Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E21253g5.426ON1457145777480.0
SAKL0G02354g5.426ON1458145368120.0
KLTH0F16236g5.426ON1460145466500.0
AER252C5.426ON1459145166010.0
Ecym_55255.426ON1459145265970.0
NDAI0C016205.426ON1460145465890.0
TDEL0E019905.426ON1460146065640.0
NCAS0H020405.426ON1460145665550.0
Kpol_1016.95.426ON1460145165280.0
Suva_8.1695.426ON1460146065210.0
ZYRO0F09856g5.426ON1458145865110.0
Smik_15.2945.426ON1460146065070.0
YOR116C (RPO31)5.426ON1460146065060.0
KAFR0D050305.426ON1462145264990.0
Skud_15.2795.426ON1460146064850.0
CAGL0L11660g5.426ON1459145664530.0
TPHA0H017605.426ON1459145464020.0
KNAG0B042405.426ON1455146063640.0
TBLA0A037205.426ON1458145963590.0
Kwal_55.214595.426ON1148114452730.0
KAFR0B010607.314ON1685150218730.0
Ecym_80657.314ON174393314861e-177
ZYRO0F05918g7.314ON174492814821e-177
ADR086C7.314ON174592814771e-176
KNAG0C039707.314ON172192214751e-176
TPHA0A030707.314ON171992514741e-176
KLLA0F05071g7.314ON172093914731e-175
CAGL0I03828g7.314ON171592014701e-175
NCAS0A139007.314ON171692514671e-175
NDAI0A021307.314ON172992314671e-175
Suva_4.1047.314ON173391714631e-174
KLTH0H02046g7.314ON174092814631e-174
YDL140C (RPO21)7.314ON173391814631e-174
TBLA0F021707.314ON172692814611e-174
TDEL0C023207.314ON172793314611e-174
Smik_4.957.314ON171991814601e-174
Kwal_56.244897.314ON172893114601e-174
SAKL0F10472g7.314ON173091914541e-173
Skud_4.1147.314ON172691814541e-173
Kwal_55.21464singletonOFF32030813071e-168
Kpol_162.1singletonON131157612531e-148
CAGL0E05500g7.51ON164397911701e-134
KLLA0F23243g7.51ON165398111521e-131
Kwal_26.69797.51ON165497811511e-131
TDEL0H040007.51ON166597411501e-131
ZYRO0D04532g7.51ON1667110411501e-131
NDAI0H012007.51ON1669100111391e-130
Kpol_1040.37.51ON165697411371e-129
TPHA0H028007.51ON1648105711351e-129
KLTH0D01628g7.51ON165498011321e-129
TBLA0E019307.51ON165997711321e-129
Skud_15.5067.51ON166597711301e-128
YOR341W (RPA190)7.51ON166497711301e-128
KNAG0D049707.51ON167196111271e-128
NCAS0F007307.51ON167490811261e-128
KAFR0K005407.51ON166297411201e-127
Smik_15.5197.51ON166597711161e-126
Suva_8.3917.51ON166597811081e-125
ADR374C7.51ON164097910991e-124
SAKL0B10736g7.51ON165097610981e-124
Kpol_1019.277.314ON3642872055e-16
TPHA0H014405.359ON87555890.13
KLLA0F18128g4.29ON72277791.6
Kwal_27.112328.331ON333640763.8
KLTH0F18568g7.519ON116777739.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E21253g
         (1457 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} hig...  2989   0.0  
SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] ...  2628   0.0  
KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} hig...  2566   0.0  
AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON...  2547   0.0  
Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {...  2545   0.0  
NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5....  2542   0.0  
TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5....  2533   0.0  
NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {...  2529   0.0  
Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON} (19972....  2519   0.0  
Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {O...  2516   0.0  
ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] ...  2512   0.0  
Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] ...  2511   0.0  
YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}...  2510   0.0  
KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {...  2508   0.0  
Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] ...  2502   0.0  
CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} hi...  2490   0.0  
TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {...  2470   0.0  
KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5....  2456   0.0  
TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {...  2454   0.0  
Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR11...  2035   0.0  
KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {...   726   0.0  
Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar ...   577   e-177
ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highl...   575   e-177
ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON} ...   573   e-176
KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {...   572   e-176
TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {...   572   e-176
KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] ...   572   e-175
CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] ...   570   e-175
NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_...   569   e-175
NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {...   569   e-175
Suva_4.104 Chr4 complement(193257..193711,193754..193782,194161....   568   e-174
KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] ...   568   e-174
YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON} ...   568   e-174
TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7....   567   e-174
TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {...   567   e-174
Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON...   566   e-174
Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL...   566   e-174
SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highl...   564   e-173
Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {O...   564   e-173
Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116...   508   e-168
Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON} co...   487   e-148
CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highl...   455   e-134
KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} hig...   448   e-131
Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {...   447   e-131
TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7....   447   e-131
ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highl...   447   e-131
NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {...   443   e-130
Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON...   442   e-129
TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7....   441   e-129
KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] ...   440   e-129
TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7....   440   e-129
Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR34...   439   e-128
YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RN...   439   e-128
KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7....   438   e-128
NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {...   438   e-128
KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] ...   436   e-127
Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR34...   434   e-126
Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W...   431   e-125
ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON...   427   e-124
SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highl...   427   e-124
Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {O...    84   5e-16
TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {O...    39   0.13 
KLLA0F18128g Chr6 (1661367..1663535) [2169 bp, 722 aa] {ON} simi...    35   1.6  
Kwal_27.11232 s27 (697964..707974) [10011 bp, 3336 aa] {ON} YDR1...    34   3.8  
KLTH0F18568g Chr6 (1507739..1511242) [3504 bp, 1167 aa] {ON} som...    33   9.3  

>KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1457

 Score = 2989 bits (7748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1443/1457 (99%), Positives = 1443/1457 (99%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV
Sbjct: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK
Sbjct: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELN              LKIIH
Sbjct: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE
Sbjct: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQG 360
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQG
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQG 360

Query: 361  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVIN 420
            RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVIN
Sbjct: 361  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVIN 420

Query: 421  GPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHR 480
            GPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHR
Sbjct: 421  GPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHR 480

Query: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540
            LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL
Sbjct: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540

Query: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHY 600
            TPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHY
Sbjct: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHY 600

Query: 601  LWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSG 660
            LWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSG
Sbjct: 601  LWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSG 660

Query: 661  VMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGSD 720
            VMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGSD
Sbjct: 661  VMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGSD 720

Query: 721  LKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
            LKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI
Sbjct: 721  LKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780

Query: 781  RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840
            RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP
Sbjct: 781  RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840

Query: 841  QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900
            QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN
Sbjct: 841  QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900

Query: 901  TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAE 960
            TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAE
Sbjct: 901  TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAE 960

Query: 961  TNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASL 1020
            TNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASL
Sbjct: 961  TNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASL 1020

Query: 1021 RGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRAR 1080
            RGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRAR
Sbjct: 1021 RGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRAR 1080

Query: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140
            VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN
Sbjct: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140

Query: 1141 AVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLELTL 1200
            AVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLELTL
Sbjct: 1141 AVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLELTL 1200

Query: 1201 EDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRMQQ 1260
            EDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRMQQ
Sbjct: 1201 EDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRMQQ 1260

Query: 1261 LRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEV 1320
            LRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEV
Sbjct: 1261 LRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEV 1320

Query: 1321 YDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDS 1380
            YDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDS
Sbjct: 1321 YDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDS 1380

Query: 1381 VLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGENDLT 1440
            VLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGENDLT
Sbjct: 1381 VLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGENDLT 1440

Query: 1441 PKPTLFETLCDTVVKAN 1457
            PKPTLFETLCDTVVKAN
Sbjct: 1441 PKPTLFETLCDTVVKAN 1457

>SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2628 bits (6812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1250/1453 (86%), Positives = 1333/1453 (91%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V+DIAPKKIKG+ FSALSA+DIV+QSEVEISTRDLFDL+NGR+ K GGALD +MGV
Sbjct: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSS AEC+TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ VCK C ++LLS++DK
Sbjct: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            R+FL ELRRPG+DNLRRM  LKKILDQCKKQRRC  CG LN              LKIIH
Sbjct: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKKSAPEKE+W+GDWKQVLE+NPELERY+KRCMDDLNPLK LNLFKQ+KP DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS  KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQG 360
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP+M+PG+SG K+KPIRGFCQRLKGKQG
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQG 360

Query: 361  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVIN 420
            RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LTYPEKVTRYNKHKLQQLVIN
Sbjct: 361  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVIN 420

Query: 421  GPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHR 480
            GP +HPGANYLLKKN+DARRNLRYGDR+KLAK LQYGDVVERHIEDGDVVLFNRQPSLHR
Sbjct: 421  GPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHR 480

Query: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540
            LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL
Sbjct: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540

Query: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHY 600
            TPKSGEPIIAATQDFITGSYLISHKDSFFDRA LTQLLSMMSD N+QFD+PPP++MKPHY
Sbjct: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHY 600

Query: 601  LWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSG 660
            LWTGKQVFSLLI+P++KSPV+IN+DAKNKV++PP  K  PNEMS NDGFV+IRGS ILSG
Sbjct: 601  LWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSG 660

Query: 661  VMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGSD 720
            VMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRMAKLCARYLGNRGFSIGI+DVTPG+D
Sbjct: 661  VMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGAD 720

Query: 721  LKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
            LKQKKE  VE AYAKCDELID FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI
Sbjct: 721  LKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780

Query: 781  RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840
            RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP
Sbjct: 781  RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840

Query: 841  QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900
            QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN
Sbjct: 841  QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900

Query: 901  TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAE 960
            TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSW HANN+T      GLLPYQII  
Sbjct: 901  TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIEN 960

Query: 961  TNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASL 1020
            TN IL+PLE KL R+DN+G +L KEDE K EYIDQ DAER+FYQSLR++MTEKA  LA +
Sbjct: 961  TNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKI 1020

Query: 1021 RGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRAR 1080
            R  +GLK L+DEPA EL+  N DE  P  I  A+NQLCKISK LV+ FL IAISKYHRA+
Sbjct: 1021 RKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRAK 1080

Query: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140
            VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN
Sbjct: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140

Query: 1141 AVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLELTL 1200
            AVLVND DERAARVVKGR+EKT+LSDV +Y+QD+Y+DN++F+Q K+D  TIEKLQLELT+
Sbjct: 1141 AVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLELTI 1200

Query: 1201 EDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRMQQ 1260
            EDI VAI +A KLKI T D+SI+G++KINI V  +G   KSIST+ KEP  N VFYRMQ 
Sbjct: 1201 EDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRMQH 1260

Query: 1261 LRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEV 1320
            LRRALP IVVKG  DISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILE+
Sbjct: 1261 LRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEI 1320

Query: 1321 YDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDS 1380
            ++VLGIEAAR+ I+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMRDS
Sbjct: 1321 FNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDS 1380

Query: 1381 VLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGENDLT 1440
            VLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTGSFKVVK T + E DL 
Sbjct: 1381 VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEEDLK 1440

Query: 1441 PKPTLFETLCDTV 1453
            PK TLFE+LC+ V
Sbjct: 1441 PKHTLFESLCNDV 1453

>KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1460

 Score = 2566 bits (6650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1215/1454 (83%), Positives = 1324/1454 (91%), Gaps = 1/1454 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V+DIAPK+IKG+ FSALSA+DIV+QS+VEISTRDLFDL+NGR  K GGALD RMGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSSQAEC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQS+CK C ALLLSEEDK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
             +FL+ELRRPG+DNLRRM ILKK++DQCKKQRRC  CG LN              LKI+H
Sbjct: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKKSAPEK++W+GDWK VL +NPELERYVK+CMDDLNPLK LNLFKQ+ P DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDST KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPG-SSGTKSKPIRGFCQRLKGKQ 359
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP+M+PG S+G K+KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVI 419
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAK+LTYPE VTRYNK KLQQLVI
Sbjct: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420

Query: 420  NGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLH 479
            NGP  HPGANYLLKK+E+ARRNLRYGDR+KLA+ LQYGDVVERH+EDGDVVLFNRQPSLH
Sbjct: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPH 599
            LTPKSGEPIIAATQDFITGSYLISHKDSFF RA+  QLLSMMSD NLQFDIPPPSIMKP+
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600

Query: 600  YLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILS 659
            Y+WTGKQVFSLLI+P+++SPVVINLDAKNKVY+PP  K  PNEMS NDG+V+IRGS ILS
Sbjct: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGS 719
            GVMDKSVLGDGKKHSVFYTILRD+GP EAA AMNRMAKLCAR+LGNRGFSIGINDVTPG 
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF 720

Query: 720  DLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
            +LK KKE MVE AYAKCD LIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 721  ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839
            I+ELDNLN+ LIMA CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840

Query: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIA 959
            NT+RTSSNGIVQFTYGGDGLDP+DMEGNAQPVNF+RSW HANN+T N     LLPYQI+ 
Sbjct: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQ 960

Query: 960  ETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLAS 1019
            +TN +L+PLE KL RYDN+G EL    + + EYIDQ DAER+FY+SLR++M EKA  LA+
Sbjct: 961  QTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLAN 1020

Query: 1020 LRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRA 1079
            +R  +GLKE +DEPA EL+  + DE  PAS   +++QLCKIS  LV KFL IAI KYH+A
Sbjct: 1021 IRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKA 1080

Query: 1080 RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139
            +VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1140 NAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLELT 1199
            NAVLVN+NDERAARVVKGR+EKTLLSDV+FY+QD+Y+DNM+FLQ+K+D  TIEKLQLELT
Sbjct: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELT 1200

Query: 1200 LEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRMQ 1259
            +EDI VAI +A KLKI  +D+SI+GKDK+NI V  +   +KSIST+ KEP  NE+FYRMQ
Sbjct: 1201 VEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRMQ 1260

Query: 1260 QLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILE 1319
             LRRALP IVVKG  DI+RAVINI+DDG RELLVEGYGLR+VMTTDGVIG KTKTNHILE
Sbjct: 1261 HLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHILE 1320

Query: 1320 VYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRD 1379
            V+ VLGIEAAR+ I+ EIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGL+KMRD
Sbjct: 1321 VFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRD 1380

Query: 1380 SVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGENDL 1439
            SVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTG+FKVVK T + E+DL
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESDL 1440

Query: 1440 TPKPTLFETLCDTV 1453
             PKPTLFE+LCD+V
Sbjct: 1441 APKPTLFESLCDSV 1454

>AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR116C
            (RPO31)
          Length = 1459

 Score = 2547 bits (6601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1211/1451 (83%), Positives = 1311/1451 (90%), Gaps = 1/1451 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V+DI PK+I G+ FSALSA+DIV+QSEVEI TRDLFDL++GR+ K+GGALD RMGV
Sbjct: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSSQAEC+TCHG LASCHGHFGHIKLALPVFHVGYFKATIQILQS+CK C  LLL+EEDK
Sbjct: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            R+FL+ELRRPG+DNLRRM  LKK+LDQCKKQRRC  CG LN              LKIIH
Sbjct: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKKSAPEK++WIGDW QVL+++PELERY+KR M++LNPLK LNLFKQI P DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDST K+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGT-KSKPIRGFCQRLKGKQ 359
            AGLEKGISINNMMEQWDYLQ+AVAMYINSDSVNP+++PG +G  K+KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVI 419
            GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LT+PEKVTRYNKHKLQQL++
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV 420

Query: 420  NGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLH 479
            NG  VHPGANYLLKKNE+ARRNLRYGDR+KLAK LQ GDVVERH+EDGDVVLFNRQPSLH
Sbjct: 421  NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPH 599
            LTPKSGEPIIAATQDFITGSYLISHKDSFFDRA   Q+LSMMSD NLQFDIPPP+IM+PH
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPH 600

Query: 600  YLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILS 659
            YLWTGKQ+FSLLIKP++KSPV+INLDAKNKVY+ P  K YPNEMS NDG+V+IRGSNILS
Sbjct: 601  YLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGS 719
            GVMDKSVLGDGKKHSVFYTILRD+GP EA QAMNRMAKLCARYLGNRGFSIGI+DVTPG 
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGV 720

Query: 720  DLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
            +LK  KE+MVE AYAKCDELIDL+ +GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+VC
Sbjct: 721  ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780

Query: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839
            IRELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT
Sbjct: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840

Query: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIA 959
            NTVRTSSNGIVQFTYGGDGLDPL+MEGNA+PVNFNRSW HANN+T N +  G+LPYQI+ 
Sbjct: 901  NTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILE 960

Query: 960  ETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLAS 1019
            ETN IL PLE +L RYDN+G  L    E+++ YIDQ DAER FYQSLR +M+EKA  LA 
Sbjct: 961  ETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLAD 1020

Query: 1020 LRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRA 1079
            +   RGLKEL   PA EL+  + D + P     ++NQLCKIS  LV+ FL IAISKY +A
Sbjct: 1021 ITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKA 1080

Query: 1080 RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139
            +VEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1140 NAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLELT 1199
            NA LVND+DERAARVVKGRVEKTLLSDV FY+QD+YRDNM+FLQ+K+D  TIEKLQLELT
Sbjct: 1141 NATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLELT 1200

Query: 1200 LEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRMQ 1259
            +EDI +AI  APKLKI T D+SI+G++KINI V +D    KSIST   EP  N+VF++MQ
Sbjct: 1201 VEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKMQ 1260

Query: 1260 QLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILE 1319
             LRRALP IVVKG  DISRAVINIRDDGKRELLVEGYGLRDVMTTDGV+G KTKTNH LE
Sbjct: 1261 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFLE 1320

Query: 1320 VYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRD 1379
            VYDVLGIEAAR+ II+EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMRD
Sbjct: 1321 VYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380

Query: 1380 SVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGENDL 1439
            SVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTM+IGTGSFKVVK T +  +DL
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDDL 1440

Query: 1440 TPKPTLFETLC 1450
             PKPTLFE LC
Sbjct: 1441 KPKPTLFENLC 1451

>Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {ON}
            similar to Ashbya gossypii AER252C
          Length = 1459

 Score = 2545 bits (6597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1208/1452 (83%), Positives = 1322/1452 (91%), Gaps = 1/1452 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V+D+APKKIKG+ FSALSA+DIV+QSEVEI TRDLFDL+NGR+ K+GGALD +MGV
Sbjct: 1    MKEVVVDVAPKKIKGLHFSALSASDIVAQSEVEIFTRDLFDLENGRAPKQGGALDSKMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSSQAEC+TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQS+CK C A+LLSEE+K
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQSICKNCAAILLSEEEK 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            R+FL ELRRPG+DNLRRM  L+K+LDQCKKQRRC  CG LN              LKIIH
Sbjct: 121  RQFLAELRRPGIDNLRRMATLRKVLDQCKKQRRCLHCGALNGVVKKAATGSGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKKSAPEKE+WIGDW QVL++NPELERY+KR MD+LNPLK LNLFKQ++  DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWIGDWNQVLQHNPELERYMKRSMDNLNPLKTLNLFKQVRAQDCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDST K+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPS-MLPGSSGTKSKPIRGFCQRLKGKQ 359
            AGLEKGISINNMMEQWDYLQ+AVAMYINSDSVNP+ M  G+ G K+KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGTGGGKTKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVI 419
            GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LTYPE+VTRYNKHKLQQL+I
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPERVTRYNKHKLQQLII 420

Query: 420  NGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLH 479
            NGP VHPGANY+LKKNEDARRNLRYGDR+KLAK +Q GDVVERHIEDGDVVLFNRQPSLH
Sbjct: 421  NGPNVHPGANYMLKKNEDARRNLRYGDRIKLAKNIQIGDVVERHIEDGDVVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPH 599
            LTPKSGEPII+ATQDFITGSYLISHKDSFFDRA  TQLLSMM+D+N+QFD+PPP+I+KP 
Sbjct: 541  LTPKSGEPIISATQDFITGSYLISHKDSFFDRATFTQLLSMMADANMQFDLPPPAIIKPC 600

Query: 600  YLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILS 659
            YLWTGKQVFSLLI+P++KSPV+INLDAKNKVYLPP  K +PNEMS NDG+V+IRGS IL 
Sbjct: 601  YLWTGKQVFSLLIRPNKKSPVIINLDAKNKVYLPPKNKSFPNEMSSNDGYVIIRGSEILC 660

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGS 719
            GVMDKSVLGDGKKHSVFYTILRD+GP EAA+AMNRMAKLCARYLGNRGFSIGINDVTPG 
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPYEAAKAMNRMAKLCARYLGNRGFSIGINDVTPGK 720

Query: 720  DLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
            +LK KKE+MVE AYAKCDELIDLF +G+LETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 721  ELKAKKEEMVEIAYAKCDELIDLFKRGELETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839
            IRELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFAKNSKT 840

Query: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899
            PQSKGFVR+SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRSSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIA 959
            NTVRTSSNG+VQFTYGGDGLDPL+MEGNAQPVNFNRSW HANN+T N+  PGLLPYQI+ 
Sbjct: 901  NTVRTSSNGVVQFTYGGDGLDPLNMEGNAQPVNFNRSWDHANNITFNNEEPGLLPYQIME 960

Query: 960  ETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLAS 1019
             +N IL PLE +L R DN+G  +  +    DEYIDQ DAER FYQSLR +MT KA  LA 
Sbjct: 961  TSNSILVPLERQLLRLDNVGNAISADLGSNDEYIDQNDAERDFYQSLRTYMTAKAHRLAQ 1020

Query: 1020 LRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRA 1079
            +R  +GLK L++EPA+EL+  + D +   +   ++NQLCKIS  LV  FL+IAISKYH+A
Sbjct: 1021 IRKSKGLKSLLEEPAQELKYMDLDASASTADLNSINQLCKISYNLVTTFLNIAISKYHKA 1080

Query: 1080 RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139
            +VEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMN+TLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKVISTPII 1140

Query: 1140 NAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLELT 1199
            NA+LVNDNDERAARVVKGR+EKTLLSDV FY+QD+YRDNM+F+Q+K+D  TIEKLQLELT
Sbjct: 1141 NALLVNDNDERAARVVKGRIEKTLLSDVVFYIQDVYRDNMSFIQVKVDLSTIEKLQLELT 1200

Query: 1200 LEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRMQ 1259
            +EDI +AI++APKLKI T D+SIIGK+KINI+V +D +  KSIST + EP  N+VFYRMQ
Sbjct: 1201 IEDIAIAISRAPKLKISTGDVSIIGKNKINISVGNDLEKGKSISTLVSEPNENDVFYRMQ 1260

Query: 1260 QLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILE 1319
             LRRALP+IVVKG  DISRAVINI +DGKRELLVEGYGLRDVMTTDGVIG KTKTNH LE
Sbjct: 1261 HLRRALPNIVVKGLPDISRAVINILEDGKRELLVEGYGLRDVMTTDGVIGYKTKTNHFLE 1320

Query: 1320 VYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRD 1379
            V++VLGIEAAR+ II+EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMRD
Sbjct: 1321 VFEVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380

Query: 1380 SVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGENDL 1439
            SVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTGSFKVV+ T +  ++L
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVRGTNISMDEL 1440

Query: 1440 TPKPTLFETLCD 1451
             P PTLFE LC+
Sbjct: 1441 KPNPTLFENLCN 1452

>NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5.426
          Length = 1460

 Score = 2542 bits (6589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1211/1454 (83%), Positives = 1315/1454 (90%), Gaps = 2/1454 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V+   PK+I G+ FSALSAADIV+QSEVEIS+RDLFDL+ GR  K GGALD RMGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEVEISSRDLFDLEKGREPKTGGALDKRMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ +CK C A+LLS++D+
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSDKDR 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            R+FL ELRRPG+DNLRRM ILKK+LDQCKKQRRC +CG LN              LKIIH
Sbjct: 121  RQFLNELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            D FRWVGKKSAPEK++W+GDWK+VL ++PELER+VKRC DDLNPLK LNLFKQIKP DCE
Sbjct: 181  DNFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFVKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLG++ST KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGVNSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358
            AGLEKGISINNMME WDYLQL VAMYINSDSVNP+MLPG+S  G K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LT+PEKVTRYN+ KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNRQKLQQLI 420

Query: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478
            INGP VHPGANYLLK NEDARRNLRYGDRVKLAK LQ+GDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKNNEDARRNLRYGDRVKLAKNLQFGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRA LTQLLSMM D+NLQFDIPPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMCDANLQFDIPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658
            HYLWTGKQ+FSLLIKP++ SPVVINLDAKNKVY+PP  K YPNEMS+NDG+V+IRGS IL
Sbjct: 601  HYLWTGKQLFSLLIKPNKDSPVVINLDAKNKVYIPPKTKAYPNEMSRNDGYVIIRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRMAKLCAR+LGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGISDVTPA 720

Query: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLKQKKE++VE AYAKCDELID FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958
            DNTVRTSSNGIVQFTYGGDGLDP++MEGNA+PVNFNRSW HA N+T + +  GLLPYQI+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHATNITFSPDQHGLLPYQIM 960

Query: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018
              TN IL+PLE++L RYDN+G+ +  ED  K EY+DQFDAER FY+SLR++M EKA  L 
Sbjct: 961  ETTNAILKPLEDRLIRYDNLGEIVPNEDSTKAEYVDQFDAERDFYKSLRDYMDEKAKVLG 1020

Query: 1019 SLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHR 1078
            S+R  RG+  +VDEPAEEL++ N DE VP +I  +++QL KI++ LV+KFL IA+ KY +
Sbjct: 1021 SVRKSRGMLPMVDEPAEELKKMNPDEQVPETIRYSVDQLYKITEDLVKKFLEIALYKYRK 1080

Query: 1079 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLEL 1198
            INAVLVN+NDERAARVVKGR+EKTLLSDV++Y+QD+Y+DN++F+Q++ID  TIEKLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDVYKDNLSFIQVRIDLNTIEKLQLEL 1200

Query: 1199 TLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRM 1258
            T+EDI VA+ +APKLKI T+D++IIGKDKI I V  +G   KSISTA KEP  N VFYRM
Sbjct: 1201 TIEDIAVALTRAPKLKILTSDVNIIGKDKIAINVFPEGYKAKSISTAAKEPTENAVFYRM 1260

Query: 1259 QQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            Q LRRALP IVVKG  +I+RAVINIRDDGKRELLVEGYGLRDVM TDGVIG KT TNHIL
Sbjct: 1261 QHLRRALPSIVVKGLPEIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1319 EVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR 1378
            EV  VLGIEAARS I+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMR
Sbjct: 1321 EVNTVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEND 1438
            DSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTGSFKVVK T + +  
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTEIAKES 1440

