 (4%)

Query: 125 FLKEVTSNAKNHADTHNNG----------KVTKRIYNINFISTLEGSQDKRVNVKVTGNK 174
           FL E+   A+  +  HNNG          ++   IYN+ FIS LEGS +KR+NV++TG K
Sbjct: 136 FLAEIEQEAERASSLHNNGSLKNGSSNNKEIGTNIYNVGFISKLEGSTNKRINVRITGKK 195

Query: 175 TFESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSLRIPKTVSEYE 234
            F + LPI ++TF++ YKI   L   Y    + ++R GVE+  F  CDS  I +  +   
Sbjct: 196 KFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYREGVEIFKFMTCDSFNIAEAYASSS 255

Query: 235 TTVDLVIVHSADANNYKTEYKRIRESRLQSF-LDESNIE-EQDPLEQPARDXXXXXXXXX 292
             +++ IV +  A+ ++ ++K+  E++++   +  S ++ + D +E    D         
Sbjct: 256 IDIEVYIVPNELASEFEIQWKQKIETKMKRVSISASPVDLDSDGIEFGNDDFRVNEYEKD 315

Query: 293 XXSAPKLAERTDDVIDLLDSDIESSNSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTI 352
             +A  L E      + +    + +  I++ L+   NK+  ++V P TTF ++A  Y+ I
Sbjct: 316 LANARSLDETEIQYSNQISKPDDGNELIKVVLLGSDNKKVYVNVKPTTTFEKLAEHYRRI 375

Query: 353 SSLSEDANVLLIFDNEELNPAATVLSEGLEEDDILEIKI 391
             L     ++L FD+++++P+ T+ S  +E+DDI+E+ +
Sbjct: 376 KKLPPTTKLILSFDHDDIDPSNTIFSAAIEDDDIVEVSV 414

>AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR363W (ESC2)
          Length = 407

 Score =  122 bits (306), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 81/254 (31%), Positives = 135/254 (53%), Gaps = 2/254 (0%)

Query: 139 THNNGKVT-KRIYNINFISTLEGSQDKRVNVKVTGNKTFESILPITIRTFIQSYKIPRRL 197
           T   G+ T  R+YN+ FIS +EGS+++RVNVKVTG K F + L I +  F + + I + L
Sbjct: 154 TGKGGRDTDARVYNVGFISRIEGSRNRRVNVKVTGQKQFATFLAIALAAFSKQHNIRKSL 213

Query: 198 RIFYTPAELVLFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVHSADANNYKTEYKRI 257
           +  Y   ++ ++R GVEV  F  CDS  I +  +   T +++ IV   +A  ++ E+KR 
Sbjct: 214 KPKYQADQVKIYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVDEATAFEQEWKRK 273

Query: 258 RESRLQSFLDESNIEEQDPLEQPARDXXXXXXXXXXXSAPKLAERTDDVIDLLDSDIESS 317
            E R++   + S +E  D +E    D           +A  L E    V +   +D ESS
Sbjct: 274 FEERVRMLSNSSFLEVMDDIEDDNDDFLVNEYEKALVNARSLNETELAVREGTPAD-ESS 332

Query: 318 NSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELNPAATVL 377
             +++ L+   NK+  I V P TT  ++A  Y+    L     + L+FD+EE++   T+ 
Sbjct: 333 QLLKIVLLGSDNKKVFIHVRPTTTLLKVAEHYRVAKELPPTVQLSLMFDHEEIDLDDTIC 392

Query: 378 SEGLEEDDILEIKI 391
           +  +E+ DI+E+ +
Sbjct: 393 NIDIEDGDIIEVVV 406

>SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some
           similarities with uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 484

 Score =  116 bits (290), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 80/277 (28%), Positives = 143/277 (51%), Gaps = 17/277 (6%)

Query: 119 QDEMFDFLKEVTSNAKNHADT---HNNGKVTKRIYNINFISTLEGSQDKRVNVKVTGNKT 175
           +D+   F  E+T NA N   T    ++ ++ KR Y I+FIS L+GS DK++ VK  G   
Sbjct: 220 EDDTDAFFTEITRNA-NRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSP 278

Query: 176 FESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSLRIPKTVSEYET 235
           F  ILP T+   +++Y+IP+ ++  Y    + L+  G ++L F  C+SLRIP+   +  T
Sbjct: 279 FTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEIT 338