Query: 1439 LTPKPTLFETLCDT 1452
            L PKPTLFE L  +
Sbjct: 1441 LKPKPTLFENLTSS 1454

>TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5.426
            YOR116C
          Length = 1460

 Score = 2533 bits (6564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1206/1460 (82%), Positives = 1317/1460 (90%), Gaps = 3/1460 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V+   PK+I G+ FSALSAADIV+QSEVEISTRDLFDL+NGR+ + GGALDP+MGV
Sbjct: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSS  ECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ +CK C A+LL + D+
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            R FL+ELRRPG+DNLRRM IL K+LDQCKKQRRC +CG LN              LKIIH
Sbjct: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRW GKKS PEK++W+GDW +VL +NPELERYVKRCMDDLNPLK LNLFKQ+KP DCE
Sbjct: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDS++KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358
            +GLEKGISINNMME WDYLQL+VAMYINSDSVNP+M+PG+S  G K KPIRGFCQRLKGK
Sbjct: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LTYPEKVTRYN+ KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420

Query: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478
            INGP VHPGANYLLKK+EDARRNLRYGDRVKLAK L+ GDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDR  LTQLLSMMSD NLQFDIP P+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600

Query: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658
             YLWTGKQVFSLLIKP++KSPVVINLDAKNKV++PP  K  P+EMSQNDG+V+IRGS IL
Sbjct: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLK+KKE MVE AYAKCDELID +NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958
            DNTVRTSSNGIVQFTYGGDGLDP++MEGNAQPVNF RSW HA N+T N+   GL PYQI 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960

Query: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018
             ET+ IL PL N+L RYDN+G+ + KE +   EYIDQ DAER+FY SL+ FM  KA  LA
Sbjct: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020

Query: 1019 SLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHR 1078
            S+R +RG+KEL+DEP  E +  ++DE+VP +I  +++QLC+I+   V++FL IAISKY R
Sbjct: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080

Query: 1079 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLEL 1198
            INAVLVNDNDERAARVVKGR+EKTLLSDV+FY+QD+Y+DN++F+Q++ID  TI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200

Query: 1199 TLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRM 1258
            T+EDI VAI +APKLKI  +D++I+ KDKI I V  +G   KSIST+ KEP  N+VF+RM
Sbjct: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260

Query: 1259 QQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            QQLRR+LP IVVKG  DISRAVIN+RDD KRELLVEGYGLRDVM+TDGV+G KT TNHIL
Sbjct: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320

Query: 1319 EVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR 1378
            EV+ VLGIEAAR+ II EIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGL+KMR
Sbjct: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEND 1438
            DSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTG+FKV+K T + E D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440

Query: 1439 LTPKPTLFETLC-DTVVKAN 1457
            L PKPTLFE+L  +T +KAN
Sbjct: 1441 LRPKPTLFESLSKETAIKAN 1460

>NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {ON}
            Anc_5.426
          Length = 1460

 Score = 2529 bits (6555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1206/1456 (82%), Positives = 1318/1456 (90%), Gaps = 4/1456 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V+   PK+I G+ FSALSAADIV+QSE+E+S+RDLFDL+ GR  K GGALD +MGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEIEVSSRDLFDLEKGREPKIGGALDRKMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ VCK C A+LL+++DK
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKTCSAILLNDQDK 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            R+FLTELRRPG+DNLRRM ILKK+LDQCKKQRRC +CG LN              LKIIH
Sbjct: 121  RQFLTELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGPASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKKSAPEK++W+GDWK+VL ++PELER++KRC DDLNPLK LNLFKQIKP DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFMKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDST KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358
            AGLEKGISINNMME WDYLQL VAMYINSDSVNP+MLPG+S  G K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LT+PEKVTRYNK KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKQKLQQLI 420

Query: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478
            INGP VHPGANYLLKKNEDARRNLRYGDR+KLAK LQ+GDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKNEDARRNLRYGDRIKLAKNLQHGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRA LTQLLSMMS+  L+FDIPPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSNGTLRFDIPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658
            +Y+WTGKQVFSLLI+P+++SPVVINLDAKNKV++PP  K+YPNEMS+NDG+V+IRGSNIL
Sbjct: 601  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVFMPPKYKDYPNEMSRNDGYVVIRGSNIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRM+KLCARYLGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARYLGNRGFSIGISDVTPA 720

Query: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLKQKKE++VE AYAKCDELID F+KGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFHKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958
            DNTVRTSSNGIVQFTYGGDGLDP++MEGNA+PVNFNRSW HA N+T ++   GLLPY+I+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHAINITFSNLEKGLLPYEIM 960

Query: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018
             +TN IL+PLE +L RYDN+G+ + K+D  K EY+DQFDAER FY+SLR+++ EKA  LA
Sbjct: 961  EKTNEILKPLEERLIRYDNVGELVPKKDNEKAEYVDQFDAERDFYRSLRDYIQEKADILA 1020

Query: 1019 SLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHR 1078
             +R  RG+ E+  EP EELR+ + DE +  SI  +++QL KI++  VQ FL IA+ KY +
Sbjct: 1021 RVRKSRGMLEMSSEPGEELRKLDPDERITESIKHSVDQLYKITEKSVQTFLEIALYKYRK 1080

Query: 1079 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLEL 1198
            INAVLVN+NDERAARVVKGR+EKTLLSD+++Y+QD+Y+DN++F+Q+++D  TIEKLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDIAYYIQDVYKDNLSFIQVRVDLGTIEKLQLEL 1200

Query: 1199 TLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRM 1258
            T+EDI VAI KAPKLKI T+D++I+GKDKI I V  DG   KSIST  KEP  N VFYRM
Sbjct: 1201 TIEDIAVAITKAPKLKIQTSDVNILGKDKIAINVYPDGYKAKSISTMAKEPSNNAVFYRM 1260

Query: 1259 QQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            Q LRR LP IVVKGF DISRAVINIRDDGKRELLVEGYGLRDVM TDGVIG KT TNHIL
Sbjct: 1261 QHLRRVLPSIVVKGFGDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1319 EVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR 1378
            EV +VLGIEAARS II EIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGL+KMR
Sbjct: 1321 EVNNVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEND 1438
            DSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTGSFKVVK T + E D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEAD 1440

Query: 1439 LTPKPTLFETL--CDT 1452
            L PKPTLFE L  C T
Sbjct: 1441 LKPKPTLFEKLSNCGT 1456

>Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON}
            (19972..24354) [4383 nt, 1461 aa]
          Length = 1460

 Score = 2519 bits (6528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1190/1451 (82%), Positives = 1308/1451 (90%), Gaps = 2/1451 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V+   PKKI G+ FSALSA+DIV+QSEVE+STRDLFDL+NGR+ K GGALDP+MGV
Sbjct: 1    MKEVVVSETPKKISGLEFSALSASDIVAQSEVEVSTRDLFDLENGRAPKIGGALDPKMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSS  ECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ +CK C ++LL++ D+
Sbjct: 61   SSSSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSSILLNDTDR 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPG+DNL+RM I+KKILDQCKKQRRC  CG LN              LKIIH
Sbjct: 121  RDFLHELRRPGIDNLKRMAIIKKILDQCKKQRRCLTCGALNGVVKRAAAGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKKS+PEK++W+GDW++VL NNPELER+ KR MDDLNPLK LNLFKQI+P DCE
Sbjct: 181  DTFRWVGKKSSPEKDEWVGDWEKVLANNPELERFAKRSMDDLNPLKTLNLFKQIRPEDCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDST K+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358
            AGLEKGISINNMME WDYLQL+VAMYINSDSVNPSM+PG+S  G K+KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPSMMPGASSGGAKAKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LTYPEKVTRYN+ KLQ LV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNREKLQALV 420

Query: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478
            INGP VHPGANY+LK NE+ARRNLRYGDR+K+AKQL+ GD+VERH+EDGD+VLFNRQPSL
Sbjct: 421  INGPNVHPGANYILKANEEARRNLRYGDRLKIAKQLRVGDIVERHLEDGDIVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEA+NLMGVKNN
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAMNLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKD+F DRA  TQLLSMMSDSNLQFDIPPP+I+KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDTFLDRATFTQLLSMMSDSNLQFDIPPPTIIKP 600

Query: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658
            + LWTGKQ+FSLLIKP++ SPVVINLDAKNKV++PP  K  PNEMSQNDGFV+IRGS IL
Sbjct: 601  YCLWTGKQLFSLLIKPNKDSPVVINLDAKNKVFIPPKSKSLPNEMSQNDGFVVIRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPD 720

Query: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
            + LKQKKE++VE AYAKCDELIDLF KGKLETQPGCNEEQTLEAKIGGLLSKVREEVG++
Sbjct: 721  NALKQKKEELVEIAYAKCDELIDLFTKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDI 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFRKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958
            DNTVRTSSNGIVQFTYGGDGLDPL+MEGNAQPVNF RSW HA N+T ++++ GLLPY II
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFKRSWDHAINITFDNSAQGLLPYAII 960

Query: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018
             +TN IL P E +L RYDNIG  ++  D+ KDE++DQ D+ER+FY SLR++M EKA  LA
Sbjct: 961  NKTNDILAPFEERLIRYDNIGTLVKANDQAKDEFVDQLDSERNFYCSLRKYMQEKASILA 1020

Query: 1019 SLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHR 1078
            S+R ++GLKEL  EP  E +E + DE   +    A+ +LCKI++  V+KFL IA+SKY R
Sbjct: 1021 SIRKDKGLKELSSEPGNEFKEMDLDEGESSEARFAVEKLCKITEKTVEKFLEIAMSKYRR 1080

Query: 1079 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLEL 1198
            INAVLVNDND+RAARVVKGR+EKTLLSDV++YVQD+Y+DN++FL++KID  TI+KLQLEL
Sbjct: 1141 INAVLVNDNDKRAARVVKGRIEKTLLSDVAYYVQDVYKDNLSFLEVKIDLSTIDKLQLEL 1200

Query: 1199 TLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRM 1258
            T+EDI VA+ +APKLKI T D+ I+ KDKI I+V  +G   KSIST+MKEP  N+VFYRM
Sbjct: 1201 TIEDIAVALTRAPKLKIQTTDVQIVSKDKITISVYPEGSKAKSISTSMKEPSENDVFYRM 1260

Query: 1259 QQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            Q LRRALP IVV G  DI+RAVINIRDDGKRELLVEGYGLR+VM TDGVIGSKT TNH+L
Sbjct: 1261 QTLRRALPQIVVNGLPDIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTTTNHVL 1320

Query: 1319 EVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR 1378
            EV+ VLGIEAARS II EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMR
Sbjct: 1321 EVFSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEND 1438
            DSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTG+FK++K+T +  +D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKILKSTEIKPDD 1440

Query: 1439 LTPKPTLFETL 1449
            L PK TLFE L
Sbjct: 1441 LKPKRTLFENL 1451

>Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2516 bits (6521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1204/1460 (82%), Positives = 1309/1460 (89%), Gaps = 3/1460 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V+   PK+IKG+ FSALSAADIV+QSEVE+STRDLFDL+  R+ +  GALDP+MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSS  ECTTCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ +CK C A+LLSE DK
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            RKFL ELRRPG+DNLRRM ILKKILDQCKKQRRC  CG LN              LKIIH
Sbjct: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKKSAPEK+ W+G+WK+VL +NPELERYVKRCMDDLNPLK LNLFKQIK  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358
            AGL+KGISINNMME WDYLQL VAMYINSDSVNP+MLPGSS  G K KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LTYPEKVTRYN+HKLQ+LV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420

Query: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478
            +NGP VHPGANYLLKKNEDARRNLRYGDR+KLAK LQ GDV+ERH+EDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRA LTQLL MMSD   QFD+PPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658
            +YLWTGKQVFSLLIKPS KSPVVINLDAKNKV++PP  K  P+EMSQNDGFV+IRGS IL
Sbjct: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLKQKKE++VE AY KCDELI  FNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958
            DNTVRTS+NGIVQFTYGGDGLDPL+MEGNAQPVNFNRSW HA N+T ++   GLLPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960

Query: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018
               N IL PLE++L RYDN G  ++ ED+ K E++DQ+DAER FY+SLRE++  KA TLA
Sbjct: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020

Query: 1019 SLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHR 1078
            +LR  RG+ ELV+ P +EL+  + DE VP ++  +++QL +IS+  V+KFL IA+ KY +
Sbjct: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080

Query: 1079 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLEL 1198
            INAVLVNDNDERAARVVKGRVEKTLLSDV++YVQD+Y+DN++F+Q++ID  TI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1199 TLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRM 1258
            T+EDI VAI +A KLKI   D++IIGKDKI I V  +G   KSIST+ KEP  N+VFYRM
Sbjct: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1259 QQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            QQLRRALP +VVKG +DISRAVINIRDDGKRELLVEGYGLRDVM TDGVIGSKT TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1319 EVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR 1378
            EV+ VLGIEAAR  I+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMR
Sbjct: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEND 1438
            DSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTGSFKV+K T V E D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440

Query: 1439 LTPKPTLFETLC-DTVVKAN 1457
            L PKP LFE+L  +  +KAN
Sbjct: 1441 LIPKPCLFESLSNEAALKAN 1460

>ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2512 bits (6511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1200/1458 (82%), Positives = 1312/1458 (89%), Gaps = 1/1458 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V   APKKI G+ FSALSAADIV+QSEVEISTRDLFDL+NGR+ K GGALDP+MGV
Sbjct: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQ +CK C ++LL + DK
Sbjct: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            + FL+ELRRPG+DNLRRM ILKK+LDQCKKQRRC +CG LN              LKIIH
Sbjct: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRW GKKS PEKE+WIGDW  VL ++PELERYVKRCMDDLNPLK LNLFKQ+KP DCE
Sbjct: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDST KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQG 360
            AGLEKGISINNMME WDYLQLAVAMYINSDSVNP++L G +G K KPIRGFCQRLKGKQG
Sbjct: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQG 360

Query: 361  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVIN 420
            RFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAK+LTYPE+VTRYNK KLQQLV+N
Sbjct: 361  RFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVN 420

Query: 421  GPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHR 480
            GP  +PGANYLLKK+EDARRNLR+GDRVKLAK L+ GD+VERH+EDGDVVLFNRQPSLHR
Sbjct: 421  GPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHR 480

Query: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540
            LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+NLL
Sbjct: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLL 540

Query: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHY 600
            TPKSGEPIIAATQDFITGSYLISHKDSFFD+  +TQLLSMMSD  LQFDIPPP+I KP Y
Sbjct: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPCY 600

Query: 601  LWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSG 660
            LWTGKQ+FSLLI+P++KSPVV+NLDAKNKVY+PP  K  PNEMSQNDGFVLIRGS ILSG
Sbjct: 601  LWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILSG 660

Query: 661  VMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGSD 720
            VMDKSVLGDGKKHSVFYTILRDYG  EAA+AMNRMAKLCARY+GNRGFSIGI+DVTP  +
Sbjct: 661  VMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAEE 720

Query: 721  LKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
            LK+KKE+MVESAYAKCDELIDLF+KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI
Sbjct: 721  LKEKKEEMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780

Query: 781  RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840
             ELDN+NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSKTP
Sbjct: 781  NELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTP 840

Query: 841  QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900
            QSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC YDN
Sbjct: 841  QSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDN 900

Query: 901  TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAE 960
            TVRTSSNGIVQFTYGGDGLDPL+MEGNAQPVNFNR+W HA N+T N+   GLLPYQI+  
Sbjct: 901  TVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQV 960

Query: 961  TNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASL 1020
            T  ILQPLEN+L RYDN+G E+ KE+  + EYIDQ DAER FY SLR+F+  KA  LA  
Sbjct: 961  TEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKF 1020

Query: 1021 RGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRAR 1080
            RG + +KEL+DEPA EL+  + DENVP  I  +++Q+ +I+  +V++FL +AI KY RA+
Sbjct: 1021 RGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAK 1080

Query: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140
            VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN
Sbjct: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140

Query: 1141 AVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLELTL 1200
            AVLVN++DERAARVVKGR+EKTLLSDV+FY+QD+YRDN+++LQ+++D  TI+KLQLELT+
Sbjct: 1141 AVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELTI 1200

Query: 1201 EDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRMQQ 1260
            EDI VA+ +APKLKI  +D+ I+GKDKI I V  DG   KSIST  KEP  NEVFYRMQQ
Sbjct: 1201 EDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQQ 1260

Query: 1261 LRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEV 1320
            LRRALP IVVKG SDISRAVINIRDDGKRELLVEGYGLRDVM+TDGV+G KT TNHILEV
Sbjct: 1261 LRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHILEV 1320

Query: 1321 YDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDS 1380
            Y VLGIEAAR+ I+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGL+KMRDS
Sbjct: 1321 YSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDS 1380

Query: 1381 VLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGENDLT 1440
            VLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTM+IGTG+FKVVK T V E  L 
Sbjct: 1381 VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQLK 1440

Query: 1441 PKPTLFETLC-DTVVKAN 1457
            PKPTLFE+L  +T VK N
Sbjct: 1441 PKPTLFESLVNETSVKVN 1458

>Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2511 bits (6507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1200/1460 (82%), Positives = 1310/1460 (89%), Gaps = 3/1460 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V+   PK+IKG+ FSALSAADIV+QSEVE+STRDLFDL+  R+ K  GALDP+MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ +CK C A+LLSE DK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPG+DNLRRM ILKKILDQCKKQRRC  CG LN              LKIIH
Sbjct: 121  RHFLQELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKKSAPEK+ W+G+WK+VL +NPELERYVKRCMDDLNPLK LNLFKQIK  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358
            AGL+KGISINNMME WDYLQL VAMYINSDSVNP+MLPGSS  G K KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LTYPEKVTRYN+HKLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478
            +NGP VHPGANYLLK+NEDARRNLRYGDR+KLAK LQ GDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRLKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRA LTQLLSMMSD   QFDIPPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDIPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658
            +YLWTGKQVFSLLIKP+  SPVVINLDAKNKV++PP  K  PNEMSQNDGFV+IRGS IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSKIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLKQKKE++VE AY+KCDELI LFNKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYSKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958
            DNTVRTS+NGIVQFTYGGDGLDPL+MEGNAQPVNFNRSW HA N+T N+   GLLPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDEGLLPYAIM 960

Query: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018
              TN IL+PLE +L RYDN G  +++E+ +K EY+DQ+DAER FY+SL+E++  KA  LA
Sbjct: 961  QTTNEILRPLEERLVRYDNSGCLVKEENLNKAEYVDQYDAERDFYRSLKEYINLKATALA 1020

Query: 1019 SLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHR 1078
            +LR  RG+ EL++ P +E  + + D+ VP ++  +++QL +IS+  V+KFL IA+ KY +
Sbjct: 1021 NLRKSRGMLELLEPPTKESEKVDPDKLVPDNVKTSVSQLYRISEKSVRKFLEIALYKYRK 1080

Query: 1079 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLEL 1198
            INAVLVNDNDERAARVVKGRVEKTLLSDV++YVQD+Y+DN++F+Q++ID  TI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1199 TLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRM 1258
            T+EDI VAI +A KLKI  +D++IIGKD+I I V  +G   +SIST+ KEP  N+VFYRM
Sbjct: 1201 TIEDIAVAITRAAKLKIQASDVNIIGKDRIAINVFPEGYKARSISTSAKEPSENDVFYRM 1260

Query: 1259 QQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            QQLRRALP +VVKG  DISRAVINIRDDGKRELLVEGYGLRDVM TDGVIGS+T TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1319 EVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR 1378
            EV+ VLGIEAAR  II EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEND 1438
            DSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTGSFKVVK T + E D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISERD 1440

Query: 1439 LTPKPTLFETLC-DTVVKAN 1457
            L PKP LFE+L  +  +KAN
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}
            RPO31RNA polymerase III largest subunit C160, part of
            core enzyme; similar to bacterial beta-prime subunit and
            to RPA190 and RPO21
          Length = 1460

 Score = 2510 bits (6506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1203/1460 (82%), Positives = 1306/1460 (89%), Gaps = 3/1460 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V+   PK+IKG+ FSALSAADIV+QSEVE+STRDLFDL+  R+ K  GALDP+MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ +CK C A+LLSE DK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            R+FL ELRRPG+DNLRRM ILKKILDQCKKQRRC  CG LN              LKIIH
Sbjct: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKKSAPEK+ W+G+WK+VL +NPELERYVKRCMDDLNPLK LNLFKQIK  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358
            AGL+KGISINNMME WDYLQL VAMYINSDSVNP+MLPGSS  G K KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LTYPEKVTRYN+HKLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478
            +NGP VHPGANYLLK+NEDARRNLRYGDR+KLAK LQ GDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRA LTQLLSMMSD    FDIPPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658
            +YLWTGKQVFSLLIKP+  SPVVINLDAKNKV++PP  K  PNEMSQNDGFV+IRGS IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLKQKKE++VE AY KCDELI LFNKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958
            DNTVRTS+NGIVQFTYGGDGLDPL+MEGNAQPVNFNRSW HA N+T N+   GLLPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960

Query: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018
               N IL PLE +L RYDN G  +++ED +K EY+DQ+DAER FY SLRE++  KA  LA
Sbjct: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020

Query: 1019 SLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHR 1078
            +LR  RG+  L++ PA+EL+  + DE VP ++  +++QL +IS+  V+KFL IA+ KY +
Sbjct: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1079 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLEL 1198
            INAVLVNDNDERAARVVKGRVEKTLLSDV+FYVQD+Y+DN++F+Q++ID  TI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1199 TLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRM 1258
            T+EDI VAI +A KLKI  +D++IIGKD+I I V  +G   KSIST+ KEP  N+VFYRM
Sbjct: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1259 QQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            QQLRRALP +VVKG  DISRAVINIRDDGKRELLVEGYGLRDVM TDGVIGS+T TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1319 EVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR 1378
            EV+ VLGIEAAR  II EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEND 1438
            DSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTGSFKVVK T + E D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1439 LTPKPTLFETLC-DTVVKAN 1457
            L PK  LFE+L  +  +KAN
Sbjct: 1441 LVPKRCLFESLSNEAALKAN 1460

>KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1462

 Score = 2508 bits (6499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1194/1452 (82%), Positives = 1302/1452 (89%), Gaps = 3/1452 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE VI  APKKI GI FSALSA+DIV+QSEVEIS+RDLFDL+  R  KE GALDPRMGV
Sbjct: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSS   C TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ++CK C ++LLS+EDK
Sbjct: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120

Query: 121  RKFLTELRRPG-MDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKII 179
            +K+L ELR  G +DNL++M ILKK++DQCKKQRRC  CG LN              LKII
Sbjct: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180

Query: 180  HDTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDC 239
            HDTFRWVGKKS PEK+ WIGDW +VL ++PELER+VKRC DDLNPLK LNLFKQ++P DC
Sbjct: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240

Query: 240  ELLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
            ELLGIDST KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTEIVWTSSLI
Sbjct: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300

Query: 300  KAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKG 357
            KAGLEKGISINNMME WDYLQL VAMYIN+DSVNP+MLPG+S  G K KPIRGFCQRLKG
Sbjct: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360

Query: 358  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQL 417
            KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LTYPEKVTRYN+ KLQ+L
Sbjct: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420

Query: 418  VINGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPS 477
            V+NGP +HPGANYLLKKNE+ARRNLRYGDR+KLAK LQYGD+VERH+EDGDVVLFNRQPS
Sbjct: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480

Query: 478  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 537
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN
Sbjct: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540

Query: 538  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMK 597
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRA  TQLLSMMSD NLQFDIPPP+IMK
Sbjct: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600

Query: 598  PHYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNI 657
            P+YLWTGKQ+FSLLIKP+ KSPVVINLDAKNKVY+PP  K  PNEMS+NDGFV+IRGSNI
Sbjct: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660

Query: 658  LSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTP 717
            LSGVMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRM+KLCAR+LGNRGFSIGI+DVTP
Sbjct: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720

Query: 718  GSDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
              DLK KKE++VE AYAKCD+LID +NKGKLETQPGCNEE+TLEAKIGGLLSKVREEVG+
Sbjct: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780

Query: 778  VCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 837
            VCI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS
Sbjct: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840

Query: 838  KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 897
            KTPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ
Sbjct: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900

Query: 898  YDNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQI 957
            YDNTVRTSSNGIVQFTYGGDGLDP++MEG+AQPVNFNRSW HA N+T N+N  GLLPYQ+
Sbjct: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960

Query: 958  IAETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTL 1017
            + +TN +L PLE +L RYDN+G E+ KED  K EY DQFDAER FY++LR ++  K+  L
Sbjct: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020

Query: 1018 ASLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYH 1077
            A +R  RGL EL+ EP EEL+  + DE        +++QLCKI++  V KFL IA+SKY 
Sbjct: 1021 AHVRKSRGLLELLSEPGEELQSLHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080

Query: 1078 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1137
            +ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140

Query: 1138 IINAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLE 1197
            IINAVLVN+NDERAARVVKGRVEKT+LSDV++Y+QD+Y+DN++FLQI+ID  TIEKLQLE
Sbjct: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200

Query: 1198 LTLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYR 1257
            LT+EDI VA+ KAPKLKI  +D+SI G DK+ + V  +G   KSIST+ K+P  N+VFYR
Sbjct: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260

Query: 1258 MQQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHI 1317
            MQQLRRALPHIVVKG  +I+RAVINIRDDGKRELLVEGYGLR+VM TDGVIGSKT TNH+
Sbjct: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320

Query: 1318 LEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKM 1377
            LEV  VLGIEAARS II EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KM
Sbjct: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380

Query: 1378 RDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEN 1437
            RDSVLQLASFEKTTDHLFDAAFYMK D VEGVSECIILGQTMSIGTGSFKVVK T +   
Sbjct: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440

Query: 1438 DLTPKPTLFETL 1449
            DL PKPTLFE+L
Sbjct: 1441 DLKPKPTLFESL 1452

>Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2502 bits (6485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1196/1460 (81%), Positives = 1303/1460 (89%), Gaps = 3/1460 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V+   PK+IKG+ FSALSAADIV+QSEVE+STRDLFDL+  R+ K  GALDP+MGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGH+KLALPVFH+GYFKATIQILQ +CK C A+LLSE DK
Sbjct: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPG+DNLRRM ILKKILDQCKKQRRC  CG LN              LKIIH
Sbjct: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKKSAPEK+ W+G+WK+VL +NPELERYVKRCMDDLNPLK LNLFKQIK  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T  SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358
            AGL+KGISINNMME WDYLQL VAMYINSDSVNP+MLPGSS  G K KPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LTYPEKVTRYN+ KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420