Query: 236 TVDLVIVHSADANNYKTEYKRIRESRLQ-SFLDESNIEEQDPLEQPARDXXXXXXXXXXX 294
            VD+ +V       Y+ E+K + E+ L  S +D  N+++ D     A +           
Sbjct: 339 DVDITLVSKEYEMKYEAEFKEMVENELSGSSVDVKNVKKDD----FATNEYELQLEKSES 394

Query: 295 SAPKLAERTDDVIDLLDSDIESSNSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTISS 354
           + P L + ++++ D         + I+L L+ + NK+  +    +T F +IA+ YK + +
Sbjct: 395 AEPSLLKSSENIRD--------GSFIKLALVGQDNKKMFVKARSSTLFKKIADYYKDVKN 446

Query: 355 LSEDANVLLIFDNEELNPAATVLSEGLEEDDILEIKI 391
           L     + L FD+  L+    V    +E++D++E+ I
Sbjct: 447 LPSFTKLKLTFDHVNLSLEDRVEDHEMEDEDMIEVAI 483

>Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {ON}
           YDR363W (ESC2) - establishes silent chromatin [contig
           130] FULL
          Length = 465

 Score =  115 bits (287), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/276 (28%), Positives = 135/276 (48%), Gaps = 30/276 (10%)

Query: 125 FLKEVTSNAKNHADTHNNGK--VTKRIYNINFISTLEGSQDKRVNVKVTGNKTFESILPI 182
           F +E+   A     T   G     KR+YNI F+S LEGS + ++NVKV G   F  ILPI
Sbjct: 206 FFEELQREAGRTTSTLKEGSPATAKRVYNIKFLSNLEGSLNDKINVKVKGKHAFSEILPI 265

Query: 183 TIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIV 242
            ++T I+ YK+ + L+ FY P  + L+R G+++L F NC+SL IP       + V + +V
Sbjct: 266 ALKTLIKEYKVSKDLKPFYQPENVSLYRNGLKILNFMNCNSLHIPLNYEGEVSDVSMTLV 325

Query: 243 HSADANNYKTEYKRIRESRLQSFLDESNIEEQDP------LEQPARDXXXXXXXXXXXSA 296
               + + + EY +  E    +  D S  EE  P      +E+  +D             
Sbjct: 326 ----SRDREQEYVKTLEQSRHATPDLSR-EETSPKIPGFSIEEFEKDLE----------- 369

Query: 297 PKLAERTDDVIDLLDSDIESSN---SIRLTLIDKANKRTSISVWPNTTFTEIANRYKTIS 353
                 + +  +LL+   ++ N   +I++ L+ + NK+  ++V   TT   +   Y+T  
Sbjct: 370 ---GFESGESNNLLEDTPQTENNHGTIKIALMAQDNKKIYVNVRQTTTIAMLGEHYRTTK 426

Query: 354 SLSEDANVLLIFDNEELNPAATVLSEGLEEDDILEI 389
           +LS       +FDNE+L  +  +    +E+ DI+E+
Sbjct: 427 NLSSIERFKFVFDNEDLQLSTKIDDLDMEDGDIIEV 462

>TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.425
           YDR363W
          Length = 461

 Score =  114 bits (285), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 74/249 (29%), Positives = 135/249 (54%), Gaps = 11/249 (4%)

Query: 147 KRIYNINFISTLEGSQDKRVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAEL 206
           KRIYN+ FIS +EG+ DK+V VKV G   F  ILP  ++ F + YKIP  L+ +Y    +
Sbjct: 215 KRIYNVRFISKIEGTLDKKVQVKVLGKFPFSKILPPALKAFSEEYKIPNVLKQYYRVNNV 274

Query: 207 VLFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVHSADANNYKTEYKR-IRESRLQSF 265
            L+    ++L F  C+SL IP+      + V+++++   +  +Y+ +    ++++  Q+ 
Sbjct: 275 TLYWNDSKLLNFMTCNSLNIPQIYENEISDVEIIVITKTNEKSYEDKINMSLKQNIEQNL 334

Query: 266 LDESN-IEEQDPLEQPARDXXXXXXXXXXXSAPKLAERTDDVIDLLDS----DIESSNSI 320
             +SN I+E   L+  + +              +L E + D +D   +    DI + + I
Sbjct: 335 AQKSNEIKELRKLKVESFEHNSIQEFEK-----ELKELSQDGVDTKQTANIDDIPNESHI 389

Query: 321 RLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELNPAATVLSEG 380
           ++ L+ + NK+  + V  +T F+E+ N ++    L E   + LIFDNEEL+   TV  + 
Sbjct: 390 KIALLTQDNKKLYVKVRNSTPFSELVNYFREQKQLGETQQIKLIFDNEELDLNETVGDQD 449

Query: 381 LEEDDILEI 389
           +E++D++E+
Sbjct: 450 MEDEDMIEV 458

>ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly
           similar to uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 416

 Score =  111 bits (277), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/249 (29%), Positives = 132/249 (53%), Gaps = 20/249 (8%)

Query: 147 KRIYNINFISTLEGSQDKRVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAEL 206
           +RIYN+ F+S L+GS DK V +KV G   F S+LP  +  FI+ YKIP  ++  Y+   +
Sbjct: 179 RRIYNVRFLSKLDGSIDKAVQIKVLGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENV 238

Query: 207 VLFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVHSADANNYKTEYKRIRESRLQSFL 266
            L+    ++L F  C+SL+IP+      + +D+ ++     N    E++++  SRL    
Sbjct: 239 TLYWKTAKLLNFMTCNSLKIPQAFENEISDIDITVIPKEKEN----EFEQMINSRLLE-- 292

Query: 267 DESNIEEQDPLEQP------ARDXXXXXXXXXXXSAPKLAERTDDVIDLLDSDIESSNSI 320
                +EQ+P +        AR            ++    E T ++IDL D     ++ +
Sbjct: 293 -----DEQNPPDTAETGNLDARVEEFEKELKNVDNSTTNHETT-ELIDLEDEG--DTDLM 344

Query: 321 RLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELNPAATVLSEG 380
           ++ L+ + NK+  ++V   T  T++A  Y+    L +D N+ LIFD+EELN   ++  + 
Sbjct: 345 KIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQD 404

Query: 381 LEEDDILEI 389
           +E++D++E+
Sbjct: 405 MEDEDMIEV 413

>KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.425
           YDR363W
          Length = 396

 Score =  110 bits (274), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 81/276 (29%), Positives = 145/276 (52%), Gaps = 14/276 (5%)

Query: 120 DEMFDFLKEVTSNA--KNHADTHNNGKVTKRIYNINFISTLEGSQDKRVNVKVTGNKTFE 177
           DE  DF KE+ + A  K+   T +  K  KRIYNI FIS L+GS +K V VKV G   F 
Sbjct: 130 DENDDFFKELATVAQKKSVTGTESAAKRPKRIYNIRFISKLDGSINKSVKVKVLGKFPFS 189

Query: 178 SILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSLRIPKTVSEYETTV 237
            ILP  ++  I +YKIP  +   Y    + L+    ++L F  CDSL IP       + V
Sbjct: 190 KILPAALKGLIDAYKIPSIMSEIYDVENVGLYWNNAKLLNFMTCDSLSIPLAFENEISNV 249

Query: 238 DLVIVHSADANNYKTEYKRIRESRLQSFLDESNIEEQDPLEQPARDXXXXXXXXXXXSAP 297
           D++IV    +  +  + +++   ++++  +E+ +E Q+ +    +D              
Sbjct: 250 DILIV----SKEFGEKLEKL--DQMKTLQEEAKLERQEEI----KDVDEGDDFVLKEFEA 299

Query: 298 KLAERTDDVIDL-LDSDIESSNSI-RLTLIDKANKRTSISVWPNTTFTEIANRYKTISSL 355
           +L +      +L LD+D E S  + +L L+ + NK+  ++V  +T  +++   YK   +L
Sbjct: 300 ELRDVAPSNANLSLDTDGEDSEPLMKLALMGQDNKKIYVNVRSSTQISKLVEYYKKQKNL 359

Query: 356 SEDANVLLIFDNEELNPAATVLSEGLEEDDILEIKI 391
           + +  V L+FD++EL+   TV  + +E++D++++ +
Sbjct: 360 ARNVKVKLLFDHDELDLNETVGDQDMEDEDMIDVVV 395

>CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q06340 Saccharomyces cerevisiae YDR363w ESC2
          Length = 369

 Score =  108 bits (270), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 131/277 (47%), Gaps = 43/277 (15%)

Query: 125 FLKEVTSNAKNHADTHNNGKVTK-RIYNINFISTLEGSQDKRVNVKVTGNKTFESILPIT 183
           F + +   +++      +G V + ++Y + FIS ++G++ K V VK  G+  F  ++   
Sbjct: 127 FFQSIAKRSQSLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPFSKLVAAA 186