Query: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478
            +NGP VHPGANYLLK+NEDARRNLRYGDR+KLAK LQ GDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+DRA LTQLLSMMSD   QFD+PPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658
            +YLWTGKQVFSLLIKP+  SPVVINLDAKNKV++PP  K  P+EMSQNDGFV+IRGS IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRMAKLCAR+LGNRGFSIGINDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLKQKKE++VE AY KCDELI LFNKG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958
            DNTVRTS+NGIVQFTYGGDGLDPL+MEGNAQPVNFNRSW HA N+T N+   GLLPY I+
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960

Query: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018
               N IL+PLE +L RYDN G  +++ED+ + EY+DQ+DAER FY+SLRE++  KA  LA
Sbjct: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020

Query: 1019 SLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHR 1078
            +LR  RG+ E ++ P +EL   + DE VP ++  +++QL +IS+  V+KFL IA+ KY +
Sbjct: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1079 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            AR+EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140

Query: 1139 INAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLEL 1198
            INAVLVNDNDERAARVVKGRVEKTLLSDV++YVQD+Y+DN++F+Q++ID  TI+KLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200

Query: 1199 TLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRM 1258
            T+EDI +AI +A KLKI  +D++IIGKD+I I V  +G   KSIST+ KEP  N+VFYRM
Sbjct: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1259 QQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            QQLRRALP +VVKG  DISRAVINIRDD KRELLVEGYGLRDVM TDGVIGSKT TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1319 EVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR 1378
            EV+ VLGIEAAR  II EI+YTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEND 1438
            DSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTGSFKVVK T + E D
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1439 LTPKPTLFETLC-DTVVKAN 1457
            L PKP LFE+L  +  +KAN
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116c RPO31 DNA-directed RNA polymerase III
          Length = 1459

 Score = 2490 bits (6453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1195/1456 (82%), Positives = 1309/1456 (89%), Gaps = 5/1456 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE VI   PK+I G+ FSALS ADIV+QSE+EIS+RDLFDL+N RS KEGGALDPRMGV
Sbjct: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            S+S  ECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ +CK C A+LLSE+DK
Sbjct: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            R FL+ELRRPG+DNLRRM +LKK+LDQCKKQRRC  CG LN              LKIIH
Sbjct: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCGALNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKKS PEK++WIGDWK+VL +NPELERYVKR  DDLNPLK LNLFKQI   DCE
Sbjct: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGID+T+K+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358
            AG+EKGISINNMME WDYLQ+ VAMYINSDS+NP+MLPGSS  G K KPIRGFCQRLKGK
Sbjct: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAK+LT+PEKVTRYN  KL+QLV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420

Query: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478
             NGP VHPGANYLLKKNE+ARRNLRYGDR KLA  LQYGDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+A LTQLLSMMSD +LQFDIPPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658
             YLWTGKQVFSLLIKP++ SPV INLDAKNKVY+PP +K YPNEMSQNDGFV++RGS IL
Sbjct: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRD+GP EAA AMNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             DLKQKKE +VE AYAKCDELIDL+NKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958
            DNTVRTSSNGIVQFTYGGDGLDPL+MEGNAQPVNFNRSW HA N+T N+   GLLPY+I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960

Query: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018
               + IL+PLE +L RYD +G+ +  ED+  D+Y+DQ D+ER FY SLREFMT+KA  LA
Sbjct: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDKAKKLA 1020

Query: 1019 SLRGERGLKELVDEPAEELREFN-WDENVPASITIALNQLCKISKILVQKFLSIAISKYH 1077
             LR  RGL +L+ +   EL  ++  +E++ A +  ++ QL +I++  VQKFL IAISKYH
Sbjct: 1021 KLRKSRGLPKLIKK--SELEGYDPENEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYH 1078

Query: 1078 RARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1137
            RA+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP
Sbjct: 1079 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1138

Query: 1138 IINAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLE 1197
            IINAVLVN+NDERAARVVKGR+EKTLLSDV +Y+QD+Y++NMA+LQ+K+D  TI+KLQLE
Sbjct: 1139 IINAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLE 1198

Query: 1198 LTLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYR 1257
            LT+EDI +AI +APKLKI T+D++++GKDKI I V  +G   K+ ST++KEP  N+VFYR
Sbjct: 1199 LTIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYR 1258

Query: 1258 MQQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHI 1317
            MQ LRRALP I+VKG +DI+RAVINIRDDGKRELLVEGYGLRDVM TDGVIG+KT TNH+
Sbjct: 1259 MQTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHV 1318

Query: 1318 LEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKM 1377
            LE+++VLGIEAAR+ II EIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGL+KM
Sbjct: 1319 LEIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKM 1378

Query: 1378 RDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEN 1437
            RDSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTGSFKVVKNT + E+
Sbjct: 1379 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAED 1438

Query: 1438 DLTPKPTLFETLCDTV 1453
            +L PK TLFE+L   V
Sbjct: 1439 ELKPKRTLFESLTSNV 1454

>TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1459

 Score = 2470 bits (6402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1175/1454 (80%), Positives = 1303/1454 (89%), Gaps = 4/1454 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE VI   PK+I G+ FSALS +DI++QSEVEISTRDLFDL+NGR+  EGGALDP+MGV
Sbjct: 1    MKEVVISETPKRISGLEFSALSTSDIIAQSEVEISTRDLFDLENGRAPIEGGALDPKMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSS  EC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQILQ VCK C A+LL++ DK
Sbjct: 61   SSSTLECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQILQGVCKSCSAILLNDTDK 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            R FL ELR+P +DNL+RM+ILKKILDQCKKQRRC ECG+LN              LKIIH
Sbjct: 121  RHFLHELRKPDIDNLKRMSILKKILDQCKKQRRCLECGDLNGVVKRAATGSGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKK+ PEK++WIGDW QVL NNPELE+++KRC DDLNPLK LNLFKQIK  DCE
Sbjct: 181  DTFRWVGKKNVPEKDKWIGDWNQVLTNNPELEKFIKRCTDDLNPLKTLNLFKQIKNEDCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDST  SGRPETYIWRYLPAPPVCIRPSVMMQDS ASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGIDSTVASGRPETYIWRYLPAPPVCIRPSVMMQDSSASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSG-TKSKPIRGFCQRLKGKQ 359
            AGLEKGISINNMME WDYLQL+VAMYINSDSVN  ++PGS+G TK+KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNLLVMPGSNGGTKAKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVI 419
            GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP+ VAK+LTYPEKVTRYNK KLQ+LV+
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPELVAKVLTYPEKVTRYNKTKLQKLVM 420

Query: 420  NGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLH 479
            NGP VHPGANYLLK NE+ARRNLRYG+R KLAKQL+ GD+VERH+EDGD+VLFNRQPSLH
Sbjct: 421  NGPNVHPGANYLLKSNEEARRNLRYGNRDKLAKQLRIGDIVERHLEDGDIVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHV-PQTEEARAEAINLMGVKNN 538
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNL    QTEEARAEAINLMGVKNN
Sbjct: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLLCYQQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRA LTQLLSMMSD+NL+FDIPPP+I KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDANLKFDIPPPAIFKP 600

Query: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658
              LWTGKQ+FSLLIKP+++SPVVINLDAKNKVY+PP  K +P+EMS NDG+V+IRGS IL
Sbjct: 601  QCLWTGKQIFSLLIKPNKESPVVINLDAKNKVYIPPQNKSWPSEMSPNDGYVIIRGSEIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGP E+A AMNRMAKLCARYLGNRGFSIGI+DVTPG
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQESANAMNRMAKLCARYLGNRGFSIGISDVTPG 720

Query: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
             +LK KKE +VE AY KCDELI  +NKG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  EELKLKKEDLVEIAYKKCDELIIQYNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDNLNAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFEKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFF+GL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFTGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958
            DNT+RTSSNGIVQFTYGGDGLDPLDMEGNA+PVNF R+W HA+N+T + N+ GLLPYQII
Sbjct: 901  DNTIRTSSNGIVQFTYGGDGLDPLDMEGNAKPVNFKRTWDHASNITFDFNAKGLLPYQII 960

Query: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018
             +TN+ILQPLEN L RY+N+G+ L K+D HKDEY+DQ DA+R FY S+RE+M EKA  LA
Sbjct: 961  KQTNLILQPLENALVRYNNVGKPLSKKDYHKDEYVDQLDAKRDFYASIREYMVEKAEQLA 1020

Query: 1019 SLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHR 1078
             +R  R LKEL+ EPAEEL+  ++DEN+P+++   +++LCKIS+  V+KFL IAISKYHR
Sbjct: 1021 KIRKARSLKELISEPAEELQHIDFDENIPSNVREVVDKLCKISEANVKKFLEIAISKYHR 1080

Query: 1079 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTPI 1140

Query: 1139 INAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLEL 1198
            I AVLVND+D RAARVVKGR+EKTLLSDV++Y++D+YRDN  F++IKID  TIEKLQLEL
Sbjct: 1141 IKAVLVNDSDRRAARVVKGRIEKTLLSDVAYYIEDVYRDNRTFIRIKIDLSTIEKLQLEL 1200

Query: 1199 TLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRM 1258
            T+EDI +AI+KAPKLKI +++I I+G DKI I V  +    KSIST++KE   N VFY+M
Sbjct: 1201 TIEDIAIAISKAPKLKIDSSNIHIVGNDKIAIDVFEEAS--KSISTSLKESSENTVFYKM 1258

Query: 1259 QQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            Q LRRALP +VVKG +DISRAVINI+DD K ELLVEGYGLRDVM TDGVIG+KT TNHIL
Sbjct: 1259 QTLRRALPDVVVKGLADISRAVINIKDDSKTELLVEGYGLRDVMCTDGVIGTKTSTNHIL 1318

Query: 1319 EVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR 1378
            E+++VLGIEAARS I+ EIDYTMSNHGMSVDPRHIQLLGDVMT+KGEVLGITRFGL+KMR
Sbjct: 1319 EIFNVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMR 1378

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEND 1438
            DSVLQLASFEKTTDHLFDAAFYMK D V+GVSECIILGQTMSIGTGSF VVK+TVV    
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDEVKGVSECIILGQTMSIGTGSFNVVKHTVVSPEQ 1438

Query: 1439 LTPKPTLFETLCDT 1452
            + PK TLFE+L  +
Sbjct: 1439 VKPKRTLFESLVSS 1452

>KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5.426
            YOR116C
          Length = 1455

 Score = 2456 bits (6364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1176/1460 (80%), Positives = 1290/1460 (88%), Gaps = 8/1460 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V+    KKI GI FSAL+AADIV+QSEVEI+TRDLFDL+ GR  K GGALD RMGV
Sbjct: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGHIKLALPVFHVGYFK+TIQILQ +CK C A+LLS++D+
Sbjct: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            R FL ELRRPG+DNLR+M+ILKK++DQCKKQRRC +CG LN              LKIIH
Sbjct: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCGGLNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKK  PEK++WIG+W ++L ++PELER+VKRC DDLNPLK L LFKQ+K  DCE
Sbjct: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGI+ST +SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSS--GTKSKPIRGFCQRLKGK 358
            AGL KGISINNMME WDYLQL VAMYINSDSVNP+MLPG+S  G K KPIRGFCQRLKGK
Sbjct: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVP  VAK+LT+PEKVTRYNK KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420

Query: 419  INGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSL 478
            INGP VHPGANYLLKKNE+ARRNLRYGD++KLAK LQYGDVVERH+EDGDVVLFNRQPSL
Sbjct: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD   LTQLLSMMSD+ LQFDIPPP+IMKP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600

Query: 599  HYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNIL 658
            +YLWTGKQVFSLLI+P++KSPVVINLDAKNKVY+PP  K +PNEMS NDGFV+IRGS IL
Sbjct: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPG 718
            SGVMDKSVLGDGKKHSVFYTILRDYGP EAA  MNRMAKLCARYLGNRGFSIGI+DVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720

Query: 719  SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
            SDL+ KKE+MV  AYAKCDELID+F  GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
            CI ELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 839  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
            TPQSKGFVRNSFFSGL+PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQII 958
            D+TVRTS+NGIVQFTYGGDGLDPLDMEGNA+PVNF RSW HA N+T N N  GLLPY+I+
Sbjct: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960

Query: 959  AETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLA 1018
             ET+ +L+PLE KL RYDN+G  + KE    + Y D+ DAER+FY+SLR +M EKA  LA
Sbjct: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020

Query: 1019 SLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHR 1078
             +R  RGL E+     +   E      V + +  +++Q+ KI+K  V  FL+IA+ KYHR
Sbjct: 1021 QIRNTRGLLEMTQNGGDTSMEV-----VSSELQASVDQVYKITKKNVNAFLTIALHKYHR 1075

Query: 1079 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1076 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1135

Query: 1139 INAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLEL 1198
            INAVLVN+ DERAARVVKGR+EKTLLSD++FY+QD+YR NM++L+I++D  TIEKLQLEL
Sbjct: 1136 INAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLEL 1195

Query: 1199 TLEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRM 1258
            T+EDI VA+++APKLKI T DI I+GKDKI++ V  +G   KSIST+ KEP  NEVFY+M
Sbjct: 1196 TMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKM 1255

Query: 1259 QQLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHIL 1318
            Q LRR+LP +VVKG  DISRAVINIRDDGKRELLVEGYGLR+VM TDGVIGSKT TNH+L
Sbjct: 1256 QTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVL 1315

Query: 1319 EVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMR 1378
            EV  VLGIEAAR+ I+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMR
Sbjct: 1316 EVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1375

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGEND 1438
            DSVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMS+GTGSFKVVK   V E D
Sbjct: 1376 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERD 1435

Query: 1439 LTPKPTLFETLC-DTVVKAN 1457
            L  +PTLFE+L  +T +KAN
Sbjct: 1436 LKVRPTLFESLASETAIKAN 1455

>TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1458

 Score = 2454 bits (6359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1180/1459 (80%), Positives = 1285/1459 (88%), Gaps = 3/1459 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V    PKKI G+ FSALSAADIV+QSEV I+TRDL+DL++GR+ K+ GALD RMGV
Sbjct: 1    MKEVVTSEIPKKISGLEFSALSAADIVAQSEVAITTRDLYDLEHGRAPKKSGALDQRMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSS  EC TCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQ++CK C A+LLS+EDK
Sbjct: 61   SSSNLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKSCAAVLLSDEDK 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            R FL+ELRRPG+DNL+RM ILKKILDQCKKQRRC  CG LN              LKIIH
Sbjct: 121  RNFLSELRRPGIDNLKRMGILKKILDQCKKQRRCLHCGGLNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKK  PEK+ W+GDW++VL +NPELER+VKR MDDLNPLK LNLFKQIKP DCE
Sbjct: 181  DTFRWVGKKQTPEKDSWVGDWQEVLSHNPELERFVKRAMDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPG-SSGTKSKPIRGFCQRLKGKQ 359
            AGLEKGISINNMME WDYLQL+VAMYINSDSVNP ++PG S+G K KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPLLMPGASTGNKVKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVI 419
            GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAK+LT+PE+VTRYNK KLQ LV+
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPERVTRYNKRKLQALVL 420

Query: 420  NGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLH 479
            NGP VHPGANYLLKK+E+ARRNLRYGD+VKLAK LQ GDVVERH+EDGDVVLFNRQPSLH
Sbjct: 421  NGPNVHPGANYLLKKDEEARRNLRYGDKVKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPH 599
            LTPKSGEPIIAATQDFITGSYLISHKDSFFDRA  TQLLSMM D NLQFDIPPP+IMKP 
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMCDGNLQFDIPPPAIMKPC 600

Query: 600  YLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILS 659
            YLWTGKQ+FSLLIKP+  SPVVIN+DAKNKV+ PP  K  P+EMS NDGFV+IRGS ILS
Sbjct: 601  YLWTGKQLFSLLIKPNSNSPVVINVDAKNKVFKPPKDKSLPSEMSPNDGFVVIRGSQILS 660

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGS 719
            GVMDKSVLGDGKKHSVFYTILRDYGP EAA AMNRMAKLCAR+LGNRGFSIGINDVTP  
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGINDVTPDD 720

Query: 720  DLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
             LK  KE +VE AYAKCDELI L+N+GKLETQPGCNEEQTLEAKI G+LSKVREEVG++C
Sbjct: 721  KLKNLKENLVEIAYAKCDELIGLYNQGKLETQPGCNEEQTLEAKISGILSKVREEVGDIC 780

Query: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839
            I ELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  INELDNWNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKT 840

Query: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899
            PQSKGFVRNSF+SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFYSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIA 959
            NTVRTSSNGIVQFTYGGDGLDP DMEGNAQPVNFNRSW HA N+  ++N   + PYQI+ 
Sbjct: 901  NTVRTSSNGIVQFTYGGDGLDPFDMEGNAQPVNFNRSWDHAYNIKFDNNDKTIYPYQILE 960

Query: 960  ETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLAS 1019
             TN IL PLE KL RYDNIG+ +  E+  KDE++DQ DAER+FY SLR++MT+KA  LA 
Sbjct: 961  ITNDILHPLEEKLIRYDNIGKVVTPENSGKDEFVDQLDAERNFYNSLRDYMTKKANELAD 1020

Query: 1020 LRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRA 1079
            +R  RG+KEL+  P +E +  + DE  P SI  ++ Q+C+I++  V++FL IAI+KY RA
Sbjct: 1021 VRKSRGMKELLSAPGDEFKLMDLDEQTPDSIRHSVEQICRITENTVREFLKIAITKYRRA 1080

Query: 1080 RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139
            RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1140 NAVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLELT 1199
            NAVLVN+NDERAARVVKGR+EKTLLSDV++Y+QD Y+DN ++L++KID  TIEKLQLELT
Sbjct: 1141 NAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDCYKDNNSYLEVKIDLGTIEKLQLELT 1200

Query: 1200 LEDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRMQ 1259
            + DI  AIA+APKLKI   D+      KI I+V  +  S+  IS + KEP  N VFYRMQ
Sbjct: 1201 MSDIADAIARAPKLKIQFGDVVPESNSKIRISVRPEA-SVSKISASAKEPLENNVFYRMQ 1259

Query: 1260 QLRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILE 1319
             LRRALP IVVKG  DI+RAVINIRD+GKRELLVEGYGLRDVM TDGVIGSKT TNH+LE
Sbjct: 1260 HLRRALPSIVVKGLPDIARAVINIRDNGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVLE 1319

Query: 1320 VYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRD 1379
            V  VLGIEAAR+ II EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL+KMRD
Sbjct: 1320 VNSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1379

Query: 1380 SVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGENDL 1439
            SVLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTGSFKVVK+T +    L
Sbjct: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKDTHIRNGTL 1439

Query: 1440 TPKPTLFETLC-DTVVKAN 1457
             PK TLFE+LC +T +K N
Sbjct: 1440 KPKRTLFESLCKETNIKIN 1458

>Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 1148

 Score = 2035 bits (5273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 960/1144 (83%), Positives = 1041/1144 (90%), Gaps = 1/1144 (0%)

Query: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60
            MKE V+DIAPK+IKG+ FSALSA+DIV QS+VEISTRDLFDL+NGR  K GGALD RMGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120
            SSSQAEC+TCHGNLASCHGHFGHIKL+LPVFHVGYFKATIQ+LQS+CK C ALLLSEEDK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120

Query: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIH 180
            R+FL+ELRRPG+DNLRRM ILKK++DQCKKQRRC  CG LN              LKI+H
Sbjct: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240
            DTFRWVGKKSAPEK++W+GDWK VL +NPELERYVK+CMDDLNPLK LNLFKQ+ P DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240

Query: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300
            L+GIDST KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK
Sbjct: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPG-SSGTKSKPIRGFCQRLKGKQ 359
            AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNP+M+PG S+G K+KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVI 419
            GRFRGNLSGKRVDFSGRTV+SPDPNLSIDEVAVPDRVAK+LTYPE VTRYNK KLQQLVI
Sbjct: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420

Query: 420  NGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLH 479
            NGP  HPGANYLLKK+E+ARRNLRYGDR+KLAK LQYGD+VERH+EDGDVVLFNRQPSLH
Sbjct: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL
Sbjct: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPH 599
            LTPKSGEPIIAATQDFITGSYLISHKDSF+ RA+  QLLSMMSD N+QFDIPPP+IMKP+
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600

Query: 600  YLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILS 659
            Y+WTGKQVFSLLI+P++KS VVINLDAKNKVY+PP  K  PNEMS NDGFV+IRGS ILS
Sbjct: 601  YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGS 719
            GVMDKSVLGDGKKHSVFYTILRD+GP EAA AMNRMAKLCARYLGNRGFSIGINDVTPG 
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGF 720

Query: 720  DLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
            +LK KKE MVE AYAKCD+LID FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 721  ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 780  IRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 839
            I+ELDNLN+ LIMA CGSKGS LNVSQMVAVVGQQIISGNRVPDGFQDRSLPHF KNSKT
Sbjct: 781  IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840

Query: 840  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 899
            PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIA 959
            NT+RTSSNGIVQFTYGGDGLDP+DMEGNAQPVNF RSW HANN+T N +   LLPYQI+ 
Sbjct: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ 960

Query: 960  ETNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLAS 1019
            +TN ILQPLE KL RYDN+G+ L    + + E+IDQ DAER+FY+SLRE++  KA  LA 
Sbjct: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK 1020

Query: 1020 LRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRA 1079
            +R  +GLK+ +DEPA EL+  + DE  P+++  +++QLCKIS  LV KFL IAI KYH+A
Sbjct: 1021 IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA 1080

Query: 1080 RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139
            +VEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1140 NAVL 1143
            NAVL
Sbjct: 1141 NAVL 1144

>KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1685

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1502 (34%), Positives = 757/1502 (50%), Gaps = 152/1502 (10%)

Query: 11   KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTC 70
            + +K + F   S  ++ + S  ++   +  D    R AK GG  DPR+G      +C TC
Sbjct: 12   RTVKEVQFGLFSPEEVRAISVAKVRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71   HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKR-KFLTELRR 129
               +  C GHFGHI LA PVFHVG+     ++ +SVC  CG LLL E +++ + + +++ 
Sbjct: 71   QEGMNECPGHFGHIDLAKPVFHVGFISKIKKVCESVCMHCGKLLLDEHNEQMRQVLKIKD 130

Query: 130  PGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXX-XXXXXXXXLKIIHDTFRWVGK 188
            P     +R N +  +   CK +  C    E +                     T R  G 
Sbjct: 131  PK----KRFNAVWSL---CKTKMIC----ETDVPSENDPTQLISRGGCGNAQPTVRKDGL 179

Query: 189  KSAPEKEQWIGDWKQ--VLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCELLGIDS 246
            K        +G WK+     +  E E+ V      L   ++LN+FK I P D   LG D 
Sbjct: 180  K-------LVGSWKKDKATSDGEEPEQRV------LGVEEILNIFKHISPEDSTKLGFDE 226

Query: 247  TSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKG 306
              +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     G
Sbjct: 227  --EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNG 283

Query: 307  ISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGRFRGNL 366
               + + E    LQ  VA Y+++D          SG   +P++    RLKGK+GR RGNL
Sbjct: 284  APHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG---RPVKSIRARLKGKEGRIRGNL 340

Query: 367  SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVINGPKVHP 426
             GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QLV NGP  HP
Sbjct: 341  MGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPNEHP 400

Query: 427  GANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHRLSILSH 486
            GA Y+++ N D R +LRY  R     QLQYG  VERHI D D VLFNRQPSLH++S++SH
Sbjct: 401  GAKYVIRDNGD-RIDLRYSKRAG-DIQLQYGWKVERHIMDDDPVLFNRQPSLHKMSMMSH 458

Query: 487  YAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGE 546
              K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +
Sbjct: 459  RVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNK 518

Query: 547  PIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFD--IPPPSIMKPHYLWTG 604
            P +   QD + G  +++ KD+F +   +  +L  + D    +D  IP P+I+KP  LWTG
Sbjct: 519  PCMGIVQDTLCGIRILTLKDTFLEFDHVLNMLYWVPD----WDGIIPTPAILKPKPLWTG 574

Query: 605  KQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSGVMDK 664
            KQ+ S  I      P  I+L   +         E    +S  D  +LI    I+ GV+DK
Sbjct: 575  KQILSAAI------PKGIHLQRFD---------EGTTLLSPKDNGMLIIDGQIIFGVVDK 619

Query: 665  SVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGIND-VTPGSDLKQ 723
              +G      + + + R+ GP   ++    + K+   +L + GFS GI D +  G  +K+
Sbjct: 620  KTVGSSSG-GLIHVVTREKGPQVCSRLFGNIQKVVNFWLLHNGFSTGIGDTIANGETIKE 678

Query: 724  KKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIREL 783
              E + E A  K +E+        L  + G    ++ E  +   L++ R++ G +    L
Sbjct: 679  ITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNL 737

Query: 784  DNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSK 843
            ++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SK
Sbjct: 738  NDTNYVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSKDDYSPESK 797

Query: 844  GFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVR 903
            GFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T R
Sbjct: 798  GFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTR 857

Query: 904  TSSNGIVQFTYGGDGLDP-------LDMEGNAQPVNFNRSWTHANNLTLNDNSPGLL--- 953
             S   I+QF YG DG+D        LD  G +    F + +        N   P LL   
Sbjct: 858  NSLGNIIQFIYGEDGIDASHIEKQSLDTIGGSDAA-FEKRYRIDLLKVENSLDPSLLESG 916

Query: 954  ---------------PYQIIAETNVILQ----------PLENKLKRYDNIGQELRKEDEH 988
                            Y+ + E    L+          PL   ++R     Q+  + D  
Sbjct: 917  SEITGDLKLQVLLDEEYRQLVEDRAFLRKVFTDGESNWPLPVNIRRIIQNAQQTFRIDHS 976

Query: 989  KDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKELVDEPAEELREFNWDENVPA 1048
            K   +      R   + +RE + EK L L      RG  E+V +  ++            
Sbjct: 977  KPSDL----TIRDIIKGVRE-LQEKLLVL------RGKNEIVQQAQQDAITLFCCLVRSR 1025

Query: 1049 SITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFH 1108
              T  + Q  +++K      ++   S++ R+ V PG  VG + AQSIGEP TQMTL TFH
Sbjct: 1026 LATRRVIQEYRLTKESFDWVINNIESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFH 1085

Query: 1109 FAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLLSD 1166
            FAGVAS  VT GVPR+KEI+N +K + TP +   L      D+  A+ ++  +E T L  
Sbjct: 1086 FAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEEKYAADQERAKYIRSAIEHTTLKS 1145