Query: 184 IRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVH 243
           +   ++++++P  +R  Y P  +V +    +VL F  CD+LR+P+               
Sbjct: 187 LSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQ--------------- 231

Query: 244 SADANNYKTEYKRIRESRLQSFLDESNIEEQDPLEQPARDXXXXXXXXXXXSAPKLAERT 303
                 Y ++Y  I+   L    +E+   EQ+  E+P R              P+     
Sbjct: 232 -----RYGSDYLEIQ---LVPVKEEAQYLEQEVFEEPER-----------APTPEEDAEE 272

Query: 304 DDVIDLLDS--------DIESSNSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSL 355
           +   +L D+        D+ES   +R+ L  + NK+  ++V P TTF  +   Y+T   L
Sbjct: 273 EFERELRDAKEVRAPVVDLESEEVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQL 332

Query: 356 SEDANVLLIFDNEELNPAATVLSEGLEEDDILEIKIS 392
                + L  D+E L+P ATV S+ +E++D+LE+++S
Sbjct: 333 PRSTQITLALDDEPLDPHATVKSQDIEDEDMLEVRLS 369

>YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}
           ESC2Sumo-like domain protein; prevents accumulation of
           toxic intermediates during replication-associated
           recombinational repair; roles in silencing, lifespan,
           chromatid cohesion and the intra-S-phase DNA damage
           checkpoint; RENi family member
          Length = 456

 Score =  109 bits (273), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 85/309 (27%), Positives = 148/309 (47%), Gaps = 32/309 (10%)

Query: 107 RFKEDQTPSINTQDEMFDFLKEVTSNAKNHA--DTHNNGKVTKRIYNINFISTLEGSQDK 164
           ++K  ++  + T DE  DF KE+   AK        +     KR+YNI F+S LEG+ +K
Sbjct: 155 KYKRQKSSLLYTYDENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINK 214

Query: 165 RVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSL 224
            V VKV G   F  ILP  +   ++SYKIP+ ++  Y    + L+    ++L F  C+SL
Sbjct: 215 AVQVKVLGKYEFSKILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSL 274

Query: 225 RIPKTVSEYETTVDLVIVHSADANNYKTEYKRIRESRLQSFLDESN----IEEQDPLE-- 278
            IP+      + +D+ IV          EY++  E+ L+S L E      I+E+  +E  
Sbjct: 275 HIPQDFENEVSDIDVTIVSK--------EYEKNFEATLESKLKEEEAALLIKERQEMERK 326

Query: 279 -QPARDXXXXXXXXXXXSAPKLAERTDDVID--------LLDSDIESSNS-------IRL 322
            +  R+           S  K  E T ++ +        LL      S +       +R+
Sbjct: 327 LEKKRNEQEESEYREFESELKNVEETQEIKENDTVMNTKLLQEGGSLSGNSSSMEEVMRI 386

Query: 323 TLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELNPAATVLSEGLE 382
            L+ + NK+  + V  +T F++IA  Y+    L +   V L+FD++EL+    +  + +E
Sbjct: 387 ALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQLPQKTRVKLLFDHDELDMNECIADQDME 446

Query: 383 EDDILEIKI 391
           ++D++++ I
Sbjct: 447 DEDMVDVII 455

>NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.425
           YDR363W
          Length = 442

 Score =  107 bits (268), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 89/309 (28%), Positives = 150/309 (48%), Gaps = 23/309 (7%)

Query: 106 ERFKEDQTPSINTQ-DEMFDFLKEVTSNAK------NHADTHNNGKVTKRIYNINFISTL 158
           +R K   TP ++   DE  +F KE+   AK      + +      K  KR+Y+I F+S L
Sbjct: 133 KRQKSTSTPILSLGPDENDEFFKEIAKEAKKLPSITDRSKEATPDKQPKRVYSIRFLSQL 192

Query: 159 EGSQDKRVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPF 218
           +G+ +K V VKV G   F  ILP T+   I+SY IP  L+ FY    + L+    ++L F
Sbjct: 193 DGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNF 252

Query: 219 SNCDSLRIPKTVSEYETTVDLVIVHSADANNYKTEYKR---IRESRLQSFLD-ESNIEEQ 274
             C+SL IP+      T VD+VI+        + E ++   + E   Q  LD E   E++
Sbjct: 253 MTCNSLNIPQAFENEVTNVDIVIMSKEKEIENENELRKKLLLEEKAAQMKLDLEKEREKE 312