Query: 1167 VSFYVQDIYRDNMAFLQIKIDSETIEKLQLELTLEDIVVAI-AKAPKL------KIGTND 1219
            V+    +IY D      +  D E I +L   L  E++  ++  ++P L      +   ND
Sbjct: 1146 VTV-ASEIYYDPDPRSTVIEDDEEIIQLHFSLLDEEMEASLDQQSPWLLRLELDRAAMND 1204

Query: 1220 -----------ISIIGKDKINIAVSSDGKSMKSIST---------AMKEPEPNEVFYRMQ 1259
                       I    K  + +  S D      I           A  E E + +  +++
Sbjct: 1205 KDLTMGQVGERIKETFKKDLFVIWSEDNAEKLIIRCRVVRPKGLDAETEAEEDHMLKKIE 1264

Query: 1260 QLRRALPHIVVKGFSDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGV 1307
                 L +I ++G  +I R V+   D       G+ +      L  +G  L +VMT  GV
Sbjct: 1265 NT--MLENITLRGVENIERVVMMKYDRKVPSKTGEFQKVPEWVLETDGVNLAEVMTIPGV 1322

Query: 1308 IGSKTKTNHILEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVL 1367
              ++  TN  +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT +G + 
Sbjct: 1323 DTTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTCQGGLT 1382

Query: 1368 GITRFGLAKMRDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFK 1427
             +TR G  +     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F 
Sbjct: 1383 SVTRHGFNRANTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFG 1442

Query: 1428 VV 1429
            V+
Sbjct: 1443 VM 1444

>Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar to
           Ashbya gossypii ADR086C
          Length = 1743

 Score =  577 bits (1486), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 361/933 (38%), Positives = 508/933 (54%), Gaps = 78/933 (8%)

Query: 9   AP-KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAEC 67
           AP + IK + F   S  ++ + S  +I   +  D    R AK GG  DPR+G      +C
Sbjct: 9   APLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMR-AKVGGLNDPRLGSIDRNYKC 67

Query: 68  TTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTEL 127
            TC   +  C GHFGHI+LA PVFH+G+     ++ + VC  CG LLL E        EL
Sbjct: 68  QTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE------YNEL 121

Query: 128 RRPGM---DNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIHDTFR 184
            R  +   D  RR N +  +   CK +  C                     +    D  +
Sbjct: 122 MRQAIKIKDPKRRFNAVWSL---CKSKMVC------------------DTEVPSEDDPSK 160

Query: 185 WVGKKSAPEKE--------QWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKP 236
           ++ +      +          +G WK+  +N+ + ++  KR    L+  ++LN+FK I P
Sbjct: 161 YISRGGCGNAQPSIRKDGLSLVGTWKKD-KNSEDSDQPEKRI---LSAEEILNVFKHITP 216

Query: 237 NDCELLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTS 296
            D   LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +
Sbjct: 217 EDSLRLGFNE--DFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKAN 273

Query: 297 SLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLK 356
             ++     G   + + E    LQ  VA Y+++D          SG   +PI+    RLK
Sbjct: 274 INVQRLEINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSG---RPIKSIRARLK 330

Query: 357 GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQ 416
           GK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L Q
Sbjct: 331 GKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQ 390

Query: 417 LVINGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQP 476
           LV NGP  HPGA Y+++ N D R +LRY  R     QLQYG  VERHI D D VLFNRQP
Sbjct: 391 LVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAG-DIQLQYGWKVERHIIDNDPVLFNRQP 448

Query: 477 SLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVK 536
           SLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V 
Sbjct: 449 SLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP 508

Query: 537 NNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFD--IPPPS 594
             +++P+S +P +   QD + G   ++ +D+F +  Q+  +L  + D    +D  IP P+
Sbjct: 509 QQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPD----WDGVIPKPT 564

Query: 595 IMKPHYLWTGKQVFSLLIKPSRKSPVVINLDA--KNKVYLPPPKKEYPNEMSQNDGFVLI 652
           I+KP  LW+GKQ+ S+ I      P  I+L    +   YL P          +++G ++I
Sbjct: 565 ILKPKPLWSGKQLLSMAI------PNGIHLQRFDEGTTYLSP----------KDNGMLII 608

Query: 653 RGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGI 712
            G  I+ GV+DK  +G      + + + R+ GP   A+    + K+   +L + GFSIGI
Sbjct: 609 DG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKLFGNIQKVVNYWLLHNGFSIGI 666

Query: 713 NDVTPGSDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVR 772
            D        ++  + +  A  +  E+        L  + G    ++ E  +   L++ R
Sbjct: 667 GDTIADEKTMREITEAIALAKKRVQEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEAR 726

Query: 773 EEVGEVCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPH 832
           ++ G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPH
Sbjct: 727 DKAGRSAELNLRDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPH 786

Query: 833 FPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLE 892
           F K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LE
Sbjct: 787 FSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALE 846

Query: 893 DLSCQYDNTVRTSSNGIVQFTYGGDGLDPLDME 925
           D+   YD T R S   I+QF YG DG+D   +E
Sbjct: 847 DIMVHYDGTTRNSLGNIIQFVYGEDGMDASHIE 879

 Score =  185 bits (469), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 135/416 (32%), Positives = 209/416 (50%), Gaps = 51/416 (12%)

Query: 1059 KISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT 1118
            +++K   Q  L+   +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT
Sbjct: 1036 RLTKQTFQWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVT 1095

Query: 1119 LGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVSFYVQDIYR 1176
             GVPR+KEI+N +K + TP +   L  D   D+  A++++  +E T L  V+   +  Y 
Sbjct: 1096 SGVPRLKEILNVAKNMKTPSLTVYLNEDYAADQEKAKLIRSAIEHTTLKSVTVSSEIYYD 1155

Query: 1177 DNMAFLQIKIDSETIEK--------------------LQLELTL-----EDIVVAIAKAP 1211
             + +   I+ D E I+                     L+LEL       +D+ +      
Sbjct: 1156 PDPSSTVIEEDEEIIQLHFSLMDEETENSLKHQSPWLLRLELDRAAMNDKDLTMGQVGEK 1215

Query: 1212 KLKIGTNDISIIGKDK------INIAVSSDGKSMKSISTAMKEPEPNEVFYRMQQLRRAL 1265
              +   ND+ +I  +       I   V  D K++     A  E E + +  +++     L
Sbjct: 1216 IKETFKNDLFVIWSEDNAENLIIRCRVVRDPKTLD----AEAEAEEDHMLKKIENT--ML 1269

Query: 1266 PHIVVKGFSDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKTK 1313
              I ++G  DI+R V+   D       G+        L  +G  L +VMT  GV  ++  
Sbjct: 1270 ESITLRGVQDITRVVMMKYDRKVPNETGEYHKVPEWVLETDGVNLSEVMTVPGVDPTRIY 1329

Query: 1314 TNHILEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFG 1373
            TN  +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G
Sbjct: 1330 TNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHG 1389

Query: 1374 LAKMRDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
              +     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1390 FNRADTGALMRCSFEETVEILFEAGASAELDDCNGVSENVILGQMAPIGTGAFDVM 1445

>ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highly
           similar to uniprot|P04050 Saccharomyces cerevisiae
           YDL140C
          Length = 1744

 Score =  575 bits (1482), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 363/928 (39%), Positives = 512/928 (55%), Gaps = 62/928 (6%)

Query: 9   AP-KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAEC 67
           AP + +K + F   S  +I + S  +I   +  D    R AK GG  DPR+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEICAISVAKIKFPETMDETQTR-AKIGGLNDPRLGSIDRSLKC 67

Query: 68  TTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTEL 127
            TC   +  C GHFGHI+LA PVFH+G+     ++ + VC  CG LLL E +      E 
Sbjct: 68  QTCQEGMNECPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHN------EQ 121

Query: 128 RRPGM---DNLRRMNILKKILDQCKKQRRCFE--CGELNXXXXXXXXXXXXXXLKIIHDT 182
            R  +   D+ +R N +  +   CK +  C      + +                I  D 
Sbjct: 122 MRQAIKIKDSKKRFNAVWSL---CKAKMICDTDVPSDEDPTQLISRGGCGNAQPTIRRDG 178

Query: 183 FRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCELL 242
            + VG   + +K++  GD       N E E+ V      LN  ++LN+FK I P D   L
Sbjct: 179 LKLVG---SWKKDKNSGD-------NEEPEQRV------LNMEEILNIFKHISPEDSWKL 222

Query: 243 GIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
           G +   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223 GFNE--EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303 LEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGRF 362
              G   + + E    LQ  VA Y+++D          SG   +P++    RLKGK+GR 
Sbjct: 280 EHNGAPHHTIEEAESLLQFHVATYMDNDIAGQPQALQKSG---RPVKSIRARLKGKEGRI 336

Query: 363 RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVINGP 422
           RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  LV NGP
Sbjct: 337 RGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTMLVRNGP 396

Query: 423 KVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHRLS 482
             HPGA Y+++ N D R +LRY  R     QLQYG  VERH+ D D VLFNRQPSLH++S
Sbjct: 397 NEHPGAKYVIRDNGD-RIDLRYSKRAG-DIQLQYGWKVERHVIDNDPVLFNRQPSLHKMS 454

Query: 483 ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTP 542
           +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P
Sbjct: 455 MMAHKVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIVSP 514

Query: 543 KSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHYLW 602
           +S +P +   QD + G   ++ +D+F +  Q+  +L  + D +    IP P+I+KP  LW
Sbjct: 515 QSNKPCMGVVQDTLCGIRKLTLRDNFIELGQVLNMLYWVPDWDGV--IPTPAILKPKPLW 572

Query: 603 TGKQVFSLLIKPSRKSPVVINLDAKNK-VYLPPPKKEYPNEMSQNDGFVLIRGSNILSGV 661
           TGKQ+ S+ I      P  I+L   ++   L  PK         ++G ++I G  I+ GV
Sbjct: 573 TGKQLLSVAI------PKGIHLQRFDEGTTLLSPK---------DNGMLVIDG-QIIFGV 616

Query: 662 MDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGIND-VTPGSD 720
           +DK  +G      + + + R+ GP   A   + + K+   +  + GFS GI D +  G  
Sbjct: 617 VDKKTVGSSSG-GLIHVVTREKGPQVCATLFSNIQKVVNYWFLHCGFSTGIGDTIADGQT 675

Query: 721 LKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
           ++Q  E + E A  K +++        L  + G    ++ E  +   L++ R++ G +  
Sbjct: 676 MRQITEAIAE-AKVKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRLAE 734

Query: 781 RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840
             L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P
Sbjct: 735 VNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSP 794

Query: 841 QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900
           +SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD 
Sbjct: 795 ESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDG 854

Query: 901 TVRTSSNGIVQFTYGGDGLDPLDMEGNA 928
           T R S   I+QF YG DG+D   +E  A
Sbjct: 855 TTRNSLGNIIQFIYGEDGMDAAHIEKQA 882

 Score =  182 bits (462), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 132/394 (33%), Positives = 202/394 (51%), Gaps = 40/394 (10%)

Query: 1075 KYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVI 1134
            ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K +
Sbjct: 1052 QFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNM 1111

Query: 1135 STPIINAVLVND--NDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIE 1192
             TP + A L  D   D+  A++++  +E T L  V+   +  Y  +     I  D E I+
Sbjct: 1112 KTPSLTAYLEPDYAADQEKAKLIRSVIEHTTLKSVTVASEIYYDPDPRSTAIPEDEEIIQ 1171

Query: 1193 KLQLELTLEDIVVAIAK-APKL------KIGTND-----------ISIIGKDKINIAVSS 1234
             L   L  ++   ++A+ +P L      +   ND           I    K+ + +  S 
Sbjct: 1172 -LHFSLLDDETEKSLAQQSPWLLRLELDRAAMNDKDLTMGQVGEKIKETFKNDLFVIWSE 1230

Query: 1235 DGKSMKSISTAMKEPEPNEVFYRMQQ---LRR----ALPHIVVKGFSDISRAVINIRD-- 1285
            D      I   +  P+  ++    ++   L++     L +I ++G  +I R V+   D  
Sbjct: 1231 DNAEQLIIRCRVVRPKSMDLETEAEEDHMLKKIENTMLENITLRGVENIERVVMMKYDRK 1290

Query: 1286 ----DGKRE------LLVEGYGLRDVMTTDGVIGSKTKTNHILEVYDVLGIEAARSCIIN 1335
                 G+ +      L  +G  L +VMT  GV  S+  TN  +++ +VLGIEA R+ +  
Sbjct: 1291 VPSETGEYQKIPEWVLETDGVNLSEVMTVPGVDASRIYTNSFIDIMEVLGIEAGRAALYK 1350

Query: 1336 EIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVLQLASFEKTTDHLF 1395
            E+   +++ G  V+ RH+ LL DVMT +G +  +TR G  +     L   SFE+T + LF
Sbjct: 1351 EVFNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILF 1410

Query: 1396 DAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            +A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1411 EAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL140C
           (RPO21)
          Length = 1745

 Score =  573 bits (1477), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 357/928 (38%), Positives = 504/928 (54%), Gaps = 73/928 (7%)

Query: 11  KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTC 70
           + IK + F   S  ++ + S  +I   +  D    R AK GG  DPR+G      +C TC
Sbjct: 12  RTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMR-AKVGGLNDPRLGSIDRNFKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELRRP 130
              +  C GHFGHI+LA PVFH+G+     ++ + VC  CG LLL E        EL R 
Sbjct: 71  GEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE------YNELMRQ 124

Query: 131 GM---DNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIHDTFRWVG 187
            +   D  RR N +  +   CK +  C                     +    D  +++ 
Sbjct: 125 AIKIKDPKRRFNAVWSL---CKAKMVC------------------DTEVPSEDDPSKYIS 163

Query: 188 KKSAPEKE--------QWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDC 239
           +      +          +G WK+  +N  + ++  KR    ++  ++LN+FK I P D 
Sbjct: 164 RGGCGNAQPSIRKDGLSLVGTWKKD-KNAEDADQPEKRI---ISAEEILNVFKHISPEDS 219

Query: 240 ELLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLI 299
             LG +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+  +  +
Sbjct: 220 WRLGFNE--DFSRPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINV 276

Query: 300 KAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQ 359
           +     G   + + E    LQ  VA Y+++D          SG   +PI+    RLKGK+
Sbjct: 277 QRLEINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSG---RPIKSIRARLKGKE 333

Query: 360 GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVI 419
           GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV 
Sbjct: 334 GRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVR 393

Query: 420 NGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLH 479
           NGP  HPGA Y+++ N D R +LRY  R     QLQYG  VERHI D D VLFNRQPSLH
Sbjct: 394 NGPNEHPGAKYVIRDNGD-RIDLRYSKRAG-DIQLQYGWKVERHIMDDDPVLFNRQPSLH 451

Query: 480 RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 539
           ++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +
Sbjct: 452 KMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQI 511

Query: 540 LTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPH 599
           ++P+S +P +   QD + G   ++ +D+F +  Q+  +L  + D +    IP P+I+KP 
Sbjct: 512 VSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPTPTILKPK 569

Query: 600 YLWTGKQVFSLLIKPSRKSPVVINLDA--KNKVYLPPPKKEYPNEMSQNDGFVLIRGSNI 657
            LW+GKQ+ S+ I      P  I+L    +   YL P          +++G ++I G  I
Sbjct: 570 PLWSGKQLLSMAI------PSGIHLQRFDEGTTYLSP----------KDNGMLIIDG-QI 612

Query: 658 LSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTP 717
           + GV+DK  +G      + + + R+ GP   A+    + K+   +L + GFSIGI D   
Sbjct: 613 IFGVVDKKTVGSSSG-GLIHVVTREKGPEVCAKLFGNIQKVVNYWLLHNGFSIGIGDTIA 671

Query: 718 GSDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
                ++    +  A  K +E+        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672 DEKTMREITDAIALAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGR 731

Query: 778 VCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 837
                L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732 SAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDD 791

Query: 838 KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 897
            +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792 YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 898 YDNTVRTSSNGIVQFTYGGDGLDPLDME 925
           YD T R S   I+QF YG DG+D   +E
Sbjct: 852 YDGTTRNSLGNIIQFVYGEDGMDAAHIE 879

 Score =  182 bits (463), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 132/416 (31%), Positives = 209/416 (50%), Gaps = 51/416 (12%)

Query: 1059 KISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT 1118
            +++K   +  L+   +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT
Sbjct: 1036 RLTKQTFEWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVT 1095

Query: 1119 LGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVSFYVQDIYR 1176
             GVPR+KEI+N +K + TP +   L      D+  A++++  +E T L  V    +  Y 
Sbjct: 1096 SGVPRLKEILNVAKNMKTPSLTVYLEESYATDQEKAKLIRSAIEHTTLKSVPVASEIYYD 1155

Query: 1177 DNMAFLQIKIDSETIE----------------------KLQLE---LTLEDIVVAIAKAP 1211
             + +   I+ D E I+                      +L+L+   +T +D+ +      
Sbjct: 1156 PDPSSTVIEEDEEIIQLHFSLMDEETEASLKHQSPWLLRLELDRVAMTDKDLTMGQVGEK 1215

Query: 1212 KLKIGTNDISIIGKDK------INIAVSSDGKSMKSISTAMKEPEPNEVFYRMQQLRRAL 1265
              +   ND+ +I  +       I   V  D K++     A  E E + +  +++     L
Sbjct: 1216 IKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLD----AEAEAEEDHMLKKIENT--ML 1269

Query: 1266 PHIVVKGFSDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKTK 1313
              I ++G  DI+R V+   D       G+        L  +G  L +VM+  GV  ++  
Sbjct: 1270 ESITLRGVQDITRVVMMKYDRKVPSETGEYHKIPEWVLETDGVNLSEVMSVPGVDPTRIY 1329

Query: 1314 TNHILEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFG 1373
            TN  +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G
Sbjct: 1330 TNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHG 1389

Query: 1374 LAKMRDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
              +     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGSF V+
Sbjct: 1390 FNRADTGALMRCSFEETVEILFEAGAAAELDDCSGVSENVILGQMAPIGTGSFDVM 1445

>KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1721

 Score =  572 bits (1475), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 354/922 (38%), Positives = 508/922 (55%), Gaps = 72/922 (7%)

Query: 11  KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTC 70
           + +K + F   S  ++ + S  +I   +  D    R AK GG  DPR+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIKFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKR-KFLTELRR 129
              ++ C GHFGHI LA PVFHVG+     ++ + VC  CG LLL E +++ + +  ++ 
Sbjct: 71  QEGMSECPGHFGHIDLAKPVFHVGFITKIKKVCECVCMHCGKLLLDENNEQMRQVMAIKD 130

Query: 130 PGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIHDTFRWVGKK 189
           P     +R N    +   CK +  C                     +   +D  + V + 
Sbjct: 131 PK----KRFNATWAL---CKTKMVC------------------ETDVPSENDPTKLVSRG 165

Query: 190 SAPEKE--------QWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCEL 241
                +        + +G WK+  +   E E   +R    L+  ++LN+FK I   D   
Sbjct: 166 GCGNTQPTVRKDGLKLVGSWKR--KKTIEGEEPEQRV---LSTEEILNIFKHISTEDFIR 220

Query: 242 LGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKA 301
           LG +   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++ 
Sbjct: 221 LGFNE--EFSRPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 277

Query: 302 GLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGR 361
               G   + + E    LQ  VA Y+++D          SG   +P++    RLKGK+GR
Sbjct: 278 LEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG---RPVKSIRARLKGKEGR 334

Query: 362 FRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVING 421
            RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QLV NG
Sbjct: 335 IRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNG 394

Query: 422 PKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHRL 481
           P  HPGA Y++++N D R +LRY  R     QLQYG  VERHI D D VLFNRQPSLH++
Sbjct: 395 PNEHPGAKYVIRENGD-RIDLRYSKRAGDV-QLQYGWKVERHIMDDDPVLFNRQPSLHKM 452

Query: 482 SILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLT 541
           S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++
Sbjct: 453 SMMAHKVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS 512

Query: 542 PKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFD--IPPPSIMKPH 599
           P+S +P +   QD + G  +++ +D+F +   +  +L  + D    +D  IP P+I+KP 
Sbjct: 513 PQSNKPCMGIVQDTLCGIRILTLRDTFLELDHVLNMLYWVPD----WDGVIPTPAILKPK 568

Query: 600 YLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILS 659
            LWTGKQ+ S+ I      P  I+L   +         E    +S  D  +LI    I+ 
Sbjct: 569 PLWTGKQILSVAI------PNGIHLQRFD---------EGTTLLSPKDNGMLIIDGQIIF 613

Query: 660 GVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGIND-VTPG 718
           GV+DK  +G      + + + R+ GP   A+    + K+   +L + GFS GI D +  G
Sbjct: 614 GVVDKKTVGSSSG-GLIHVVTREKGPQTCARLFGNIQKVVNFWLLHNGFSTGIGDTIADG 672

Query: 719 SDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
           + +K+  E + E A  K +E+        L  + G    ++ E  +   L++ R++ G +
Sbjct: 673 ATIKEITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 731

Query: 779 CIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 838
               L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 732 AEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDY 791

Query: 839 TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 898
           +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 792 SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 851

Query: 899 DNTVRTSSNGIVQFTYGGDGLD 920
           DNT R S   ++QF YG DG+D
Sbjct: 852 DNTTRNSLGNVIQFIYGEDGID 873

 Score =  178 bits (452), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 128/397 (32%), Positives = 202/397 (50%), Gaps = 44/397 (11%)

Query: 1074 SKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKV 1133
            +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K 
Sbjct: 1050 AQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKN 1109

Query: 1134 ISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETI 1191
            + TP +   L +D  +D+  A++++  +E T L  V+    +IY D      +  + E I
Sbjct: 1110 MKTPSLTVYLKDDYSSDQEKAKLIRSAIEHTTLKSVTV-ASEIYYDPDPRSTVIEEDEEI 1168

Query: 1192 EKLQLELTLEDIVVAI-AKAPKL------KIGTND-----------ISIIGKDKINIAVS 1233
             +L   L  +++  ++  ++P L      +   ND           I    K+ + +  S
Sbjct: 1169 IQLHFSLLDDEMESSLDQQSPWLLRLELDRAAMNDKDLTMGQVGERIKETFKNDLFVIWS 1228

Query: 1234 SDGKSMKSIST---------AMKEPEPNEVFYRMQQLRRALPHIVVKGFSDISRAVINIR 1284
             D      I           A  E E + +  +++     L +I ++G  +I R V+   
Sbjct: 1229 EDNAEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENT--MLENITLRGVENIERVVMMKY 1286

Query: 1285 D------DGKRE------LLVEGYGLRDVMTTDGVIGSKTKTNHILEVYDVLGIEAARSC 1332
            D       G+ +      L  +G  L +VM   GV  ++  TN  +++ +VLGIEA R+ 
Sbjct: 1287 DRKVPNESGEYQKVPEWVLESDGVNLAEVMQVPGVDATRIYTNSFIDIMEVLGIEAGRAA 1346

Query: 1333 IINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVLQLASFEKTTD 1392
            +  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G  +     L   SFE+T +
Sbjct: 1347 LYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVE 1406

Query: 1393 HLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
             LF+A    + D   GVSE ++LGQ   IGTG+F V+
Sbjct: 1407 ILFEAGAAAELDDCRGVSENVLLGQMAPIGTGAFDVM 1443

>TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1719

 Score =  572 bits (1474), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 359/925 (38%), Positives = 506/925 (54%), Gaps = 62/925 (6%)

Query: 9   AP-KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAEC 67
           AP + +K + F   S  ++ S S  +I   +  D    R AK GG  DPR+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRSISVAKIKFPETMDETQTR-AKIGGLNDPRLGSIDRNLKC 67

Query: 68  TTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSE--EDKRKFLT 125
            TC   +  C GHFGHI LA PVFH+G+     ++ + +C  CG LLL E  E  R+ ++
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDENNEQMRQVMS 127

Query: 126 ELRRPGMDNLRRMNILKKILDQCKKQRRCFE--CGELNXXXXXXXXXXXXXXLKIIHDTF 183
                  D+ +R N +  +   CK +  C      E +                I  D  
Sbjct: 128 I-----KDSKKRFNAIWTL---CKTKTVCETDVPSEDDPTQLISRGGCGNAQPTIRKDGL 179

Query: 184 RWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCELLG 243
           + VG         W  D  +   +  E E+ V      LN  ++LN+FK I  +D   LG
Sbjct: 180 KLVGS--------WKKD--KATNDGDEPEQRV------LNTEEILNIFKHISVHDSNTLG 223

Query: 244 IDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGL 303
            +   +  RP+  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++   
Sbjct: 224 FNE--QFARPDWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLE 280

Query: 304 EKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGRFR 363
             G   + + E    LQ  +A Y+++D          SG   +P++    RLKGK+GR R
Sbjct: 281 HNGAPHHAIEEAESLLQFHIATYMDNDIAGQPQALQKSG---RPVKSIRARLKGKEGRIR 337

Query: 364 GNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVINGPK 423
           GNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGP 
Sbjct: 338 GNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPN 397

Query: 424 VHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHRLSI 483
            HPGA Y+++ N D R +LRY  R     QLQYG  VERHI D D VLFNRQPSLH++S+
Sbjct: 398 EHPGAKYVIRDNGD-RIDLRYSKRAG-DIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSM 455

Query: 484 LSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPK 543
           ++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+
Sbjct: 456 MAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCSVPLQIVSPQ 515

Query: 544 SGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFD--IPPPSIMKPHYL 601
           S +P +   QD + G   ++ +D F +  QL  +L  + D    +D  IP P+I+KP  L
Sbjct: 516 SNKPCMGIVQDTLCGIRKLTLRDCFIELDQLLNMLYWVPD----WDGIIPTPAIIKPVPL 571

Query: 602 WTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSGV 661
           W+GKQ+ S+ I      P  I+L   +         E    +S  D  +LI    I+ GV
Sbjct: 572 WSGKQILSIAI------PKGIHLQRFD---------EGTTMLSPKDNGMLIIDGQIIFGV 616

Query: 662 MDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGIND-VTPGSD 720
           +DK  +G      + + + R+ GP   A+    + K+   +  + GFS GI D +  G  
Sbjct: 617 VDKKTVGSSNG-GLIHVVTREKGPQICAKMFGNIQKVVNFWFLHNGFSTGIGDTIADGGT 675

Query: 721 LKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
           +K+  E + + A  K +E+        L  + G    ++ E  +   L++ R++ G +  
Sbjct: 676 MKEITETIAD-AKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAE 734

Query: 781 RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840
             L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P
Sbjct: 735 VNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSP 794

Query: 841 QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900
           +SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD+
Sbjct: 795 ESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDS 854