Query: 275 DPLEQPARDXXXXXXXXXXXSAPKLAERT------------DDVIDLLDSDIESSNSIRL 322
               +P                 +L + T            D  +++  SD E S+ +++
Sbjct: 313 GEKNKPKESKNTEYAKAIAEFEKELKDATELKDSQVHGGENDGNMNIDGSDNEKSSIMKI 372

Query: 323 TLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELNPAATVLSEGLE 382
            L+   NK+  ++V  +T F+++A  Y+    L + A + L+FD++ELN   TV  + +E
Sbjct: 373 ALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDME 432

Query: 383 EDDILEIKI 391
           ++D++E+ I
Sbjct: 433 DEDMIEVVI 441

>Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  107 bits (267), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 152/310 (49%), Gaps = 32/310 (10%)

Query: 107 RFKEDQTPSINTQDEMFDFLKEVTSNAKNHADTHNNG--KVTKRIYNINFISTLEGSQDK 164
           ++K  ++  +   DE  DF KE+   AK              KR+YNI F+S LEG+ +K
Sbjct: 157 KYKRQKSSLLYAYDENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINK 216

Query: 165 RVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSL 224
            V VKV G   F  ILP  +    +SYKIP+ ++  Y    + L+    ++L F  C+SL
Sbjct: 217 AVQVKVLGKYEFSRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSL 276

Query: 225 RIPKTVSEYETTVDLVIVHSADANNYKTEYKRIRESRLQSFLDESN----IEEQDPLEQP 280
            IP+      + +D+ IV          EY++  E+ L+S L E      ++E + +E+ 
Sbjct: 277 HIPQDFENEVSDIDVTIVSK--------EYEKNFEASLESKLKEEEAALLVKEHEEIERK 328

Query: 281 -------ARDXXXXXXXXXXXSAPKLAERTDD--VI---------DLLDSDIESSNSIRL 322
                    +           +  +  ERT++  VI         +LL+++ +S   +++
Sbjct: 329 LERKRNEQEESEYREFEFELRNVKEKQERTENETVINIKNLQEDDNLLENNSDSEKVMKI 388

Query: 323 TLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELNPAATVLSEGLE 382
            L  + NK+  ++V  +T F+++A  Y+    L + A + L+FD+++L+    +  + +E
Sbjct: 389 ALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDMHECIADQDME 448

Query: 383 EDDILEIKIS 392
           ++D++++ I+
Sbjct: 449 DEDMIDVIIN 458

>Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W
           (REAL)
          Length = 452

 Score =  106 bits (264), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/308 (25%), Positives = 140/308 (45%), Gaps = 32/308 (10%)

Query: 106 ERFKEDQTPSINTQDEMFDFLKEVTSNAKNHADTHNNGK--VTKRIYNINFISTLEGSQD 163
           +++K  +   +NT DE  DF KE+   AK              KR+YNI F S LEG+ +
Sbjct: 150 QKYKRQKNSLLNTYDENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTIN 209

Query: 164 KRVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDS 223
           K V VKV G   F  ILP  +   ++SYKIP+ ++  Y    + L+    ++L F  C+S
Sbjct: 210 KAVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNS 269

Query: 224 LRIPKTVSEYETTVDLVIVHSADANNYKTEYKRIRESRLQSFLDESNI----EEQDPLEQ 279
           L IP+      + +D+ IV          EY++  E+ L+S L E       +E+  +E 
Sbjct: 270 LHIPQDFENEISDIDITIVSK--------EYEKNFEATLESKLKEEETALFAKERQEMEM 321

Query: 280 PARDXXXXXXXXXXXSAPKLAERTDDVIDLL-------DSDIESSNSI-----------R 321
                                   ++  +L        +  +   NS+           +
Sbjct: 322 KLEKKRNEREESEFREFEFELRNVEETEELKANETFMNEHSLREGNSVKENNGGNEKVMK 381

Query: 322 LTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELNPAATVLSEGL 381
           + L+ + NK+  ++V  +T F ++A  Y+    L + A + L+FD++ELN    +  + +
Sbjct: 382 IALMGQDNKKIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNECIADQDM 441

Query: 382 EEDDILEI 389
           E++D++++
Sbjct: 442 EDEDMVDV 449

>NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON}
           Anc_5.425 YDR363W
          Length = 457

 Score =  100 bits (249), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 127/271 (46%), Gaps = 20/271 (7%)