Query: 901 TVRTSSNGIVQFTYGGDGLDPLDME 925
           T R S   ++QF YG DG+D   +E
Sbjct: 855 TTRNSLGNVIQFVYGEDGIDAGHIE 879

 Score =  187 bits (474), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 142/418 (33%), Positives = 214/418 (51%), Gaps = 50/418 (11%)

Query: 1056 QLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1115
            Q  +++K   Q  L+   S++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 QEYRLTKQAFQWVLNNIESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1116 NVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVSFYVQD 1173
             VT GVPR+KEI+N +K + TP     L  +   D+  A++++  +E T L  V+    +
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSSTVYLDPEYATDQEKAKIIRSAIEHTTLKSVTV-ASE 1151

Query: 1174 IYRD----------NMAFLQIK---IDSETIEKLQ------LELTLEDIVVAIAKAPKLK 1214
            IY D          +   +Q+    +DSET + +       L L L+   +       ++
Sbjct: 1152 IYYDPDPTTTVIAEDEEIIQLHYSLMDSETEKNIDNQSPWLLRLELDRAAMNDKDLTMVQ 1211

Query: 1215 IGT-------NDISII----GKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRMQQLRR 1263
            +G        ND+S+I      DK+ I         KS+  A  E E + +  +++    
Sbjct: 1212 VGEKIKETFRNDLSVIWSEDNADKLIIRCRV--VRPKSLD-AETEAEEDHMLKKIENT-- 1266

Query: 1264 ALPHIVVKGFSDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSK 1311
             L  I ++G  DI R V+   D       G+ +      L  +G  L +VMT  GV GS+
Sbjct: 1267 MLESITLRGVEDIERVVMMKYDRKMPSETGEYQKVPEWVLETDGVNLMEVMTVPGVDGSR 1326

Query: 1312 TKTNHILEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITR 1371
              TN  +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT +G +  +TR
Sbjct: 1327 IYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTR 1386

Query: 1372 FGLAKMRDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
             G  +     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1387 HGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa]
           {ON} highly similar to uniprot|P04050 Saccharomyces
           cerevisiae YDL140C
          Length = 1720

 Score =  572 bits (1473), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 357/939 (38%), Positives = 510/939 (54%), Gaps = 102/939 (10%)

Query: 8   IAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAEC 67
            +P++++GIS + +   + + +S+++              AK GG  DPR+G      +C
Sbjct: 22  FSPEEVRGISVAKIEFPETMDESQMK--------------AKIGGLNDPRLGSIDRNYKC 67

Query: 68  TTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKR-KFLTE 126
            TC   +A C GHFGHI+LA PVFH+G+     ++ +SVC  CG LLL E +++ +   +
Sbjct: 68  QTCGEGMAECPGHFGHIELAKPVFHIGFLSKIKKVCESVCMHCGKLLLDEYNEQMRQAIK 127

Query: 127 LRRPGMDNLRRMNILKKILDQCKKQRRCFE----------------CGELNXXXXXXXXX 170
           ++ P     RR N +  +   CK +  C                  CG +          
Sbjct: 128 IKDPK----RRFNAVWTL---CKAKMVCETEVPSPDDPTVFLSRGGCGHIQP-------- 172

Query: 171 XXXXXLKIIHDTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNL 230
                  I  D    VG         W  D      + PE     KR    ++  ++LN+
Sbjct: 173 ------SIRKDGLSLVGT--------WKKDKNADDSDQPE-----KRI---ISAEEILNV 210

Query: 231 FKQIKPNDCELLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLT 290
           FK I P D   LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL 
Sbjct: 211 FKHISPEDGWRLGFNE--DFSRPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLG 267

Query: 291 EIVWTSSLIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRG 350
           +I+  +  ++     G   + + E    LQ  VA Y+++D          SG   +PI+ 
Sbjct: 268 DILKANINVQKLEINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSG---RPIKS 324

Query: 351 FCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYN 410
              RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN
Sbjct: 325 IRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYN 384

Query: 411 KHKLQQLVINGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVV 470
             +L QLV NGP  HPGA Y+++++ D R +LRY  R     QLQYG  VERHI D D V
Sbjct: 385 IDRLTQLVRNGPNEHPGAKYVIRESGD-RIDLRYSKRAG-DIQLQYGWKVERHITDNDPV 442

Query: 471 LFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAI 530
           LFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE  
Sbjct: 443 LFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELS 502

Query: 531 NLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFD- 589
            L  V   +++P+S +P +   QD + G   ++ +D+F +  Q+  +L  + D    +D 
Sbjct: 503 QLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKMTLRDTFIELDQVLNMLYWIPD----WDG 558

Query: 590 -IPPPSIMKPHYLWTGKQVFSLLIKPSRKSPVVINLDA--KNKVYLPPPKKEYPNEMSQN 646
            IP P+I+KP  LW+GKQV S+ I      P  I+L        +L P          ++
Sbjct: 559 IIPTPAILKPVPLWSGKQVLSMAI------PNGIHLQRFDDGTTFLSP----------KD 602

Query: 647 DGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNR 706
           +G ++I G  I+ GV+DK  +G      + + + R+ GP   A+  + + K+   +L + 
Sbjct: 603 NGMLIIDG-KIIFGVVDKKTVGSSSG-GLIHVVTREKGPEICARLFSNIQKVVNYWLLHN 660

Query: 707 GFSIGINDVTPGSDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGG 766
           GFSIGI D        ++  + +  A  K +++        L  + G    ++ E  +  
Sbjct: 661 GFSIGIGDTIADEKTMREITEAIAVAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVR 720

Query: 767 LLSKVREEVGEVCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQ 826
            L++ R++ G      L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF 
Sbjct: 721 YLNEARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFA 780

Query: 827 DRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRR 886
           DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RR
Sbjct: 781 DRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRR 840

Query: 887 LMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLDME 925
           L+K+LED+   YD T R S   ++QF YG DG+D   +E
Sbjct: 841 LVKALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE 879

 Score =  185 bits (470), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 136/401 (33%), Positives = 207/401 (51%), Gaps = 51/401 (12%)

Query: 1074 SKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKV 1133
            +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K 
Sbjct: 1051 AQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKN 1110

Query: 1134 ISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVS-----FYVQD----IYRDNMAFL 1182
            + TP +   L  +   D+  A+ ++  +E T L  V+     +Y  D    +  D+   +
Sbjct: 1111 MKTPSLTVYLDPEYAADQEKAKEIRSAIEHTTLKSVTVASEIYYDPDPRSTVIEDDEEII 1170

Query: 1183 QIK---IDSETIEKL--------QLEL-----TLEDIVVAIAKAPKLKIGTNDISIIGKD 1226
            Q+    +D ET + L        +LEL     T +D+ +        +   ND+ +I  +
Sbjct: 1171 QLHFSLMDEETEKSLDYQSPWLLRLELDRAAMTDKDLTMGQVGEKIKETFKNDLFVIWSE 1230

Query: 1227 K------INIAVSSDGKSMKSISTAMKEPEPNEVFYRMQQLRRALPHIVVKGFSDISRAV 1280
                   I   V  D K++     A  E E + +  +++     L  I ++G  DI+R V
Sbjct: 1231 DNAEKLIIRCRVIRDPKTLD----ADVEAEEDHMLKKIEN--SMLEKITLRGVEDITRVV 1284

Query: 1281 INIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKTKTNHILEVYDVLGIEA 1328
            +   D       G+        L  +G  L +VMT  GV GS+  TN  +++ +VLGIEA
Sbjct: 1285 MMKYDRKVPSETGEYHKVPEWVLETDGVNLSEVMTVSGVDGSRIYTNSFIDIMNVLGIEA 1344

Query: 1329 ARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVLQLASFE 1388
             R+ +  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G  +     L   SFE
Sbjct: 1345 GRAALYREVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFNRADTGALMRCSFE 1404

Query: 1389 KTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            +T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1405 ETVEILFEAGAAAELDDCRGVSENVILGQMAPIGTGAFDVM 1445

>CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa]
           {ON} highly similar to uniprot|P04050 Saccharomyces
           cerevisiae YDL140c RPO21 DNA-directed RNA polymerase II
          Length = 1715

 Score =  570 bits (1470), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 358/920 (38%), Positives = 511/920 (55%), Gaps = 57/920 (6%)

Query: 11  KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTC 70
           + +K + F   S  +I + S  +I   +  D    R AK GG  DPR+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEIRAISVAKIRLPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKR-KFLTELRR 129
              +  C GHFGHI LA PVFH+G+     ++ +S+C  CG LLL E +++ +   +++ 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCESLCMHCGKLLLDEHNEQMRQAIQIKD 130

Query: 130 PGMDNLRRMNILKKILDQCKKQRRCFE--CGELNXXXXXXXXXXXXXXLKIIHDTFRWVG 187
           P     +R N +  +   CK +  C      E +                I  D  + VG
Sbjct: 131 PK----KRFNAVWSL---CKTKMVCETDVPSEDDPTKLISRGGCGNTQPTIRKDGLKLVG 183

Query: 188 KKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCELLGIDST 247
              + +K++  GD      + PE     +R    L+  ++LN+FK I P D   LG +  
Sbjct: 184 ---SWKKDKSTGD-----ADEPE-----QRV---LSTEEILNIFKHISPEDSYRLGFNE- 226

Query: 248 SKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKGI 307
            +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     G 
Sbjct: 227 -EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGA 284

Query: 308 SINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGRFRGNLS 367
             + + E    LQ  VA Y+++D          SG   +P++    RLKGK+GR RGNL 
Sbjct: 285 PHHAVEEAESLLQFHVATYMDNDIAGQPQALQKSG---RPVKSIRARLKGKEGRIRGNLM 341

Query: 368 GKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVINGPKVHPG 427
           GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QLV NGP  HPG
Sbjct: 342 GKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLSQLVRNGPNEHPG 401

Query: 428 ANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHRLSILSHY 487
           A Y+++ N D R +LRY  R     QLQYG  VERHI D D VLFNRQPSLH++S+++H 
Sbjct: 402 AKYVIRDNGD-RIDLRYSKRSGDV-QLQYGWKVERHIMDDDPVLFNRQPSLHKMSMMAHR 459

Query: 488 AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEP 547
            K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +P
Sbjct: 460 VKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKP 519

Query: 548 IIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHYLWTGKQV 607
            +   QD + G   ++ +D+F +  Q+  +L  + D +    IP P+I+KP  LW+GKQ+
Sbjct: 520 CMGIVQDTLCGIRKLTLRDTFLEFDQVLNMLYWVPDWDGV--IPTPAIIKPKPLWSGKQI 577

Query: 608 FSLLIKPSRKSPVVINLDAKNK-VYLPPPKKEYPNEMSQNDGFVLIRGSNILSGVMDKSV 666
            S+ I      P  I+L   ++   L  PK         ++G ++I G  I+ GV+DK  
Sbjct: 578 LSVAI------PKGIHLQRFDEGTTLLSPK---------DNGMLVIDG-EIIFGVVDKKT 621

Query: 667 LGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGIND-VTPGSDLKQKK 725
           +G      + + + R+ GP   A+    + K+   +L + GFS GI D V  G  +++  
Sbjct: 622 VGSSSG-GLIHVVTREKGPTICARLFGNIQKVVNFWLLHNGFSTGIGDTVADGQTMREIS 680

Query: 726 EQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDN 785
           E + E A  K + +        L  + G    ++ E  +   L++ R+  G +    L +
Sbjct: 681 ETIAE-AKQKVEAVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDRAGRLAEMNLKD 739

Query: 786 LNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGF 845
           LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKGF
Sbjct: 740 LNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDYSPESKGF 799

Query: 846 VRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTS 905
           V NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T R S
Sbjct: 800 VENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTRNS 859

Query: 906 SNGIVQFTYGGDGLDPLDME 925
              ++QF YG DG+D   +E
Sbjct: 860 LGNVIQFIYGEDGMDAGHIE 879

 Score =  175 bits (443), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 135/417 (32%), Positives = 205/417 (49%), Gaps = 48/417 (11%)

Query: 1056 QLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1115
            Q  +++K   +  L+   +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 QEYRLTKEAFEWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1116 NVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVSFYVQD 1173
             VT GVPR+KEI+N +K + TP +   L  +   D+  A++V+  +E T L  V+   + 
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLEPEYSADQEKAKLVRSAIEHTTLKSVTVASEI 1152

Query: 1174 IYRDNMAFLQIKIDSETIEKLQLELTL---EDIVVAIAKAPKL------KIGTND----- 1219
             Y  +     I  D E I   QL  +L   E   +   ++P L      +   ND     
Sbjct: 1153 YYDPDPRSTVIPEDDEII---QLHFSLLDDETEKLLDQQSPWLLRLELDRAAMNDKDLTM 1209

Query: 1220 ------ISIIGKDKINIAVSSDGKSMKSIST---------AMKEPEPNEVFYRMQQLRRA 1264
                  I    K+ + +  S D      I           A  E E + +  +++     
Sbjct: 1210 GQVGERIKDTFKNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEEDHMLKKIENT--M 1267

Query: 1265 LPHIVVKGFSDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKT 1312
            L +I ++G   I R V+   D       G+ +      L  +G  L +VMT  GV  ++ 
Sbjct: 1268 LENITLRGIEGIERVVMMKYDRKVPNETGEYQKVPEWVLETDGVNLSEVMTVPGVDPTRI 1327

Query: 1313 KTNHILEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRF 1372
             TN  +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT +G +  +TR 
Sbjct: 1328 YTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRH 1387

Query: 1373 GLAKMRDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            G  +     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1388 GFNRSSTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON}
           Anc_7.314
          Length = 1716

 Score =  569 bits (1467), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 360/925 (38%), Positives = 508/925 (54%), Gaps = 62/925 (6%)

Query: 9   AP-KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAEC 67
           AP + +K + F   S  ++   S  +I   +  D    R AK GG  DPR+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRGISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKC 67

Query: 68  TTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTEL 127
            TC   +  C GHFGHI LA PVFHVG+     ++ +SVC  CG LLL E +      E 
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCESVCMHCGKLLLDEHN------EQ 121

Query: 128 RRPGM---DNLRRMNILKKILDQCKKQRRCFE--CGELNXXXXXXXXXXXXXXLKIIHDT 182
            R  M   D+ +R N +  +   CK +  C      + +                I  D 
Sbjct: 122 MRQAMAIKDSKKRFNAVWTL---CKTKMICETDVPSDDDPTTLISRGGCGNAQPSIRKDG 178

Query: 183 FRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCELL 242
            + VG             WK+  +N  + +   +R    L+  ++LN+FK I P D   +
Sbjct: 179 LKLVGS------------WKKE-KNTSDGDEPEQRV---LSTEEILNIFKHISPEDSTRM 222

Query: 243 GIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAG 302
           G   + +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++  
Sbjct: 223 GF--SEEFARPEWMILCVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303 LEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGRF 362
              G   + + E    LQ  VA Y+++D          SG   +P++    RLKGK+GR 
Sbjct: 280 EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG---RPVKSIRARLKGKEGRI 336

Query: 363 RGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVINGP 422
           RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QLV NGP
Sbjct: 337 RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 423 KVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHRLS 482
             HPGA Y+++ N D R +LRY  R     QLQYG  VERHI D D VLFNRQPSLH++S
Sbjct: 397 NEHPGAKYVIRDNGD-RIDLRYSKRAG-DIQLQYGWKVERHIMDDDPVLFNRQPSLHKMS 454

Query: 483 ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTP 542
           +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++ 
Sbjct: 455 MMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSA 514

Query: 543 KSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHYLW 602
           +S +P +   QD + G   ++ +D+F +  Q+  +L  + D +    IP P+++KP  LW
Sbjct: 515 QSNKPCMGIVQDTLCGIRKLTLRDTFIEFDQVLNMLYWVPDWDGV--IPTPAVLKPKPLW 572

Query: 603 TGKQVFSLLIKPSRKSPVVINLDAKNK-VYLPPPKKEYPNEMSQNDGFVLIRGSNILSGV 661
           TGKQV S  I      P  I+L   ++   L  PK         ++G ++I G  I+ GV
Sbjct: 573 TGKQVLSAAI------PKGIHLQRFDEGTTLLSPK---------DNGMLVIDG-QIIFGV 616

Query: 662 MDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGIND-VTPGSD 720
           +DK  +G      + + + R+ GP   A+    + K+   +L + GFS GI D +  G  
Sbjct: 617 VDKKTVGSSSG-GLIHVVTREKGPTICARLFGNIQKIVNFWLLHNGFSTGIGDTIADGQT 675

Query: 721 LKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
           +K+  E + E A  K +++        L  + G    ++ E  +   L++ R++ G +  
Sbjct: 676 IKEITETIAE-AKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAE 734

Query: 781 RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840
             L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P
Sbjct: 735 VNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDYSP 794

Query: 841 QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900
           +SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD 
Sbjct: 795 ESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDG 854

Query: 901 TVRTSSNGIVQFTYGGDGLDPLDME 925
           T R S   ++QF YG DG+D   +E
Sbjct: 855 TTRNSLGNVIQFIYGEDGIDAAHIE 879

 Score =  181 bits (459), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 135/417 (32%), Positives = 206/417 (49%), Gaps = 48/417 (11%)

Query: 1056 QLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1115
            Q  K++K   Q  L+   S++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 QEYKLTKQAFQWVLNNVESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1116 NVTLGVPRIKEIINASKVISTPIINAVLVN--DNDERAARVVKGRVEKTLLSDVSFYVQD 1173
             VT GVPR+KEI+N +K + TP +   L +   +D+  A+ ++  +E T L  ++   + 
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLKDGYSSDQEKAKFIRSAIEHTTLKSITVASEI 1152

Query: 1174 IYRDNMAFLQIKIDSETIEKLQLELTLEDIVVAIA---KAPKL------KIGTND----- 1219
             Y  +     I  D E I   QL  +L D     +   ++P L      +   ND     
Sbjct: 1153 YYDPDPRSTVIPEDDEII---QLHFSLMDDETEQSLDRQSPWLLRLELDRAAMNDKDLTM 1209

Query: 1220 ------ISIIGKDKINIAVSSDGKSMKSIST---------AMKEPEPNEVFYRMQQLRRA 1264
                  I    K+ + +  S D      I           A  E E + +  +++     
Sbjct: 1210 GQVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENT--M 1267

Query: 1265 LPHIVVKGFSDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKT 1312
            L +I ++G  +I R V+   D       G+ E      L  +G  L +VMT  G+  ++ 
Sbjct: 1268 LENITLRGVENIERVVMMKYDRKVPSATGEYEKVPEWVLETDGVNLSEVMTVPGIDATRI 1327

Query: 1313 KTNHILEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRF 1372
             TN  +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT +G +  +TR 
Sbjct: 1328 YTNSFIDIMEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRH 1387

Query: 1373 GLAKMRDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            G  +     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F V+
Sbjct: 1388 GFNRASTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFDVM 1444

>NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {ON}
           Anc_7.314
          Length = 1729

 Score =  569 bits (1467), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 358/923 (38%), Positives = 506/923 (54%), Gaps = 58/923 (6%)

Query: 9   AP-KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAEC 67
           AP + +K + F   S  ++ + S  +I   +  D    R AK GG  DPR+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKC 67

Query: 68  TTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTEL 127
            TC   +  C GHFGHI LA PV HVG+     ++ +SVC  CG LLL E ++     ++
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVLHVGFIAKIKKVCESVCMHCGKLLLDEHNE-----QM 122

Query: 128 RRPGM--DNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIHDTFRW 185
           R+     D+ +R N    + + CK +     C                        T R 
Sbjct: 123 RQAIAIKDSKKRFN---AVWNLCKTK---MICDTDVPSDDDPTQLISRGGCGNAQPTVRK 176

Query: 186 VGKKSAPEKEQWIGDWKQVLENNP--ELERYVKRCMDDLNPLKVLNLFKQIKPNDCELLG 243
            G K        +G WK+    N   E E+ V      L+  ++LN+FK I P D   LG
Sbjct: 177 DGLK-------LVGSWKKEKNTNDGDEPEQRV------LSTEEILNIFKHISPEDSTRLG 223

Query: 244 IDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGL 303
            +   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++   
Sbjct: 224 FNE--EFARPEWMILNVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLE 280

Query: 304 EKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGRFR 363
             G   + + E    LQ  VA Y+++D          SG   +P++    RLKGK+GR R
Sbjct: 281 HNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG---RPVKSIRARLKGKEGRIR 337

Query: 364 GNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVINGPK 423
           GNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QLV NGP 
Sbjct: 338 GNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGPN 397

Query: 424 VHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHRLSI 483
            HPGA Y+++ N D R +LRY  R     QLQYG  VERHI D D VLFNRQPSLH++S+
Sbjct: 398 EHPGAKYVIRDNGD-RIDLRYSKRAG-DIQLQYGWKVERHITDNDPVLFNRQPSLHKMSM 455

Query: 484 LSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPK 543
           ++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++ +
Sbjct: 456 MAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSAQ 515

Query: 544 SGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHYLWT 603
           S +P +   QD + G   ++ +D+F +  ++  +L  + D +    IP P+I+KP  LW+
Sbjct: 516 SNKPCMGIVQDTLCGIRKLTLRDTFLEFDEVLNMLYWVPDWDGV--IPTPAIIKPKPLWS 573

Query: 604 GKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSGVMD 663
           GKQV S+ I      P  I+L   +         E    +S  D  +L+    I+ GV+D
Sbjct: 574 GKQVLSIAI------PRGIHLQRFD---------EGTTLLSPKDNGMLVVDGQIIFGVVD 618

Query: 664 KSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGIND-VTPGSDLK 722
           K  +G      + + + R+ GP   A+    + K+   +L + GFS GI D +  GS +K
Sbjct: 619 KKTVG-SSNGGLIHVVTREKGPTICAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGSTIK 677

Query: 723 QKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRE 782
           +  E + + A  K +++        L  + G    ++ E  +   L++ R++ G +    
Sbjct: 678 EITETIAD-AKRKVEDVTKEAQSNLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEMN 736

Query: 783 LDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQS 842
           L++LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+S
Sbjct: 737 LNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSKDDYSPES 796

Query: 843 KGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTV 902
           KGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T 
Sbjct: 797 KGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTA 856

Query: 903 RTSSNGIVQFTYGGDGLDPLDME 925
           R S   ++QF YG DG+D   +E
Sbjct: 857 RNSLGNVIQFIYGEDGMDAAHIE 879

 Score =  180 bits (457), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 132/415 (31%), Positives = 213/415 (51%), Gaps = 44/415 (10%)

Query: 1056 QLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1115
            Q  +++K   +  L+   +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 QEYRLTKQAFEWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1116 NVTLGVPRIKEIINASKVISTPIINAVLVND--NDERAARVVKGRVEKTLLSDVSFYVQD 1173
             VT GVPR+KEI+N +K + TP +   L +D  +D+  A+ ++  +E T L  ++    +
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKFIRSAIEHTTLKSITV-ASE 1151

Query: 1174 IYRD----------NMAFLQIK---IDSETIEKLQ------LELTLEDIVVAIAKAPKLK 1214
            IY D          +   +Q+    +D ET + L       L L L+   +        +
Sbjct: 1152 IYYDPDPRSTVIPEDDEIIQLHFSLLDDETEQSLDRQSPWLLRLELDRAAMNDKDLTMGQ 1211

Query: 1215 IGT-------NDISIIGKDKINIAVSSDGKSMKSIST-AMKEPEPNEVFYRMQQLRRALP 1266
            +G        ND+ +I  +     +    + ++  S  A  E E + +  +++     L 
Sbjct: 1212 VGERIKETFRNDLFVIWSEDNAEKLIIRCRVVRPKSMDAETEAEEDHMLKKIENT--MLE 1269

Query: 1267 HIVVKGFSDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKTKT 1314
            +I ++G  +I R V+   D       G+ +      L  +G  L +VMT  GV  ++  T
Sbjct: 1270 NITLRGVENIERVVMMKYDRKVPSQSGEYQKVPEWVLETDGVNLSEVMTVPGVDATRIYT 1329

Query: 1315 NHILEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL 1374
            N  +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT +G +  ITR G 
Sbjct: 1330 NSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGALTSITRHGF 1389

Query: 1375 AKMRDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
             +     L  +SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F V+
Sbjct: 1390 NRASTGALMRSSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFDVM 1444

>Suva_4.104 Chr4
           complement(193257..193711,193754..193782,194161..198878)
           [5202 bp, 1733 aa] {ON} YDL140C (REAL)
          Length = 1733

 Score =  568 bits (1463), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 353/917 (38%), Positives = 493/917 (53%), Gaps = 51/917 (5%)

Query: 11  KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTC 70
           + +K + F   S  ++ + S  +I   +  D    R AK GG  DPR+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELRRP 130
              +  C GHFGHI LA PVFHVG+     ++ + VC  CG LLL E +      EL R 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131 GMDNLRRMNILKKILDQCKKQRRCFE--CGELNXXXXXXXXXXXXXXLKIIHDTFRWVGK 188
            +           I   CK +  C      E +                +  D  + VG 
Sbjct: 125 ALAIKDTKKRFGAIWTLCKTKMVCETDVPSENDPTQLVSRGGCGNTQPTVRKDGLKLVG- 183

Query: 189 KSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCELLGIDSTS 248
             + +K++  GD      + PEL          L+  ++LN+FK I   D   LG +   
Sbjct: 184 --SWKKDRATGD-----ADEPELRV--------LSTEEILNIFKHISAKDSSSLGFNEVF 228

Query: 249 KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKGIS 308
              RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     G  
Sbjct: 229 S--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309 INNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGRFRGNLSG 368
            + + E    LQ  VA Y+++D          SG   +P++    RLKGK+GR RGNL G
Sbjct: 286 HHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG---RPVKSIRARLKGKEGRIRGNLMG 342

Query: 369 KRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVINGPKVHPGA 428
           KRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGP  HPGA
Sbjct: 343 KRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGA 402

Query: 429 NYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHRLSILSHYA 488
            Y+++ + D R +LRY  R     QLQYG  VERHI D D VLFNRQPSLH++S+++H  
Sbjct: 403 KYVIRDSGD-RIDLRYSKRAG-DIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRV 460

Query: 489 KIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPI 548
           K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +P 
Sbjct: 461 KVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPC 520

Query: 549 IAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHYLWTGKQVF 608
           +   QD + G   ++ +D+F +  Q+  +L  + D +    IP P+I+KP  LW+GKQV 
Sbjct: 521 MGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKPLWSGKQVL 578

Query: 609 SLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSGVMDKSVLG 668
           S+ I      P  I+L   +         E    +S  D  +LI    I+ GV++K  +G
Sbjct: 579 SVAI------PNGIHLQRFD---------EGTTLLSPKDNGMLIIDGQIVFGVVEKKTVG 623

Query: 669 DGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGSDLKQKKEQM 728
                 + + + R+ GP   A+    + K+   +L + GFS GI D        ++  + 
Sbjct: 624 SSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITET 682

Query: 729 VESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNA 788
           +  A  K  ++        L  + G    ++ E  +   L++ R++ G +    L +LN 
Sbjct: 683 IADAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLNN 742

Query: 789 PLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRN 848
              M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKGFV N
Sbjct: 743 VKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAYGFVDRTLPHFSKDDYSPESKGFVEN 802

Query: 849 SFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNG 908
           S+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YDNT R S   
Sbjct: 803 SYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGN 862

Query: 909 IVQFTYGGDGLDPLDME 925
           ++QF YG DG+D   +E
Sbjct: 863 VIQFIYGEDGMDASHIE 879

 Score =  177 bits (450), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 132/415 (31%), Positives = 205/415 (49%), Gaps = 44/415 (10%)

Query: 1056 QLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1115
            Q  K++K   +  LS   +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 QEYKLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1116 NVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRVEKTLLSDVSFYVQD 1173
             VT GVPR+KEI+N +K + TP +   L   +  D+  A+ ++  +E T L  V+    +
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEKAKFIRSAIEHTTLKSVTI-ASE 1151

Query: 1174 IYRDNMAFLQIKIDSETIEKLQLELTLEDIVVAI-AKAPKL------KIGTND------- 1219
            IY D      +  + E I +L   L  ++   +   ++P L      +   ND       
Sbjct: 1152 IYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQ 1211

Query: 1220 ----ISIIGKDKINIAVSSDGKSMKSIST---------AMKEPEPNEVFYRMQQLRRALP 1266
                I    K+ + +  S D      I           A  E E + +  +++     L 
Sbjct: 1212 VGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENT--MLE 1269

Query: 1267 HIVVKGFSDISRAVINIRD------------DGKRELLVEGYGLRDVMTTDGVIGSKTKT 1314
            +I ++G  +I R V+   D            + +  L  +G  L +VMT  G+  ++  T
Sbjct: 1270 NITLRGVENIERVVMMKYDRKVPSPTGEYIKEPEWVLETDGVNLSEVMTVPGIDPTRIYT 1329

Query: 1315 NHILEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL 1374
            N  +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G 
Sbjct: 1330 NSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGF 1389

Query: 1375 AKMRDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
             +     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1390 NRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa]
           {ON} highly similar to uniprot|P04050 Saccharomyces
           cerevisiae YDL140C
          Length = 1740

 Score =  568 bits (1463), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 355/928 (38%), Positives = 501/928 (53%), Gaps = 73/928 (7%)

Query: 11  KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTC 70
           + +K + F   S  ++ + S  +I   +  D    R AK GG  DPR+G      +C TC
Sbjct: 12  RTVKEVQFGIFSPEEVRAISVAKIEFPETMDETQMR-AKVGGLNDPRLGSIDRNYKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELRRP 130
              +  C GHFGHI+LA PVFH+GY     ++ + VC  CG LLL E       +EL R 
Sbjct: 71  GEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH------SELMRQ 124

Query: 131 GM---DNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIHDTFRWVG 187
            +   D  RR N +  +   CK +  C                     +   +D  ++V 
Sbjct: 125 AIKIKDPKRRFNAVWSL---CKAKMVC------------------ETEVPSDNDPAQYVS 163

Query: 188 KKSAPEKE--------QWIGDWKQ--VLENNPELERYVKRCMDDLNPLKVLNLFKQIKPN 237
           +      +          +G WK+    ++  + ER V      ++  +VLN+FK I P 
Sbjct: 164 RGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRV------ISADEVLNVFKHISPE 217

Query: 238 DCELLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSS 297
           D   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT KL +I+  + 
Sbjct: 218 DSVRLGFNE--DFARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANI 274

Query: 298 LIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKG 357
            ++     G   + + E    LQ  VA Y+++D          SG   +PI+    RLKG
Sbjct: 275 NVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG---RPIKSIRARLKG 331

Query: 358 KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQL 417
           K+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QL
Sbjct: 332 KEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNIDRLTQL 391

Query: 418 VINGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPS 477
           V NGP  HPGA Y+++ N D R +LRY  R     QLQYG  VERHI D D VLFNRQPS
Sbjct: 392 VRNGPNEHPGAKYIIRDNGD-RIDLRYSKRAG-DIQLQYGWKVERHIIDEDPVLFNRQPS 449

Query: 478 LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 537
           LH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V  
Sbjct: 450 LHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQ 509

Query: 538 NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMK 597
            +++ +S +P +   QD + G   ++ +D+F +  Q+  +L  + D +    IP P I+K
Sbjct: 510 QIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWIPDWDGV--IPTPIILK 567

Query: 598 PHYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNI 657
           P  LW+GKQ+ S+ I      P  I+L   +         E    +S  D  +LI    I
Sbjct: 568 PKPLWSGKQILSIAI------PSGIHLQRFD---------EGTTLLSPKDNGMLIIDGQI 612

Query: 658 LSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTP 717
           + GV+DK  +G      + + + R+ GP   A+  + + K+   +L + GFSIGI D   
Sbjct: 613 IFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQKVVNFWLLHNGFSIGIGDTIA 671

Query: 718 GSDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
                ++  + +  A  K +E+        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672 DEKSMREITEAIIVAKRKVEEVTKEAQANLLTAKHGMTLRESFEDSVVRYLNEARDKAGR 731

Query: 778 VCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 837
                L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732 SAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDD 791

Query: 838 KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 897
            +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792 YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 898 YDNTVRTSSNGIVQFTYGGDGLDPLDME 925
           YD T R S   ++QF YG DG+D   +E
Sbjct: 852 YDGTTRNSLGNVIQFIYGEDGMDAAHIE 879

 Score =  184 bits (467), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 136/419 (32%), Positives = 213/419 (50%), Gaps = 51/419 (12%)

Query: 1056 QLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1115
            Q  +++K   +  LS   S++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 QEYRLNKQTFEWVLSNVESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1116 NVTLGVPRIKEIINASKVISTPIINAVLVNDN--DERAARVVKGRVEKTLLSDVS----- 1168
             VT GVPR+KEI+N +K + TP +   L  D+  D+  A++++  +E T L  ++     
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLDKDHAADQEKAKLIRSAIEHTTLKSITVASEI 1152

Query: 1169 FYVQD----IYRDNMAFLQIK---IDSETIEKLQLE----LTLE---------DIVVAIA 1208
            +Y  D    +  ++   +Q+    +D ET + L  +    L LE         D+ +   
Sbjct: 1153 YYDPDPRSTVIEEDEEIIQLHFSLMDEETEQSLDYQSPWLLRLELDRAAMNDKDLTMGQV 1212

Query: 1209 KAPKLKIGTNDISIIGKDK------INIAVSSDGKSMKSISTAMKEPEPNEVFYRMQQLR 1262
                 +   ND+ +I  +       I   V  D K++     A  E E + +  R++   
Sbjct: 1213 GEKIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLD----AEAEAEEDHMLKRIENT- 1267

Query: 1263 RALPHIVVKGFSDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGS 1310
              L  I ++G  DI+R V+   D       G+        L  +G  L +VM   GV  +
Sbjct: 1268 -MLESITLRGVEDITRVVMMKYDRKVPSPTGEYHKVPEWVLETDGVNLAEVMCVPGVDPA 1326

Query: 1311 KTKTNHILEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGIT 1370
            +  TN  +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT +G ++ +T
Sbjct: 1327 RIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVT 1386

Query: 1371 RFGLAKMRDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            R G  +     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F V+
Sbjct: 1387 RHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQVAPIGTGAFDVM 1445

>YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON}
           RPO21RNA polymerase II largest subunit B220, part of
           central core; phosphorylation of C-terminal heptapeptide
           repeat domain regulates association with transcription
           and splicing factors; similar to bacterial beta-prime
          Length = 1733

 Score =  568 bits (1463), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 356/918 (38%), Positives = 497/918 (54%), Gaps = 53/918 (5%)

Query: 11  KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTC 70
           + +K + F   S  ++ + S  +I   +  D    R AK GG  DPR+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELRRP 130
              +  C GHFGHI LA PVFHVG+     ++ + VC  CG LLL E +      EL R 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131 GMDNLRRMNILKKILDQCKKQRRCFE--CGELNXXXXXXXXXXXXXXLKIIHDTFRWVGK 188
            +           I   CK +  C      E +                I  D  + VG 
Sbjct: 125 ALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTIRKDGLKLVG- 183

Query: 189 KSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCELLGIDSTS 248
             + +K++  GD      + PEL          L+  ++LN+FK I   D   LG +   
Sbjct: 184 --SWKKDRATGD-----ADEPELRV--------LSTEEILNIFKHISVKDFTSLGFNEVF 228

Query: 249 KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKGIS 308
              RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     G  
Sbjct: 229 S--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309 INNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGRFRGNLSG 368
            + + E    LQ  VA Y+++D          SG   +P++    RLKGK+GR RGNL G
Sbjct: 286 HHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG---RPVKSIRARLKGKEGRIRGNLMG 342

Query: 369 KRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVINGPKVHPGA 428
           KRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGP  HPGA
Sbjct: 343 KRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGA 402

Query: 429 NYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHRLSILSHYA 488
            Y+++ + D R +LRY  R     QLQYG  VERHI D D VLFNRQPSLH++S+++H  
Sbjct: 403 KYVIRDSGD-RIDLRYSKRAG-DIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRV 460

Query: 489 KIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPI 548
           K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +P 
Sbjct: 461 KVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPC 520

Query: 549 IAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHYLWTGKQVF 608
           +   QD + G   ++ +D+F +  Q+  +L  + D +    IP P+I+KP  LW+GKQ+ 
Sbjct: 521 MGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKPLWSGKQIL 578

Query: 609 SLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSGVMDKSVLG 668
           S+ I      P  I+L   +         E    +S  D  +LI    I+ GV++K  +G
Sbjct: 579 SVAI------PNGIHLQRFD---------EGTTLLSPKDNGMLIIDGQIIFGVVEKKTVG 623

Query: 669 DGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGIND-VTPGSDLKQKKEQ 727
                 + + + R+ GP   A+    + K+   +L + GFS GI D +  G  +++  E 
Sbjct: 624 SSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITET 682

Query: 728 MVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLN 787
           + E A  K  ++        L  + G    ++ E  +   L++ R++ G +    L +LN
Sbjct: 683 IAE-AKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLN 741

Query: 788 APLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVR 847
               M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKGFV 
Sbjct: 742 NVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVE 801

Query: 848 NSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSN 907
           NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YDNT R S  
Sbjct: 802 NSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLG 861

Query: 908 GIVQFTYGGDGLDPLDME 925
            ++QF YG DG+D   +E
Sbjct: 862 NVIQFIYGEDGMDAAHIE 879

 Score =  178 bits (451), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 132/415 (31%), Positives = 205/415 (49%), Gaps = 44/415 (10%)

Query: 1056 QLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1115
            Q  +++K      LS   +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 QEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1116 NVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRVEKTLLSDVSFYVQD 1173
             VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  +E T L  V+    +
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTI-ASE 1151

Query: 1174 IYRDNMAFLQIKIDSETIEKLQLELTLEDIVVAI-AKAPKL------KIGTND------- 1219
            IY D      +  + E I +L   L  E+   +   ++P L      +   ND       
Sbjct: 1152 IYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQ 1211

Query: 1220 ----ISIIGKDKINIAVSSDGKSMKSIST---------AMKEPEPNEVFYRMQQLRRALP 1266
                I    K+ + +  S D      I           A  E E + +  +++     L 
Sbjct: 1212 VGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENT--MLE 1269

Query: 1267 HIVVKGFSDISRAVINIRD------------DGKRELLVEGYGLRDVMTTDGVIGSKTKT 1314
            +I ++G  +I R V+   D            + +  L  +G  L +VMT  G+  ++  T
Sbjct: 1270 NITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYT 1329

Query: 1315 NHILEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL 1374
            N  +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G 
Sbjct: 1330 NSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGF 1389

Query: 1375 AKMRDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
             +     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1390 NRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7.314
           YDL140C
          Length = 1726

 Score =  567 bits (1461), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 348/928 (37%), Positives = 508/928 (54%), Gaps = 73/928 (7%)

Query: 11  KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTC 70
           + IK + F   S  +I + S  +I   +  D    R AK GG  DPR+G      +C TC
Sbjct: 12  RTIKEVQFGLFSPEEIRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKR-KFLTELRR 129
              +  C GHFGHI LA PVFH+G+     ++ + +C  CG LLL E +++ + + +++ 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDEHNEQMRQILKIK- 129

Query: 130 PGMDNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIHDTFRWVGKK 189
              D+ +R N    I   CK +  C                     +   HD  + V + 
Sbjct: 130 ---DSKKRFN---AIWSLCKTKMIC------------------DTDVPSEHDPTQLVSRG 165

Query: 190 SAPEKE--------QWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCEL 241
                +        + +G WK+  +N  + +   +R    L+  ++LN+FK I P D   
Sbjct: 166 GCGNAQPTVRKDGLKLVGSWKKE-KNTSDGDEPEQRI---LSTEEILNIFKHISPEDSIA 221

Query: 242 LGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKA 301
           +G +   +  RPE      LP PP  +RPS+   +S    EDDLT KL +I+  +  ++ 
Sbjct: 222 MGFNE--EFSRPEWMFLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302 GLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGR 361
               G   + + E    LQ  VA Y+++D          SG   +P++    RLKGK+GR
Sbjct: 279 LEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG---RPVKSIRARLKGKEGR 335

Query: 362 FRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVING 421
            RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  LV NG
Sbjct: 336 IRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTHLVRNG 395

Query: 422 PKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHRL 481
           P  HPGA Y+++ N D R +LRY  R     QLQYG  VERHI D D VLFNRQPSLH++
Sbjct: 396 PNEHPGAKYVIRDNGD-RIDLRYSKRAG-DIQLQYGWKVERHIMDNDPVLFNRQPSLHKM 453

Query: 482 SILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLT 541
           S+++H  ++ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++
Sbjct: 454 SMMAHRVRVMPFSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS 513

Query: 542 PKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFD--IPPPSIMKPH 599
            +S +P +   QD + G   ++ +D+F +  Q+  LL  + D    +D  IP P+I+KP 
Sbjct: 514 AQSNKPCMGIVQDTLCGIRKLTLRDNFIEFDQVLNLLYWVPD----WDGVIPTPAILKPK 569

Query: 600 YLWTGKQVFSLLIKPSRKSPVVINLDA--KNKVYLPPPKKEYPNEMSQNDGFVLIRGSNI 657
            LW+GKQ+ S+ I      P  I+L    +   +L P          +++G ++I G  I
Sbjct: 570 PLWSGKQILSIAI------PKGIHLQRFDEGTTFLSP----------KDNGMLIIDG-QI 612

Query: 658 LSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTP 717
           + GV+DK  +G      + + + R+ GP   A+  + + K+   +  + GFS GI D   
Sbjct: 613 IFGVVDKKTVGSSSG-GLIHVVTREKGPQICAKLFSNIQKVTNYWFLHNGFSTGIGDTIA 671

Query: 718 GSDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
             +  ++    +  A  K +E+        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672 DGETMREITGTIAEAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGR 731

Query: 778 VCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 837
           +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732 LAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDD 791

Query: 838 KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 897
            +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792 YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 898 YDNTVRTSSNGIVQFTYGGDGLDPLDME 925
           YD+T R S   ++QF YG DG+D   +E
Sbjct: 852 YDSTTRNSLGNVIQFVYGEDGIDAGHIE 879

 Score =  186 bits (473), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 140/415 (33%), Positives = 210/415 (50%), Gaps = 44/415 (10%)

Query: 1056 QLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1115
            Q  K++K   Q  L+   +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 QEFKLNKQSFQWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1116 NVTLGVPRIKEIINASKVISTPIINAVL--VNDNDERAARVVKGRVEKTLLSDVSFYVQD 1173
             VT GVPR+KEI+N +K + TP + A L      D+  A++++  +E T L  V+    +
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTAYLEPAYAADQEKAKLIRSAIEHTTLKSVTV-ASE 1151

Query: 1174 IYRDNMAFLQIKIDSETIEKLQLELTLEDIVVAI-AKAPKL------KIGTNDISI-IGK 1225
            IY D      +  + E I +L   L  E+   ++  ++P L      +   ND  + +G+
Sbjct: 1152 IYYDPDPRTTVIAEDEEIMQLHFSLMDEETEKSLDQQSPWLLRLELDRAAMNDKDLTMGQ 1211

Query: 1226 --DKINIAVSSDGKSMKSISTAMK-----------------EPEPNEVFYRMQQLRRALP 1266
              +KI     +D   + S   A K                 E E + +  +++     L 
Sbjct: 1212 VGEKIRETFRNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEEDHMLKKIENT--MLE 1269

Query: 1267 HIVVKGFSDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKTKT 1314
            +I ++G  +I R V+   D       G  E      L  +G  L +VMT  GV  S+  T
Sbjct: 1270 NITLRGVENIERVVMMKYDRKIPGTSGAYEKVPEWVLETDGVNLLEVMTVPGVDASRIYT 1329

Query: 1315 NHILEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL 1374
            N  +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT  G +  +TR G 
Sbjct: 1330 NSFIDITEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTNGSLTSVTRHGF 1389

Query: 1375 AKMRDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
             +     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGSF V+
Sbjct: 1390 NRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGSFDVM 1444

>TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {ON}
           Anc_7.314 YDL140C
          Length = 1727

 Score =  567 bits (1461), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 357/933 (38%), Positives = 503/933 (53%), Gaps = 72/933 (7%)

Query: 9   AP-KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAEC 67
           AP + +K + F   S  ++ + S  +I   +  D    R AK GG  DPR+G      +C
Sbjct: 9   APLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKC 67

Query: 68  TTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTEL 127
            TC   +  C GHFGHI LA PVFH+G+     ++ + VC  CG LLL + ++     ++
Sbjct: 68  QTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCECVCMHCGKLLLDDHNE-----QM 122

Query: 128 RRPGM--DNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKII------ 179
           R+     D+ +R N    I   CK +  C                      K+I      
Sbjct: 123 RQACKIKDSKKRFN---AIWTLCKTKMIC-----------ESDVPSEEDPTKLISRGGCG 168

Query: 180 --HDTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPN 237
               T R  G K        +G WK+  +N  + E   +R    L   ++LN+FK I   
Sbjct: 169 NAQPTVRKDGLK-------LVGSWKKE-KNTGDPEEPEQRI---LTMEEILNIFKHISKE 217

Query: 238 DCELLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSS 297
           D   LG +   +  RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  + 
Sbjct: 218 DSNRLGFNE--EFARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANI 274

Query: 298 LIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKG 357
            ++     G   + + E    LQ  VA Y+++D          SG   +P++    RLKG
Sbjct: 275 SLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG---RPVKSIRARLKG 331

Query: 358 KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQL 417
           K+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  L
Sbjct: 332 KEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTFL 391

Query: 418 VINGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPS 477
           V NGP  HPGA Y+++ N D R +LRY  R     QLQYG  VERHI D D VLFNRQPS
Sbjct: 392 VRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAG-DIQLQYGWKVERHIMDNDPVLFNRQPS 449

Query: 478 LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 537
           LH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V  
Sbjct: 450 LHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPL 509

Query: 538 NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFD--IPPPSI 595
            +++P+S +P +   QD + G   ++ +D+F +  Q+  +L  + D    +D  IP P+I
Sbjct: 510 QIVSPQSNKPCMGIVQDTLCGIRKLTLRDNFIELDQVLNMLYWVPD----WDGVIPTPAI 565

Query: 596 MKPHYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGS 655
           +KP  LWTGKQ+ S+ I      P  I+L   +         E    +S  D  +LI   
Sbjct: 566 IKPKPLWTGKQILSIAI------PKGIHLQRFD---------EGTTLLSPKDNGMLIIDG 610

Query: 656 NILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDV 715
            I+ GV+DK  +G      + + + R+ GP   A+    + K+   +  + GFS GI D 
Sbjct: 611 KIIFGVVDKKTVGSSSG-GLIHVVTREKGPQICARLFGNIQKVVNYWFLHNGFSTGIGDT 669

Query: 716 TPGSDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEV 775
                  ++  + +  A  K +++        L  + G    ++ E  +   L++ R++ 
Sbjct: 670 IADGQTMREITETIADAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKA 729

Query: 776 GEVCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPK 835
           G +    L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K
Sbjct: 730 GRLAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSK 789

Query: 836 NSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLS 895
           +  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+ 
Sbjct: 790 DDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIM 849

Query: 896 CQYDNTVRTSSNGIVQFTYGGDGLDPLDMEGNA 928
             YD+T R S   ++QF YG DG+D   +E  A
Sbjct: 850 VHYDSTTRNSLGNVIQFVYGEDGMDASHIEKQA 882

 Score =  155 bits (392), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 123/384 (32%), Positives = 190/384 (49%), Gaps = 43/384 (11%)

Query: 1075 KYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVI 1134
            ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT GVPR+      +K I
Sbjct: 1052 QFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLXXXXEKAKFI 1111

Query: 1135 STPIINAVLVN---------DNDERAARVVKG----RVEKTLLSDVSFYVQDIYRDNMAF 1181
             + I +  L +         D D R+  + +     ++  +LL D +    D  + +   
Sbjct: 1112 RSAIEHTTLKSVTVASEIYYDPDPRSTVIAEDEEIIQLHFSLLDDETEKSLD--QQSPWL 1169

Query: 1182 LQIKIDSETIEKLQLELTLEDIVVAIAKAPKLKIGTNDISII----GKDKINIAVSSDGK 1237
            L++++D   +     +LT+  +   I +  K     ND+ +I      +K+ I       
Sbjct: 1170 LRLELDRAAMN--DKDLTMGQVGEKIKETFK-----NDLFVIWSEDNAEKLIIRCRVVRP 1222

Query: 1238 SMKSISTAMKEPEPNEVFYRMQQLRRALPHIVVKGFSDISRAVINIRD------DGKRE- 1290
                I T   E E + +  +++     L +I ++G  +I R V+   D       G+   
Sbjct: 1223 KSMDIET---EAEEDHMLKKIENT--MLENITLRGVENIERVVMMKYDRKVPSATGEYHK 1277

Query: 1291 -----LLVEGYGLRDVMTTDGVIGSKTKTNHILEVYDVLGIEAARSCIINEIDYTMSNHG 1345
                 L  +G  L +VMT  GV   +  TN  +++ +VLGIEA R+ +  E+   +++ G
Sbjct: 1278 VPEWVLETDGVNLSEVMTVPGVDSKRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG 1337

Query: 1346 MSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVLQLASFEKTTDHLFDAAFYMKNDA 1405
              V+ RH+ LL DVMT +G +  +TR G  +     L   SFE+T + LF+A    + D 
Sbjct: 1338 SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSATGALMRCSFEETVEILFEAGACAEMDD 1397

Query: 1406 VEGVSECIILGQTMSIGTGSFKVV 1429
              GVSE +ILGQ   IGTGSF V+
Sbjct: 1398 CRGVSENVILGQMAPIGTGSFDVM 1421

>Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON}
           YDL140C (REAL)
          Length = 1719

 Score =  566 bits (1460), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 355/918 (38%), Positives = 498/918 (54%), Gaps = 53/918 (5%)

Query: 11  KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTC 70
           + +K + F   S  ++ + S  +I   +  D    R AK GG  DPR+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELRRP 130
              +  C GHFGHI LA PVFHVG+     ++ + VC  CG LLL E +      EL R 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131 GMDNLRRMNILKKILDQCKKQRRCFE--CGELNXXXXXXXXXXXXXXLKIIHDTFRWVGK 188
            +           I   CK +  C      E +                +  D  + VG 
Sbjct: 125 ALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQLVSRGGCGNTQPTVRKDGLKLVG- 183

Query: 189 KSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCELLGIDSTS 248
             + +K++  GD ++     PEL          L+  ++LN+FK I   D   LG +   
Sbjct: 184 --SWKKDRASGDAEE-----PELRV--------LSTEEILNIFKHISVKDFTSLGFNEVF 228

Query: 249 KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKGIS 308
              RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     G  
Sbjct: 229 S--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309 INNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGRFRGNLSG 368
            + + E    LQ  VA Y+++D          SG   +P++    RLKGK+GR RGNL G
Sbjct: 286 HHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG---RPVKSIRARLKGKEGRIRGNLMG 342

Query: 369 KRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVINGPKVHPGA 428
           KRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGP  HPGA
Sbjct: 343 KRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGA 402

Query: 429 NYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHRLSILSHYA 488
            Y+++ + D R +LRY  R     QLQYG  VERHI D D VLFNRQPSLH++S+++H  
Sbjct: 403 KYVIRDSGD-RIDLRYSKRAG-DIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRV 460

Query: 489 KIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPI 548
           K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +P 
Sbjct: 461 KVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPC 520

Query: 549 IAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHYLWTGKQVF 608
           +   QD + G   ++ +D+F +  Q+  +L  + D +    IP P+I+KP  LW+GKQ+ 
Sbjct: 521 MGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKPLWSGKQIL 578

Query: 609 SLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSGVMDKSVLG 668
           S+ I      P  I+L   +         E    +S  D  +LI    I+ GV++K  +G
Sbjct: 579 SVAI------PNGIHLQRFD---------EGTTLLSPKDNGMLIIDGQIIFGVVEKKTVG 623

Query: 669 DGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGIND-VTPGSDLKQKKEQ 727
                 + + + R+ GP   A+    + K+   +L + GFS GI D +  G  +++  E 
Sbjct: 624 SSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITET 682

Query: 728 MVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLN 787
           + E A  K  ++        L  + G    ++ E  +   L++ R++ G +    L +LN
Sbjct: 683 IAE-AKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLN 741

Query: 788 APLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVR 847
               M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKGFV 
Sbjct: 742 NVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVE 801

Query: 848 NSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSN 907
           NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YDNT R S  
Sbjct: 802 NSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLG 861

Query: 908 GIVQFTYGGDGLDPLDME 925
            ++QF YG DG+D   +E
Sbjct: 862 NVIQFIYGEDGMDAAHIE 879

 Score =  177 bits (449), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 131/415 (31%), Positives = 205/415 (49%), Gaps = 44/415 (10%)

Query: 1056 QLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1115
            Q  +++K      LS   +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 QEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1116 NVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRVEKTLLSDVSFYVQD 1173
             VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  +E T L  V+    +
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTI-ASE 1151