Query: 120 DEMFDFLKEVTSNAKNHADTHNNG---KVTKRIYNINFISTLEGSQDKRVNVKVTGNKTF 176
           DE  +F KE+   AK            K+ KRIYNI FIS L+G+ +K V VKV G   F
Sbjct: 165 DENDEFFKEIAKEAKKIPSLTKESTPDKLPKRIYNIRFISKLDGTMNKCVQVKVLGKFQF 224

Query: 177 ESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSLRIPKTVSEYETT 236
           + ILP  +   I++Y IP  L+ +Y+   + L+    ++L F  C+SL IP+      T 
Sbjct: 225 QKILPAALTGLIKAYSIPSVLQKYYSVDNVSLYWNHAKLLDFMTCNSLNIPQAFENEVTN 284

Query: 237 VDLVIVHSAD--ANNYKTEYKRIRESR-----LQSFLDESNIEEQDPLEQPARDXXXXXX 289
           VD+ ++   D   N      K +++ R     L++   E  I+E+   E    +      
Sbjct: 285 VDIELISKDDEIENEKAITEKLLKDEREVSLKLEAAKKEKEIQEKLAKELAKEEKENEVF 344

Query: 290 XXXXXSAPKLAERTDDVIDLLDSDIESSNSI----------RLTLIDKANKRTSISVWPN 339
                    ++E   +  D   S +  +N +          ++ L+ + NK+  ++V   
Sbjct: 345 EEFEHELENVSELKTNGYDADASTVNEANELALEEGNADVMKIALVGQDNKKIHVNVRGT 404

Query: 340 TTFTEIANRYKTISSLSEDANVLLIFDNEEL 370
           T F+++A  Y+    L ++A + L+FD+EEL
Sbjct: 405 TPFSKVAEYYRIQKQLPQNAKIKLVFDHEEL 435

>Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score = 98.6 bits (244), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 77/303 (25%), Positives = 144/303 (47%), Gaps = 24/303 (7%)

Query: 107 RFKEDQTPSINTQDEMFDFLKEVTSNAKNHADTHN--NGKVTKRIYNINFISTLEGSQDK 164
           + K  +   ++  DE  DF KE+   AK           +  KR+YNI F+S LEG+ +K
Sbjct: 157 KHKRQKCSLVDIYDENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINK 216

Query: 165 RVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSL 224
            V VKV G   F  ILP  +   ++SYKIP+ +   Y    + L+    ++L F  C+SL
Sbjct: 217 AVQVKVLGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSL 276

Query: 225 RIPKTVSEYETTVDLVIVHSADANNYKTEYKRIRESRLQ----SFLDESNIEEQDPLEQP 280
            I +      + +D+ IV    +  Y+  ++   ES+L+    + L +   E +  LE+ 
Sbjct: 277 NISQDFENEISDIDVTIV----SKEYEKNFEATLESKLKEDEAALLVKQRQEIERKLEKK 332

Query: 281 ARDXXXXXXXX---XXXSAPKLAERTDDVIDLLDSDIESSNS-----------IRLTLID 326
             +              +  +  E  ++ I +    ++ +NS           I+L L+ 
Sbjct: 333 RNEQEESEYREFEFELRNVKETQELEENEIIINTKPLQGNNSLKGNNGDTEKVIKLALMG 392

Query: 327 KANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELNPAATVLSEGLEEDDI 386
           + NK+  ++V  +T   ++A  Y+    L + A + L+FD++ELN +  V  + +E++D+
Sbjct: 393 QDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDM 452

Query: 387 LEI 389
           +++
Sbjct: 453 IDV 455

>TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {ON}
           Anc_5.425 YDR363W
          Length = 453

 Score = 93.6 bits (231), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 158/312 (50%), Gaps = 32/312 (10%)

Query: 109 KEDQTPSINTQDEMFDFLKEVTSNAKNHADTHNNG--KVTKRIYNINFISTLEGSQDKRV 166
           +E +   I+  DE F  ++E    +K  +   N+G  ++  R YNI +IS L GS+++R+
Sbjct: 144 REIRPSGIDADDEFFKAIREA---SKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRI 200

Query: 167 NVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSLRI 226
             KV G +TF  +LP  + T ++  KIP +LR  Y    + L+    ++L F NCDSL+I
Sbjct: 201 QAKVLGTQTFAKVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKI 260

Query: 227 PKTVSEYETTVDLVIVHSADANNYKT-------EYKRIRESRLQSF---------LDESN 270
           P+T     + ++++++   +   ++        E +++ +  +++F         L+ S 
Sbjct: 261 PQTYQNEISELEIILISKEEEQKFEEQFKMQLLEDEQLSQKNIENFNDSNKPFDILNTSY 320