Query: 1174 IYRDNMAFLQIKIDSETIEKLQLELTLEDIVVAI-AKAPKL------KIGTND------- 1219
            IY D      +  + E I +L   L  ++   +   ++P L      +   ND       
Sbjct: 1152 IYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQ 1211

Query: 1220 ----ISIIGKDKINIAVSSDGKSMKSIST---------AMKEPEPNEVFYRMQQLRRALP 1266
                I    K+ + +  S D      I           A  E E + +  +++     L 
Sbjct: 1212 VGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENT--MLE 1269

Query: 1267 HIVVKGFSDISRAVINIRD------------DGKRELLVEGYGLRDVMTTDGVIGSKTKT 1314
            +I ++G  +I R V+   D            + +  L  +G  L +VMT  G+  ++  T
Sbjct: 1270 NITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDATRIYT 1329

Query: 1315 NHILEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL 1374
            N  +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G 
Sbjct: 1330 NSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGF 1389

Query: 1375 AKMRDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
             +     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1390 NRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON}
           YDL140C (RPO21) - RNA polymerase II large subunit
           [contig 161] FULL
          Length = 1728

 Score =  566 bits (1460), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 354/931 (38%), Positives = 501/931 (53%), Gaps = 73/931 (7%)

Query: 11  KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTC 70
           + +K + F   S  ++ + S  +I   +  D    R AK GG  DPR+G      +C TC
Sbjct: 12  RTVKEVQFGMFSPEEVRAISVAKIEFPETMDETQMR-AKVGGLNDPRLGSIDRNFKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELRRP 130
              +  C GHFGHI+LA PVFH+GY     ++ + VC  CG LLL E       +EL + 
Sbjct: 71  GEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH------SELMKQ 124

Query: 131 GM---DNLRRMNILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIHDTFRWVG 187
            +   D  RR N +  +   CK +  C                     +   +D  ++V 
Sbjct: 125 AIKIKDPKRRFNAVWSL---CKVKMVC------------------ETEVPSDNDPSQYVS 163

Query: 188 KKSAPEKE--------QWIGDWKQ--VLENNPELERYVKRCMDDLNPLKVLNLFKQIKPN 237
           +      +          +G WK+    ++  + ER +      ++  +VLN+FK I P 
Sbjct: 164 RGGCGNTQPSVRKDGLSLVGTWKKDKGADDADQPERRI------ISADEVLNVFKHISPE 217

Query: 238 DCELLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSS 297
           D   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT KL +I+  + 
Sbjct: 218 DSVRLGFNE--DFARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANI 274

Query: 298 LIKAGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKG 357
            ++     G   + + E    LQ  VA Y+++D          SG   +PI+    RLKG
Sbjct: 275 NVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG---RPIKSIRARLKG 331

Query: 358 KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQL 417
           K+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QL
Sbjct: 332 KEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNIDRLTQL 391

Query: 418 VINGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPS 477
           V NGP  HPGA Y+++ N D R +LRY  R     QLQYG  VERHI D D VLFNRQPS
Sbjct: 392 VRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAG-DIQLQYGWKVERHIIDEDPVLFNRQPS 449

Query: 478 LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 537
           LH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V  
Sbjct: 450 LHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQ 509

Query: 538 NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMK 597
            +++ +S +P +   QD + G   ++ +D+F +  Q+  +L  + D +    IP P I+K
Sbjct: 510 QIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIELEQVLNMLYWIPDWDGV--IPTPIILK 567

Query: 598 PHYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNI 657
           P  LW+GKQ+ S+ I      P  I+L   +         E    +S  D  +LI    I
Sbjct: 568 PKPLWSGKQILSIAI------PTGIHLQRFD---------EGTTLLSPKDNGMLIIDGQI 612

Query: 658 LSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTP 717
           + GV+DK  +G      + + + R+ GP   A+  + + K+   +L + GFSIGI D   
Sbjct: 613 IFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQKVVNYWLLHNGFSIGIGDTIA 671

Query: 718 GSDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
                ++    +  A  K +E+        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672 DEKSMREITDAIVVAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGR 731

Query: 778 VCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 837
                L +LN    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732 SAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDD 791

Query: 838 KTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 897
            +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792 YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 898 YDNTVRTSSNGIVQFTYGGDGLDPLDMEGNA 928
           YD T R S   ++QF YG DG+D   +E  A
Sbjct: 852 YDGTTRNSLGNVIQFIYGEDGMDAAHIEKQA 882

 Score =  184 bits (466), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 134/419 (31%), Positives = 212/419 (50%), Gaps = 51/419 (12%)

Query: 1056 QLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1115
            Q  +++K   +  LS   +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 QEYRLNKQTFEWVLSNVEAQFLRSLVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1116 NVTLGVPRIKEIINASKVISTPIINAVLVNDN--DERAARVVKGRVEKTLLSDVS----- 1168
             VT GVPR+KEI+N +K + TP +   L  ++  D+  A++++  +E T L  ++     
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLDEEHAADQEKAKLIRSAIEHTTLKSITVASEI 1152

Query: 1169 FYVQD----IYRDNMAFLQIK---IDSETIEKLQLE----LTLE---------DIVVAIA 1208
            +Y  D    +  D+   +Q+    +D ET + L  +    L LE         D+ +   
Sbjct: 1153 YYDPDPRSTVIEDDEEIIQLHFSLMDEETEQSLDYQSPWLLRLELDRAAMNDKDLTMGQV 1212

Query: 1209 KAPKLKIGTNDISIIGKDK------INIAVSSDGKSMKSISTAMKEPEPNEVFYRMQQLR 1262
                 +   ND+ +I  +       I   V  D K++     A  E E + +  R++   
Sbjct: 1213 GEKIKETFKNDLFVIWSEDNAEKLVIRCRVVRDPKTLD----AEAEAEEDHMLKRIENT- 1267

Query: 1263 RALPHIVVKGFSDISRAVINIRDDG------------KRELLVEGYGLRDVMTTDGVIGS 1310
              L  I ++G  DI+R V+   D              +  L  +G  L +VM   GV  +
Sbjct: 1268 -MLESITLRGVEDITRVVMMKYDRKVPSPAGDYHKIPEWVLETDGVNLAEVMCVPGVDPA 1326

Query: 1311 KTKTNHILEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGIT 1370
            +  TN  +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT +G ++ +T
Sbjct: 1327 RIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVT 1386

Query: 1371 RFGLAKMRDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            R G  +     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTG+F V+
Sbjct: 1387 RHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQVAPIGTGAFDVM 1445

>SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highly
           similar to uniprot|P04050 Saccharomyces cerevisiae
           YDL140C
          Length = 1730

 Score =  564 bits (1454), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 357/919 (38%), Positives = 498/919 (54%), Gaps = 55/919 (5%)

Query: 11  KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTC 70
           + IK + F   S  ++ + S  +I   +  D    R AK GG  DPR+G      +C TC
Sbjct: 12  RTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMR-AKVGGLNDPRLGSIDRNYKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKR-KFLTELRR 129
              +  C GHFGHI+LA PVFH+G+     ++ + VC  CG LLL E +++ K   +++ 
Sbjct: 71  GEGMNDCPGHFGHIELAKPVFHIGFLSRIKKVCECVCMHCGKLLLDEHNEQMKQAIKIKD 130

Query: 130 PGMDNLRRMN---ILKKILDQCKKQRRCFECGELNXXXXXXXXXXXXXXLKIIHDTFRWV 186
           P     RR N    L K+   C+ +       E +                I  D    V
Sbjct: 131 PK----RRFNAVWTLSKVKMICETEVPS----EDDPTKYISRGGCGNTQPSIRKDGLSLV 182

Query: 187 GKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCELLGIDS 246
           G         W  D      + PE     KR    ++  +VLN+FK I P D   LG + 
Sbjct: 183 GT--------WKKDKNADDADQPE-----KRI---ISAEEVLNVFKHICPEDSWRLGFNE 226

Query: 247 TSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKG 306
                RPE  +   LP PP  +RPS+   ++    EDDLT KL +I+  +  ++     G
Sbjct: 227 --DFARPEWMLLTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANINVQRLEING 283

Query: 307 ISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGRFRGNL 366
              + + E    LQ  VA Y+++D          SG   +PI+    RLKGK+GR RGNL
Sbjct: 284 SPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSG---RPIKSIRARLKGKEGRIRGNL 340

Query: 367 SGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVINGPKVHP 426
            GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGP  HP
Sbjct: 341 MGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP 400

Query: 427 GANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHRLSILSH 486
           GA Y+++ N D R +LRY  R     QLQYG  VERHI D D VLFNRQPSLH++S+++H
Sbjct: 401 GAKYVIRDNGD-RIDLRYSKRAG-DIQLQYGWKVERHIIDNDPVLFNRQPSLHKMSMMAH 458

Query: 487 YAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGE 546
             K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +
Sbjct: 459 RVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNK 518

Query: 547 PIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHYLWTGKQ 606
           P +   QD + G   ++ +D+F +  Q+  +L  + D +    IP P+I+KP  LW+GKQ
Sbjct: 519 PCMGIVQDTLCGVRKMTLRDTFIELDQVLNMLYWVPDWDGV--IPTPTILKPKPLWSGKQ 576

Query: 607 VFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSGVMDKSV 666
           + S+ I      P  I+L   +         E    +S  D  +LI    I+ GV+DK  
Sbjct: 577 ILSMAI------PKGIHLQRFD---------EGTTLLSPKDNGMLIVDGQIIFGVVDKKT 621

Query: 667 LGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGSDLKQKKE 726
           +G      + + + R+ GP   A+  + + K+   +L + GFSIGI D        ++  
Sbjct: 622 VG-SSNGGLIHIVTREKGPQICARLFSNIQKVVNYWLLHNGFSIGIGDTIADQKTMREIT 680

Query: 727 QMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNL 786
           + +  A  K + +        L  + G    ++ E  +   L++ R++ G      L +L
Sbjct: 681 EAIAVAKKKVENVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRSAEVNLKDL 740

Query: 787 NAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFV 846
           N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKGFV
Sbjct: 741 NNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSPESKGFV 800

Query: 847 RNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSS 906
            NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD T R S 
Sbjct: 801 ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDGTTRNSL 860

Query: 907 NGIVQFTYGGDGLDPLDME 925
             I+QF YG DG+D   +E
Sbjct: 861 GNIIQFIYGEDGMDAAHIE 879

 Score =  187 bits (474), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 136/416 (32%), Positives = 214/416 (51%), Gaps = 51/416 (12%)

Query: 1059 KISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT 1118
            K++K   Q  L+   +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT
Sbjct: 1036 KLTKQTFQWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVT 1095

Query: 1119 LGVPRIKEIINASKVISTPIINAVLVNDN--DERAARVVKGRVEKTLLSDVS-----FYV 1171
             GVPR+KEI+N +K + TP +   L ++   D+  A++++  +E T L  V+     +Y 
Sbjct: 1096 SGVPRLKEILNVAKNMKTPSLTVYLESEESADQEKAKLIRSAIEHTTLKSVTVASEIYYD 1155

Query: 1172 QD----IYRDNMAFLQIK---IDSETIEKLQ------LELTLE-------DIVVAIAKAP 1211
             D    +  D+   +Q+    +D ET + L       L L L+       D+ +      
Sbjct: 1156 PDPRSTVIEDDEEIIQLHFSLMDEETEQSLDHQSPWLLRLELDRAAMNDKDLTMGQVGEK 1215

Query: 1212 KLKIGTNDISIIGKDK------INIAVSSDGKSMKSISTAMKEPEPNEVFYRMQQLRRAL 1265
              +   ND+ +I  +       I   V  D K++     A  E E + +  +++     L
Sbjct: 1216 IKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLD----AEAEAEEDHMLKKIENT--ML 1269

Query: 1266 PHIVVKGFSDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKTK 1313
              I ++G  DI+R V+   D       G+ +      L  +G  L +VM+  GV  ++  
Sbjct: 1270 ESITLRGVEDITRVVMMKYDRKTPSATGEYQKVPEWVLETDGVNLAEVMSVPGVDSTRIY 1329

Query: 1314 TNHILEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFG 1373
            TN  +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G
Sbjct: 1330 TNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHG 1389

Query: 1374 LAKMRDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
              +     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1390 FNRSDTGALMRCSFEETVEILFEAGAAAELDNCRGVSENVILGQMAPIGTGAFDVM 1445

>Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {ON}
           YDL140C (REAL)
          Length = 1726

 Score =  564 bits (1454), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 354/918 (38%), Positives = 490/918 (53%), Gaps = 53/918 (5%)

Query: 11  KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTC 70
           + +K + F   S  ++ + S  +I   +  D    R AK GG  DPR+G      +C TC
Sbjct: 12  RTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNLKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELRRP 130
              +  C GHFGHI LA PVFHVG+     ++ + VC  CG LLL E +      EL R 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHVGFIAKIKKLCECVCMHCGKLLLDEHN------ELMRQ 124

Query: 131 GMDNLRRMNILKKILDQCKKQRRCFE--CGELNXXXXXXXXXXXXXXLKIIHDTFRWVGK 188
            +           I   CK +  C      E +                +  D  + VG 
Sbjct: 125 ALAIKDSKKRFAAIWTLCKTKMVCETDVPSENDPTQLVSRGGCGNTQPTVRKDGLKLVGS 184

Query: 189 KSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCELLGIDSTS 248
                   W  D      + PEL          L+  ++LN+FK I   D   LG +   
Sbjct: 185 --------WKKDRASGDADEPELRV--------LSTEEILNIFKHISVEDFTSLGFNEVF 228

Query: 249 KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIKAGLEKGIS 308
              RPE  I   LP PP  +RPS+   +S    EDDLT KL +I+  +  ++     G  
Sbjct: 229 S--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLEHNGAP 285

Query: 309 INNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGRFRGNLSG 368
            + + E    LQ  VA Y+++D          SG   +P++    RLKGK+GR RGNL G
Sbjct: 286 HHAIEEAESLLQFHVATYMDNDIAGQPQALQKSG---RPVKSIRARLKGKEGRIRGNLMG 342

Query: 369 KRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVINGPKVHPGA 428
           KRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGP  HPGA
Sbjct: 343 KRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHPGA 402

Query: 429 NYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHRLSILSHYA 488
            Y+++ + D R +LRY  R     QLQYG  VERHI D D VLFNRQPSLH++S+++H  
Sbjct: 403 KYVIRDSGD-RIDLRYSKRAG-DIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRV 460

Query: 489 KIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPI 548
            + P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE RAE   L  V   +++P+S +P 
Sbjct: 461 IVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPC 520

Query: 549 IAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHYLWTGKQVF 608
           +   QD + G   ++ +D+F +  Q+  +L  + D +    IP P+I+KP  LW+GKQV 
Sbjct: 521 MGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGV--IPTPAIIKPKPLWSGKQVL 578

Query: 609 SLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSGVMDKSVLG 668
           S  I      P  I+L   +         E    +S  D  +LI    I+ GV++K  +G
Sbjct: 579 SAAI------PSGIHLQRFD---------EGTTLLSPKDNGMLIIDGQIVFGVVEKKTVG 623

Query: 669 DGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGIND-VTPGSDLKQKKEQ 727
                 + + + R+ GP   A+    + K+   +L + GFS GI D +  G  +++  E 
Sbjct: 624 SSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITET 682

Query: 728 MVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLN 787
           + E A  K  ++        L  + G    ++ E  +   L++ R++ G +    L +LN
Sbjct: 683 IAE-AKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEVNLKDLN 741

Query: 788 APLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVR 847
               M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+SKGFV 
Sbjct: 742 NVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFVE 801

Query: 848 NSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSN 907
           NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YDNT R S  
Sbjct: 802 NSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLG 861

Query: 908 GIVQFTYGGDGLDPLDME 925
            ++QF YG DG+D   +E
Sbjct: 862 NVIQFIYGEDGMDAAHIE 879

 Score =  177 bits (450), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 131/415 (31%), Positives = 206/415 (49%), Gaps = 44/415 (10%)

Query: 1056 QLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASM 1115
            Q  +++K   +  LS   +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS 
Sbjct: 1033 QEYRLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASK 1092

Query: 1116 NVTLGVPRIKEIINASKVISTPIINAVLV--NDNDERAARVVKGRVEKTLLSDVSFYVQD 1173
             VT GVPR+KEI+N +K + TP +   L   +  D+  A++++  +E T L  V+    +
Sbjct: 1093 KVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTTLKSVTI-ASE 1151

Query: 1174 IYRDNMAFLQIKIDSETIEKLQLELTLEDIVVAI-AKAPKL------KIGTND------- 1219
            IY D      +  + E I +L   L  ++   +   ++P L      +   ND       
Sbjct: 1152 IYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDLTMGQ 1211

Query: 1220 ----ISIIGKDKINIAVSSDGKSMKSIST---------AMKEPEPNEVFYRMQQLRRALP 1266
                I    K+ + +  S D      I           A  E E + +  +++     L 
Sbjct: 1212 VGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENT--MLE 1269

Query: 1267 HIVVKGFSDISRAVINIRD------------DGKRELLVEGYGLRDVMTTDGVIGSKTKT 1314
            +I ++G  +I R V+   D            + +  L  +G  L +VMT  G+  ++  T
Sbjct: 1270 NITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYT 1329

Query: 1315 NHILEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGL 1374
            N  +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G 
Sbjct: 1330 NSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGF 1389

Query: 1375 AKMRDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
             +     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1390 NRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDVM 1444

>Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 320

 Score =  508 bits (1307), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 243/308 (78%), Positives = 272/308 (88%)

Query: 1143 LVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLELTLED 1202
            LVN NDERAARVVKGR+EKTLLSDV+FY+QD+Y+DN++FLQ+KID  TIEKLQLELT+ED
Sbjct: 4    LVNMNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNLSFLQVKIDLGTIEKLQLELTIED 63

Query: 1203 IVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRMQQLR 1262
            I VAI +A KLKI   D+SIIGKDK+NI V  +G  +KSIST+ KEP  NE+FYR+Q LR
Sbjct: 64   IAVAITRASKLKIAAQDVSIIGKDKVNINVYPEGSKLKSISTSAKEPIENELFYRVQHLR 123

Query: 1263 RALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEVYD 1322
            R+LP IVVKG  DI+RAVINI+ DG RELLVEGYGLRDVMTTDGV+G KTKTNHILEV  
Sbjct: 124  RSLPGIVVKGLPDIARAVINIKSDGSRELLVEGYGLRDVMTTDGVVGHKTKTNHILEVVS 183

Query: 1323 VLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVL 1382
            VLGIEAAR+ I+ EIDYTMSNHGMSVDPRH+QLLGDVMTYKGEVLGITRFGL+KMRDSVL
Sbjct: 184  VLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEVLGITRFGLSKMRDSVL 243

Query: 1383 QLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGENDLTPK 1442
            QLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTMSIGTG+FKVVK T +   +L PK
Sbjct: 244  QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTNLSSEELKPK 303

Query: 1443 PTLFETLC 1450
             TLFE+LC
Sbjct: 304  ATLFESLC 311

>Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON}
           complement(211..4146) [3936 nt, 1312 aa]
          Length = 1311

 Score =  487 bits (1253), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 260/576 (45%), Positives = 356/576 (61%), Gaps = 22/576 (3%)

Query: 346 KPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEK 405
           +P++    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE 
Sbjct: 2   RPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEV 61

Query: 406 VTRYNKHKLQQLVINGPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIE 465
           VT YN  +L QLV NGP  HPGA Y+++ N D R +LRY  R     QLQYG  VERHI 
Sbjct: 62  VTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAG-DIQLQYGWKVERHIM 119

Query: 466 DGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEA 525
           D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQ+EE 
Sbjct: 120 DNDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEET 179

Query: 526 RAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSN 585
           RAE   L  V   +++P+S +P +   QD + G   ++ +DSF +  Q+  +L  + D +
Sbjct: 180 RAELSQLCAVPMQIVSPQSNKPCMGIVQDTLCGIRKLTLRDSFIEFDQVLNMLYWVPDWD 239

Query: 586 LQFDIPPPSIMKPHYLWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQ 645
               IP P+I+KP  LWTGKQ+ S+ I      P  I+L   +         E    +S 
Sbjct: 240 GV--IPQPAILKPKPLWTGKQILSIAI------PKGIHLQRFD---------EGTTMLSP 282

Query: 646 NDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGN 705
            D  +L+    I+ GV+DK  +G      + + + R+ GP   A+    + K+   +L +
Sbjct: 283 KDNGMLVIDGQIVFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKMFGNIQKVVNFWLLH 341

Query: 706 RGFSIGIND-VTPGSDLKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKI 764
            GFS GI D +  G  +K+  E + E A  K +E+        L  + G    ++ E  +
Sbjct: 342 NGFSTGIGDTIADGETMKEITETIAE-AKKKVEEVTKEAQANLLTAKHGMTLRESFEDNV 400

Query: 765 GGLLSKVREEVGEVCIRELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDG 824
              L++ R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  G
Sbjct: 401 VRFLNEARDKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFG 460

Query: 825 FQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMS 884
           F DR+LPHF K+  +P+SKGFV NS+  GL+P EF FHA+ GREGL+DTAVKTAETGY+ 
Sbjct: 461 FVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQ 520

Query: 885 RRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLD 920
           RRL+K+LED+   YD+T R S   ++QF YG DG+D
Sbjct: 521 RRLVKALEDIMVHYDSTTRNSLGNVIQFVYGEDGID 556

 Score =  179 bits (455), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 136/412 (33%), Positives = 203/412 (49%), Gaps = 44/412 (10%)

Query: 1059 KISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVT 1118
            +++K      LS   S++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  VT
Sbjct: 718  RLTKQAFDWVLSNIESQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVT 777

Query: 1119 LGVPRIKEIINASKVISTPIINAVLVNDN--DERAARVVKGRVEKTLLSDVSFYVQDIYR 1176
             GVPR+KEI+N +K + TP     L  +   D+  A+ ++  +E T L  V+    +IY 
Sbjct: 778  SGVPRLKEILNVAKNMKTPSSTVYLEPEYAIDQEKAKFIRSAIEHTTLKSVTV-ASEIYY 836

Query: 1177 DNMAFLQIKIDSETIEKLQLELTLEDIVVAI-AKAPKL------KIGTND---------- 1219
            D      +  D E I +L   L  ++   A+  ++P L      +   ND          
Sbjct: 837  DPDPRSTVIPDDEEIIQLHFSLLDDETEKALDNQSPWLLRLELDRAAMNDKDLTMGQVGE 896

Query: 1220 -ISIIGKDKINIAVSSDGKSMKSIST---------AMKEPEPNEVFYRMQQLRRALPHIV 1269
             I    K+ + +  S D      I           A  E E + +  +++     L  I 
Sbjct: 897  KIKETFKNDLFVIWSEDNADKLIIRCRVVRPKSLDAETEAEEDHMLKKIENT--MLESIT 954

Query: 1270 VKGFSDISRAVINIRD------DGKRE------LLVEGYGLRDVMTTDGVIGSKTKTNHI 1317
            ++G  DI R V+   D      +G  E      L  +G  L +VMT  GV  ++  TN  
Sbjct: 955  LRGVEDIERVVMMKYDRKMPSENGAYEKVPEWVLETDGVNLLEVMTVTGVDPTRIYTNSF 1014

Query: 1318 LEVYDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKM 1377
            +++ +VLGIEA R+ +  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G  + 
Sbjct: 1015 IDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGSLTSVTRHGFNRS 1074

Query: 1378 RDSVLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
                L   SFE+T + LF+A    + D   GVSE +ILGQ   +GTG+F V+
Sbjct: 1075 NTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPVGTGAFDVM 1126

>CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341w RPA190 DNA-directed RNA polymerase I
          Length = 1643

 Score =  455 bits (1170), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 316/979 (32%), Positives = 495/979 (50%), Gaps = 126/979 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    L  PP   R PS +  +   ++++ L   L++I+ TS LI           
Sbjct: 337  KADMFFMDVLVVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDELSTLQ 393

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLK 356
              K  LE + I  + +M  +  +Q  V  +I+S         G++G K  PI G  Q L+
Sbjct: 394  KDKVSLEDRRIIFSRLMNAFVTIQNDVNSFIDSTKAQ-----GNTGGKV-PIPGVKQALE 447

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 448  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQ 507

Query: 417  LVINGPKVHPGANYLLKKNEDARR----NLRYGDRVKLAKQLQ----------YGDVVER 462
             +INGP   PGA+ +  +NED        +    R  LA QL               V R
Sbjct: 508  AIINGPDKWPGASQI--QNEDGSLISLVGMTLEQRKALANQLMTPSSNPYTHTLNKKVYR 565

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ D+VL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 566  HIKNRDIVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 625

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMM 581
             E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF R Q  Q +   
Sbjct: 626  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGC 685

Query: 582  ------SDSNLQFDIPPPSIMKPHYLWTGKQVFS-LLIKPSRKSPVVINLDAKNKVYLPP 634
                    +  +    PP+I KP  LWTGKQ+ + +L+  +      INL + NK+    
Sbjct: 686  IRPEDGHATRAKLVTLPPAIHKPIPLWTGKQIITTVLLNVTPPDMPGINLKSSNKI---- 741

Query: 635  PKKEYPNEMSQNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNR 694
             K EY  + S+ +  V+ +   +L G++DKS  G   K+ + +++   YGP  AA+ ++ 
Sbjct: 742  -KNEYWGKHSEEND-VIFKDGQLLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKVLSV 798

Query: 695  MAKLCARYLGNRGFSIGINDVTPGSDLKQKKEQMVESAYAKCDELIDLFNKG-----KLE 749
            + +L   Y+ N  F+ G++D+   SD  + +  +++       E +D+  +       L+
Sbjct: 799  LGRLFTNYIMNTAFTCGMDDLRLTSDGNKWRSDILK-------ESVDIGRQAAAEVTNLD 851

Query: 750  TQPGCNEEQTLE--------------------AKIGGLLSKVREEVGEVCIRELDNLNAP 789
                 N+ + L+                    AK+  + SKV  +       +    N+ 
Sbjct: 852  KDTPSNDPELLKRLEEILRDNNKLGILDAVSSAKVNTITSKVVSQCVPGGTMKKFPENSM 911

Query: 790  LIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNS 849
              MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  
Sbjct: 912  QAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGR 971

Query: 850  FFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGI 909
            F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   +
Sbjct: 972  FYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTL 1031

Query: 910  VQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAETNVILQPLE 969
            +QF YGGD +D +     +    FN    + + L L   +P  L   +  ET +      
Sbjct: 1032 IQFLYGGDAVDVIK---ESHMTEFNFCLDNYDAL-LKKYNPSALVEHVDVETAL------ 1081