Query: 271 IEEQDPLEQPARDXXXXXXXXXXXSAPKLAE---RTDDVIDLLD-SDIES-------SNS 319
            E +  LE                S  + +    + +D ++L++ SD ES       SN 
Sbjct: 321 NEYEKELENWNSKDFNVTNDVLDVSNDENSSNNVKGNDSMNLIEISDNESSIKEHGTSNV 380

Query: 320 IRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELNPAATVLSE 379
           I+++L+   NK+  ++V  +T   ++ + +K   +L+ +  + +IFD++ L+  + +   
Sbjct: 381 IKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMIGDN 440

Query: 380 GLEEDDILEIKI 391
            +E++DI+E+ I
Sbjct: 441 DIEDEDIVEMII 452

>KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {ON}
           Anc_5.425 YDR363W
          Length = 345

 Score = 90.5 bits (223), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 118/274 (43%), Gaps = 34/274 (12%)

Query: 119 QDEMFDFLKEVTSNAKNHADTHNNGKVTKRIYNINFISTLEGSQDKRVNVKVTGNKTFES 178
           +++ F  L    + +   A+T     V   +Y + F S LEG+  K V VKV G +   +
Sbjct: 101 EEQFFQELLRARTQSVEPAETATTSTVPSPVYRVRFQSQLEGTLGKSVQVKVIGTRPLGT 160

Query: 179 ILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSLRIPKTVSEYET--- 235
           +LP  +   +++ ++P+ L+  YT   + ++R G  VLPF NC+SL +   V E+E    
Sbjct: 161 VLPSVLSALVRACRVPQVLQGGYTEGAVGMYRGGARVLPFMNCNSLGV---VQEFENEVL 217

Query: 236 TVDLVIVHSADANNYKTEYKRIRESRLQSFLDESNIEEQDPLEQPARDXXXXXXXXXXXS 295
            VD+V+     A N +T    +   +  +   E+      P+  PA              
Sbjct: 218 EVDVVL----RALNLETPASDVSGGQEATNGTEAAASVPVPVPAPA----TAASESPGNP 269

Query: 296 APKLAERTDDVIDLLDSDIESSNSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSL 355
           AP L                    +++ L+   N+R  + V   T  + +   Y+    L
Sbjct: 270 APAL--------------------MKIALLSADNRRLYVKVHGGTPCSRLLEYYRMERGL 309

Query: 356 SEDANVLLIFDNEELNPAATVLSEGLEEDDILEI 389
              A + L  D+E+++P   +    LE+ D+LEI
Sbjct: 310 PAGAPLQLRLDDEQVSPETHISELDLEDGDVLEI 343

>TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {ON}
           Anc_5.425 YDR363W
          Length = 436

 Score = 87.8 bits (216), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 127/261 (48%), Gaps = 22/261 (8%)

Query: 144 KVTKRIYNINFISTLEGSQDKRVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTP 203
           K  ++I+N+ F+S LEG+ D+ + +KV G   F SIL   +   ++ +KIP  +   YT 
Sbjct: 185 KARQKIFNLMFLSKLEGTVDRAIQLKVLGKYDFASILESVLERVVEEFKIPYPVMHQYTV 244

Query: 204 AELVLFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVHSADANN---------YKTEY 254
             + L+  G ++L F  CDSL+I    +   T +++ +V  +D             + E 
Sbjct: 245 DNVTLYWNGGKLLKFMTCDSLKISNIDNNEVTEIEVTMVSKSDEERFEEEERARLLRVEK 304

Query: 255 KRIRESRLQSFLD----ESNIEEQDPLEQPARDXXXXXXXXXXXSAPKLAERTDDVIDLL 310
           + + +++L +  +    + N E    +E    D           S  KLA      +DL 
Sbjct: 305 EAMSKAKLPTTFEADPSDDNGEADCSIEIIEMDDSSRESEMKEGS--KLAP-----VDLE 357

Query: 311 DSDIESSNSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEEL 370
           D D      I+L L+ + N R  ++V  +T F+++A  YK    L  +  + L FD+E+L
Sbjct: 358 DED--ELEVIKLALVGQDNARLYVNVRRSTPFSKVAEYYKLHKPLPMEVKLNLYFDHEKL 415

Query: 371 NPAATVLSEGLEEDDILEIKI 391
           +   TV  + LE++D+LE+ I
Sbjct: 416 DLNETVGDQELEDEDMLEVVI 436

>Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {ON}
           complement(53549..54880) [1332 nt, 444 aa]
          Length = 443

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 122/270 (45%), Gaps = 32/270 (11%)

Query: 148 RIYNINFISTLEGSQDKRVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAELV 207
           RIYNI F S L+GS DK++  +V G + F  I+   + ++ + YK+ R  +  Y    + 
Sbjct: 178 RIYNITFTSKLDGSVDKKLQARVLGKQQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVT 237

Query: 208 LFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVHSADANNYKTEYKRIRE-------- 259
           ++    ++LPF  C+SL+IP       + ++L I+   +   ++ + K   E        
Sbjct: 238 VYWDRAKLLPFMTCNSLKIPLEFQSEISHIELTIISKENEQQFEADIKAQLEVDQKENTN 297

Query: 260 ----SRLQSFLDESNIEEQD--------------PLEQPARDXXXXXXXXXXXSAPKLAE 301
                  ++F  ES I+E                P+  P++                  E
Sbjct: 298 KTEVGSSKNFGIESQIDENKKKYEEYENELNESIPISVPSQGTAEDPMHIDGDE-----E 352

Query: 302 RTDDVIDLLDSDIESSNSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANV 361
              D+I    +D++  N ++L L+   NK+  ++    T F ++A  Y     L +   V
Sbjct: 353 NAVDIIGKATTDLQ-QNIVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKV 411

Query: 362 LLIFDNEELNPAATVLSEGLEEDDILEIKI 391
            LIFD+E+++  + V  + +E+DD++E+ I
Sbjct: 412 KLIFDDEQIDLDSMVKDQDVEDDDMIEVVI 441

>Ecym_4177 Chr4 (372606..374813) [2208 bp, 735 aa] {ON} similar to
           Ashbya gossypii AGL124C
          Length = 735

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 41/71 (57%)

Query: 309 LLDSDIESSNSIRLTLIDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNE 368
            LD DI +SN++  TLI+  +  T  S+     +T++++++    + +E  +++++ +N 
Sbjct: 159 FLDKDILASNAVEFTLIESYSVLTKTSIPFKQYYTKLSDKFTNPQNPAELTSIIVVTNNT 218

Query: 369 ELNPAATVLSE 379
            +    T+LS+
Sbjct: 219 GVRALLTILSD 229

>Skud_8.58 Chr8 complement(106099..107670) [1572 bp, 523 aa] {ON}
           YHR009C (REAL)
          Length = 523

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 6/55 (10%)

Query: 12  NQNITDEENEIEKEVDISIHASNLPSLETLKNDRKRPHKNGISLALESEEPAKKL 66
           N++  +EE   E  V     +S++PSL +L N+R + H N +S  L+S  PA++L
Sbjct: 169 NESTGNEEEGSEVHV-----SSSVPSLHSLTNERMKSHTNSVS-ELDSVSPAEQL 217

>YBR060C Chr2 complement(360652..362514) [1863 bp, 620 aa] {ON}
           ORC2Subunit of the origin recognition complex, which
           directs DNA replication by binding to replication
           origins and is also involved in transcriptional
           silencing; interacts with Spp1p and with trimethylated
           histone H3; phosphorylated by Cdc28p
          Length = 620

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 49/105 (46%), Gaps = 24/105 (22%)

Query: 85  AESSYENSVISESDDSIHSELERFKEDQTPSINTQDEMFDF---LKE-VTSNAKNHADTH 140
           A ++YE++V  ++DD+  S      E  TPS  +     DF   LK+ + +N K + D+ 
Sbjct: 146 ATTTYEDNVTPQTDDNFVSNSPEPPEPATPSKKSLTTNHDFTSPLKQIIMNNLKEYKDST 205

Query: 141 NNGKVT-------------KRIYNI-------NFISTLEGSQDKR 165
           + GK+T             K++Y         +F+ T EG  D+R
Sbjct: 206 SPGKLTLSRNFTPTPVPKNKKLYQTSETKSASSFLDTFEGYFDQR 250

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.342 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,729,578
Number of extensions: 1743929
Number of successful extensions: 6358
Number of sequences better than 10.0: 61
Number of HSP's gapped: 6599
Number of HSP's successfully gapped: 63
Length of query: 392
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 280
Effective length of database: 40,638,807
Effective search space: 11378865960
Effective search space used: 11378865960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)