Query: 970  NKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKEL 1029
                +Y    + L+   +HKDE    +     +   L ++   K L   S   +  L+  
Sbjct: 1082 ----KYSK--KTLKNRKKHKDE--KHYKQTLKYDPVLSKYNPAKYLGAVSENFQDKLELF 1133

Query: 1030 VDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGA 1089
            +D+ ++  +E+            ++N+         +KF ++   KY R+ + PG AVG 
Sbjct: 1134 LDKSSKTFKEYE-----------SINE---------KKFRALMQLKYMRSLINPGEAVGI 1173

Query: 1090 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDND 1148
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + ND  
Sbjct: 1174 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWNDVS 1233

Query: 1149 ERAARVVKGRVEKTLLSDV 1167
            +  A      + K +LS+V
Sbjct: 1234 DETADTFCKSISKVILSEV 1252

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 87/168 (51%), Gaps = 10/168 (5%)

Query: 1263 RALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEVY 1321
            R +PHI         R +    ++GKR L+ EG   + +   +  I      +N I  V 
Sbjct: 1480 RQVPHI--------DRCIRPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDIASVL 1531

Query: 1322 DVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSV 1381
               G+EAAR+ I+NEI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S+
Sbjct: 1532 QTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSL 1591

Query: 1382 LQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            +++ S+E T   L  A    + + +E  S  I+LG+  ++GTG+F ++
Sbjct: 1592 MKM-SYETTCQFLTKAVLDNEREQLESPSARIVLGKLNNVGTGAFDIL 1638

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 53/117 (45%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + F  L++ADI + S   I+   +  LDN      GG  D  +G       C TC 
Sbjct: 10  EISSVDFGILTSADIRNLSAKRITNPTV--LDNLGHPISGGLYDLALGAFLRNL-CGTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L+S C  C    L   D  ++  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSACLFCHHFKLKSLDVHRYACKLR 123

>KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1653

 Score =  448 bits (1152), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 327/981 (33%), Positives = 495/981 (50%), Gaps = 124/981 (12%)

Query: 254  ETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------------ 300
            + +    L  PP   R PS +  +   + ++ L   L++I+ TS LI+            
Sbjct: 353  DMFFMEVLIVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSRLQKD 409

Query: 301  --AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGK 358
              +  ++ +  N +M  +  +Q  V  +I+S          SSG K  PI G  Q L+ K
Sbjct: 410  KVSADDRKVIFNRLMNAFVTIQNDVNAFIDSTKAQ-----SSSGNKV-PIPGLKQALEKK 463

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLV 418
            +G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q V
Sbjct: 464  EGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNVAELRQAV 523

Query: 419  INGPKVHPGANYLLKKNEDARR----NLRYGDRVKLAKQL---QYGDV-------VERHI 464
            INGP   PGA  +  +NED        +    R  LA QL      DV       V RHI
Sbjct: 524  INGPDKWPGATQI--QNEDGSFVSLVGMTLEQRKALANQLLTPSTHDVAHSINKKVYRHI 581

Query: 465  EDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTE 523
            ++ DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E
Sbjct: 582  KNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 641

Query: 524  EARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLL----- 578
             A+AEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R Q  Q +     
Sbjct: 642  NAKAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIR 701

Query: 579  --SMMSDSNLQFDIPPPSIMKPHYLWTGKQVFS-LLIKPSRKSPVVINLDAKNKVYLPPP 635
                 +  N    IPP ++MKP  LWTGKQ+ + +L+     +   INL++KNK+     
Sbjct: 702  PEDGHATRNKLVTIPP-AVMKPEPLWTGKQIITTVLLNTCPANMPGINLNSKNKI----- 755

Query: 636  KKEYPNEMSQNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRM 695
            K EY  + S+ +  V   G  +L G++DKS  G   K  + +++   YGP+ AA+ ++ +
Sbjct: 756  KNEYWGKSSEENNVVFKDGQ-LLCGILDKSQYG-ASKFGIVHSLHEVYGPDVAAKVLSVL 813

Query: 696  AKLCARYLGNRGFSIGINDVTPGSDLKQKKEQMVESAY----AKCDELIDL-----FNKG 746
             +L   Y+    F+ G++D+   ++  + +  +++++         E+ +L      + G
Sbjct: 814  GRLFTNYITATAFTCGMDDLRLTAEGNKWRNDILQTSVDIGRVAAAEVTNLDKDVKSDDG 873

Query: 747  KL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMATCGS 797
            +L     E     N+   L+A     ++ +  +V   C+ +      P      MA  G+
Sbjct: 874  ELLKRLEEILRDDNKLGILDAITSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMALSGA 933

Query: 798  KGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPP 857
            KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P 
Sbjct: 934  KGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGIRPQ 993

Query: 858  EFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGD 917
            E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD
Sbjct: 994  EYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFLYGGD 1053

Query: 918  GLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLL----PYQIIAETNVILQPLENKLK 973
             +D +  E +     F             DN   LL    P  ++   +V     E+ LK
Sbjct: 1054 AVD-ITKESHMTEFKF-----------CVDNYDALLKKYNPSALVDHLDV-----ESALK 1096

Query: 974  RYDNIGQELRKEDEHKDEYIDQFDAERSFYQS-LREFMTEKALTLASLRGERGLKELVDE 1032
             Y     + RK++     Y     A+ S Y   L +F   K L   S   +  L++ +  
Sbjct: 1097 -YSKKTLKNRKKNSKLPHY-----AQTSKYDPVLSKFNPSKYLGAVSENFQDKLEKFIST 1150

Query: 1033 PAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGA 1092
              +    F  DENV      AL QL                 KY R+ + PG AVG I +
Sbjct: 1151 NDD---FFKKDENVNEKKFRALMQL-----------------KYMRSLINPGEAVGIIAS 1190

Query: 1093 QSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERA 1151
            QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + +D  +  
Sbjct: 1191 QSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQLTMPIRDDVSDEL 1250

Query: 1152 ARVVKGRVEKTLLSDVSFYVQ 1172
            A      + K +LS+V   VQ
Sbjct: 1251 ADTFCKNITKVMLSEVIDKVQ 1271

 Score = 85.9 bits (211), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 89/168 (52%), Gaps = 10/168 (5%)

Query: 1263 RALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEVY 1321
            R +PHI         R V    ++GKR L+ EG   + +   D  I  +  ++N +  V 
Sbjct: 1490 RQVPHI--------DRCVHPEPENGKRVLVTEGVNFQAMWDQDDFIDINGIRSNDVAAVL 1541

Query: 1322 DVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSV 1381
               G+EAAR+ I+NEI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S+
Sbjct: 1542 KTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGNYLAFNRQGMESSTSSL 1601

Query: 1382 LQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            +++ S+E T   L  A    +++ ++  S  I++G+   +GTGSF ++
Sbjct: 1602 MKM-SYETTCQFLTKAVLDNEHEELKSPSAKIVMGKLNGVGTGSFDLL 1648

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 59/134 (44%), Gaps = 12/134 (8%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  I FS L++ +I   S  +++   +  LDN     +GG  D  +G       C TC 
Sbjct: 10  EITSIDFSVLTSDEIRKLSAKQVTNPTV--LDNLGHPIQGGLYDLALGAFLKNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR--- 128
            +   C GH GHI+L +P ++  +F      L+S C  C    L   +   +  +LR   
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLKSSEVHLYACKLRLLQ 126

Query: 129 ------RPGMDNLR 136
                 R  +DN+R
Sbjct: 127 YALIDERYQIDNIR 140

>Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {ON}
            YOR341W (RPA190) - RNA polymerase I subunit 190 (alpha)
            [contig 46] FULL
          Length = 1654

 Score =  447 bits (1151), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 319/978 (32%), Positives = 499/978 (51%), Gaps = 124/978 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK---------- 300
            R + +    +  PP   R PS + ++   ++++ L   L++I+ TS LI+          
Sbjct: 345  RADMFFLEVVIVPPTRFRLPSKLGEEIHENSQNQL---LSKILTTSLLIRDLNEEMSKLQ 401

Query: 301  ----AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLK 356
                +  +K +  N +M  +  +Q  V  +I+S         GS+G K  PI G  Q L+
Sbjct: 402  KDKVSAQDKIVIFNRLMNAFVTIQNDVNAFIDSTKAQ-----GSAGGKV-PIPGVKQALE 455

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 456  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQ 515

Query: 417  LVINGPKVHPGANYLLKKNEDARRNLRYG----DRVKLAKQL----------QYGDVVER 462
             VINGP   PGA+ +  +NED       G     R  LA QL               V R
Sbjct: 516  AVINGPDKWPGASQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSSTHSLNKKVYR 573

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 574  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 633

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMM 581
             E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R +  Q +   
Sbjct: 634  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYGC 693

Query: 582  ------SDSNLQFDIPPPSIMKPHYLWTGKQVFS-LLIKPSRKSPVVINLDAKNKVYLPP 634
                    +  +    PP++MKP  LWTGKQ+ + +L+  +      INL +KNK+    
Sbjct: 694  IRPEDGHATRNKLVTVPPAVMKPVPLWTGKQIITTVLLNVTPADMPGINLISKNKI---- 749

Query: 635  PKKEYPNEMS-QNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMN 693
             K +Y  + S +ND  V+ +   +L G++DKS  G   K+ + +++   YGP  +A+ ++
Sbjct: 750  -KNDYWGKHSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPAVSAKVLS 805

Query: 694  RMAKLCARYLGNRGFSIGINDVTPGSDLKQKKEQMVESAY----AKCDELIDL-----FN 744
             + +L   Y+    F+ G++D+    D  + +  +++++     A   E+ +L      N
Sbjct: 806  VLGRLFTNYITATAFTCGMDDLRLTDDGNKWRSDILKTSTDVGRAAAAEVTNLDPDVSAN 865

Query: 745  KGKL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI-----RELDNLNAPLIMAT 794
              +L     E     N+   L+A     ++ +  +V   C+     ++  N N+   MA 
Sbjct: 866  DTELLKRLEEILRDDNKLGILDAVTSSKVNTITSQVVSKCVPGGTMKKFPN-NSMQAMAL 924

Query: 795  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 854
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+
Sbjct: 925  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMISGKTLPSFKPFETDAMAGGYIKGRFYSGI 984

Query: 855  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 914
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF Y
Sbjct: 985  RPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFLY 1044

Query: 915  GGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLL----PYQIIAETNVILQPLEN 970
            GGD +D +  E +     F             DN   LL    P  +I   +V     E+
Sbjct: 1045 GGDAVD-VTQESHMTEFKF-----------CADNYDALLKKYNPSALIEHLDV-----ES 1087

Query: 971  KLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKELV 1030
             LK Y     + RK    K+E +  F  +  +   + +F   K L   S   +  L+  +
Sbjct: 1088 ALK-YSKKALKNRK----KNERVPHFAQKVKYDPVVSKFNPSKYLGSVSENFQDKLESFI 1142

Query: 1031 DEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAI 1090
            D   E  +  +           ++N+         +KF ++   KY R+ + PG AVG I
Sbjct: 1143 DSNNELFKSRD-----------SVNE---------KKFRALMQLKYMRSLINPGEAVGII 1182

Query: 1091 GAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDE 1149
             +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D  +
Sbjct: 1183 ASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILADVTD 1242

Query: 1150 RAARVVKGRVEKTLLSDV 1167
              A      + K +LS+V
Sbjct: 1243 SQADTFCKSITKVMLSEV 1260

 Score = 86.3 bits (212), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 90/162 (55%), Gaps = 2/162 (1%)

Query: 1269 VVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEVYDVLGIE 1327
            V++   +I R V    ++GKR L+ EG   +++   D  +  +   +N +  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFVDVNGITSNDVSSVLKTYGVE 1546

Query: 1328 AARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVLQLASF 1387
            AAR+ I+NEI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1388 EKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    +++ ++  S  ++LG+  ++GTG+F V+
Sbjct: 1606 ETTCQFLTKAVLDNESENLDSPSARLVLGKLNNVGTGAFDVL 1647

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + F  ++A DI + S ++I+   +  LDN      GG  D  +G       C TC 
Sbjct: 10  EITSVDFGVMTAQDIRNFSAMQITNPTV--LDNLGHPISGGLYDLALGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L+S C  C    L   +  ++  +L+
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHGFRLKAPEVHRYACKLK 123

>TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7.51
            YOR341W
          Length = 1665

 Score =  447 bits (1150), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 317/974 (32%), Positives = 500/974 (51%), Gaps = 116/974 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLE 304
            + + +    +  PP   R PS M ++   + ++ L   L++I+ TS LI+      + ++
Sbjct: 350  KADNFFMEVVLVPPTRFRLPSKMGEEVHENTQNQL---LSKILTTSLLIRDLNDEMSTIQ 406

Query: 305  KG-ISINN-------MMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLK 356
            K  +S+++       +M  +  +Q  V  +I+S         GS+ +K  P+ G  Q L+
Sbjct: 407  KDKVSVDDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GSASSKI-PVPGVKQALE 460

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 461  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELRQ 520

Query: 417  LVINGPKVHPGANYLLKKNEDARR----NLRYGDRVKLAKQLQ----------YGDVVER 462
             VINGP   PGA+ +  +NED        +    R  LA QL               V R
Sbjct: 521  AVINGPDKWPGASQI--QNEDGTLVSLVGMTLEQRKALANQLMTPSSNVSTHPLNKKVYR 578

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 579  HIKNRDVVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 638

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLL--- 578
             E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R +  Q +   
Sbjct: 639  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYGC 698

Query: 579  ---SMMSDSNLQFDIPPPSIMKPHYLWTGKQVFS-LLIKPSRKSPVVINLDAKNKVYLPP 634
                    S  +    PP+++KP  LWTGKQ+ S +L+  +      INL++ NK+    
Sbjct: 699  IRPEHGHASRGKIVTMPPAVLKPVPLWTGKQIISTVLLNVTPADMPGINLESNNKI---- 754

Query: 635  PKKEYPNEMS-QNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMN 693
             K EY  + S +ND  V+ +   ++ G++DKS  G   K+ + +++   YGP  AA+ ++
Sbjct: 755  -KNEYWGKGSTEND--VIFKNGELVCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLS 810

Query: 694  RMAKLCARYLGNRGFSIGINDVTPGSDLKQKKEQMVES-------AYAKCDEL------- 739
             + +L   Y+    F+ G++D+   ++  + + +++++       A A+   L       
Sbjct: 811  VLGRLFTNYITATAFTCGMDDLRLTAEGNKSRSEILKTSIDIGRQAAAEVTNLDKDTPSD 870

Query: 740  -IDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMAT 794
             ++L  + + E     N+   L+A     ++ V  +V   C+ +      P      MA 
Sbjct: 871  DVELLKRLE-EILRDENKSGILDAVTSSKVNTVTSKVVSTCVPDGTMKKFPYNSMQAMAL 929

Query: 795  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 854
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+
Sbjct: 930  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSGI 989

Query: 855  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 914
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF Y
Sbjct: 990  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGSLIQFLY 1049

Query: 915  GGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAETNVILQPLENKLKR 974
            GGD +D +  E +    +F R    A    L   +P  L   +  ET +          +
Sbjct: 1050 GGDAVD-VTKESHMTQFDFCRENYDA---LLKKYNPVALAEHLDVETAL----------Q 1095

Query: 975  YDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKELVDEPA 1034
            Y     + RK    K+     ++ +  +   L ++   K L   S +    L+  +++ A
Sbjct: 1096 YSKKVSKNRK----KNSKTAHYEQKVKYDPVLAKYNPAKYLGSVSEKFHDKLESYLEDKA 1151

Query: 1035 EELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQS 1094
               +EF   E+V A    AL QL                 KY R+ + PG AVG I +QS
Sbjct: 1152 ---KEFKSRESVSAKRFRALMQL-----------------KYMRSLINPGEAVGIIASQS 1191

Query: 1095 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERAAR 1153
            +GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + +D  +  A 
Sbjct: 1192 VGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSAIKTPQMTLPIWDDVSDEQAD 1251

Query: 1154 VVKGRVEKTLLSDV 1167
            +    + K +LS+V
Sbjct: 1252 LFCKSISKVVLSEV 1265

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 85/162 (52%), Gaps = 2/162 (1%)

Query: 1269 VVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKT-NHILEVYDVLGIE 1327
            V++    I R V +   + KR L+ EG   + +   +  I     T N +  V    G+E
Sbjct: 1497 VIREVPHIDRCVHSEPVNNKRMLVTEGVNFQAMWDQEAFIDVDAITSNDVASVLRTYGVE 1556

Query: 1328 AARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVLQLASF 1387
            AAR+ I+NEI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1615

Query: 1388 EKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    + + +E  S  I+LG+  ++GTGSF ++
Sbjct: 1616 ETTCQFLTKAVLDNEREELESPSARIVLGKLSNVGTGSFDLL 1657

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + F+ L+  DI + S  +I+   +  LDN      GG  D  +G       C+TC 
Sbjct: 10  EITSLDFNILTPQDIRNLSAKQITNPTV--LDNLGHPISGGLYDLSLGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L+S C  C    L + +  ++  +L+
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSCCLFCHHFRLKKVEVHRYACKLK 123

>ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1667

 Score =  447 bits (1150), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 344/1104 (31%), Positives = 550/1104 (49%), Gaps = 159/1104 (14%)

Query: 249  KSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------A 301
            KS  P+ +    +  PP   R PS + ++   + ++ L   L++++ TS LI+      +
Sbjct: 349  KSVTPDVFFMEVVLVPPTRFRLPSKLGEEVHENTQNQL---LSKVLTTSLLIRDLNDEMS 405

Query: 302  GLEKG--------ISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQ 353
             L+K         +  + +M  +  +Q  V  +I+S         GS+G K  PI G  Q
Sbjct: 406  NLQKDKVSVEDRRVIFSRLMNAFVTIQNDVNSFIDSTKAQ-----GSTGGKV-PIPGVKQ 459

Query: 354  RLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHK 413
             L+ K+G FR ++ GKRV+ + R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +
Sbjct: 460  ALEKKEGLFRKHMMGKRVNHAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAE 519

Query: 414  LQQLVINGPKVHPGANYLLKKNEDARR----NLRYGDRVKLAKQL----------QYGDV 459
            L+Q VINGP   PGA  +  +NED        +    R  LA QL               
Sbjct: 520  LRQAVINGPDKWPGATQI--QNEDGSLVSLVGMTLEQRNALANQLLTPSSNPATHTLNKK 577

Query: 460  VERHIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLH 518
            V RHI++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H
Sbjct: 578  VFRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMH 637

Query: 519  VPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLL 578
             PQ E AR+EA NL    +  LTP SG P+    QD I+    +++KDSFF R Q  Q +
Sbjct: 638  FPQNENARSEAFNLANTDSQYLTPTSGSPLRGLIQDHISAGVWLTNKDSFFTRDQYQQYI 697

Query: 579  SMM------SDSNLQFDIPPPSIMKPHYLWTGKQVFSLLIKPSRKSPVV-INLDAKNKVY 631
                       +  +    PP++MKP  LWTGKQ+ + +I     + +  INL +KNK+ 
Sbjct: 698  YGCIRPEDGHSTRPKIVTVPPAVMKPVPLWTGKQIITTVIMNVTPADMPGINLLSKNKI- 756

Query: 632  LPPPKKEYPNEMSQNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQA 691
                K EY  + S  +  +   G+ +L G++DKS  G   K+ + +++   YGP  AA+ 
Sbjct: 757  ----KNEYWGQGSTENEVIFKDGA-LLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKV 810

Query: 692  MNRMAKLCARYLGNRGFSIGINDVTPGSDLKQKKEQMVESAY----AKCDELIDL----- 742
            ++ + +L   ++ N  FS G++D+   ++  + ++ +++++         E+ +L     
Sbjct: 811  LSVLGRLFTNFITNTAFSCGMDDLRLTAEGNKDRKDLLKTSTDVGRQAAAEVTNLPTDTP 870

Query: 743  FNKGKL-----ETQPGCNEEQTLEA----KIGGLLSKVREEVGEVCIRELDNLNAPLIMA 793
             N  +L     E     N+   L+A    K+  + SKV   V      +    N+   MA
Sbjct: 871  SNDPELLKRLEEILRDDNKSGILDAVTSSKVNSVTSKVVSTVIPKGTMKKFPQNSMQAMA 930

Query: 794  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 853
              G+KGST+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 931  LSGAKGSTVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSG 990

Query: 854  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFT 913
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQF 
Sbjct: 991  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHVSYDNTVRDGDGTLVQFL 1050

Query: 914  YGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAETNVILQPLENKLK 973
            YGGD +D        Q   F+    + + L L   +P  L   +  E+   L+  +  LK
Sbjct: 1051 YGGDAVDTTKESHMTQ---FDFCLENYDAL-LRKYNPSALVEHLDVES--ALKYSKKALK 1104

Query: 974  RYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKELVDEP 1033
                I     KE  +K+   D++D        L ++   K L   S + +  L+  +D  
Sbjct: 1105 SRKKID----KEPHYKNS--DKYDP------VLSKYNPAKYLGSVSEKFQDKLEGFLDSH 1152

Query: 1034 AEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQ 1093
            +++L+           +   +N+         +KF ++   KY R+ V PG AVG I AQ
Sbjct: 1153 SKQLK-----------LHSGINE---------KKFRALMQLKYMRSLVNPGEAVGIIAAQ 1192

Query: 1094 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERAA 1152
            S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP ++  + N   +  A
Sbjct: 1193 SVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIVMTASAAIKTPQMSLPVWNHVSDDQA 1252

Query: 1153 RVVKGRVEKTLLSDV--------------------------SFYVQDIYRDN-------- 1178
             +    + K +LS+V                           FY +D Y +         
Sbjct: 1253 SIFCKSITKVVLSEVVDKVTVTETTGVSEHGSPARSYAVHMKFYGKDAYGEEYDVSKEEL 1312

Query: 1179 --------MAFLQIKIDSETIEKLQLELTLEDIVVAIAKAPKLKIGTNDISIIGKDKINI 1230
                    + +L++ I  E   K Q + ++ DI VA+ K+ +  +G+ +    G ++ N 
Sbjct: 1313 QNVVATKFLYYLEMAIVKEL--KKQKKTSMPDIGVAVPKS-QTALGSGEGPTSGSNEDND 1369

Query: 1231 AVSSDGKSMKSISTAMKEPEPNEV 1254
               +  K+ +++S   +EP+ +E+
Sbjct: 1370 EEEARQKTKQAVS--YEEPDEDEI 1391

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 81/162 (50%), Gaps = 2/162 (1%)

Query: 1269 VVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEVYDVLGIE 1327
            V++    ISR +       +R L  EG   + +   +  I     ++N +  V    G+E
Sbjct: 1500 VIREVPHISRCIPGEPVGDRRMLTTEGVNFQAMWDQEMFIDVDGIRSNDVAAVLRTYGVE 1559

Query: 1328 AARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVLQLASF 1387
            AAR+ I+ EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1560 AARNTIVYEINNVFSRYAISVSFRHLDLIADLMTRQGNYLAFNRQGMETSTSSFMKM-SY 1618

Query: 1388 EKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A      + ++  S  I+LG+  ++GTG+F V+
Sbjct: 1619 ETTCQFLTKAVLDNDREKLQSPSARIVLGKLNNVGTGAFDVL 1660

 Score = 49.3 bits (116), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 53/117 (45%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + F+  SA +I + S  +I+   +  LDN      GG  D  +G       C TC 
Sbjct: 10  EISSVDFNVFSAEEIRNLSAKQITNPTV--LDNLGHPISGGLYDLALGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L+S C  C    L   +  +F  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHRFRLRSIEVNRFACKLR 123

>NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {ON}
            Anc_7.51
          Length = 1669

 Score =  443 bits (1139), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 332/1001 (33%), Positives = 508/1001 (50%), Gaps = 129/1001 (12%)

Query: 229  NLFKQI---KPNDCELLGIDSTSKSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDD 284
            N+FK I   KPN      + ST  S   + +    +  PP   R PS +  +   ++++ 
Sbjct: 336  NIFKYIFHSKPN------VSSTPISA--DMFFMDVIVVPPTRFRLPSKLGDEIHENSQNQ 387

Query: 285  LTVKLTEIVWTSSLIK------AGLEKG-ISINN-------MMEQWDYLQLAVAMYINSD 330
            L   L++I+ T+ LI+      + L+K  +S+++       +M  +  +Q  V  +I+S 
Sbjct: 388  L---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRVIFSRLMNAFVTIQNDVNAFIDST 444

Query: 331  SVNPSMLPGSSGTKSKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEV 390
                    G++G K  PI G  Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  +E+
Sbjct: 445  KAQ-----GTTGGKV-PIPGVKQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETNEI 498

Query: 391  AVPDRVAKILTYPEKVTRYNKHKLQQLVINGPKVHPGANYLLKKNEDARR----NLRYGD 446
             VP   A  LTYPE VT YN  +L+Q VINGP   PGA  +  +NED        +    
Sbjct: 499  GVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWPGAAQI--QNEDGSLVSLVGMSAEQ 556

Query: 447  RVKLAKQLQ----------YGDVVERHIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RT 495
            R  LA QL               V RHI++ D+V+ NRQP+LH+ S++ H  ++ P  +T
Sbjct: 557  RKALANQLMTPSSNVGTHTLNKKVYRHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKT 616

Query: 496  FRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDF 555
             RL+      YNADFDGDEMN+H PQ E ARAEA NL    +  LTP SG P+    QD 
Sbjct: 617  LRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDH 676

Query: 556  ITGSYLISHKDSFFDRAQLTQLL-SMMSDSNLQFDIP-----PPSIMKPHYLWTGKQVFS 609
            I+    ++ KDSFF R Q  Q +   +   +     P     PP+I KP  LWTGKQ+ S
Sbjct: 677  ISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHATRPKLITLPPTIYKPVPLWTGKQIIS 736

Query: 610  -LLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSGVMDKSVLG 668
             +L+  +      INL + NK+     K EY  + S N+  VL +   +L G++DKS  G
Sbjct: 737  TVLLNVTPADMPGINLTSSNKI-----KNEYWGK-SSNENEVLFKNGELLCGILDKSQYG 790

Query: 669  DGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGSDLKQKKEQM 728
               K  + +++   YGP+ AA+ ++ + +L   Y+ +  F+ G++D+    +  + +  +
Sbjct: 791  -ASKFGIVHSLHEVYGPSIAAKVLSVLGRLFTNYIMSTAFTCGMDDLRLSEEGNKWRSDI 849

Query: 729  ----VESAYAKCDELIDL----------FNKGKLETQPGCNEEQTLEAKIGGLLSKVREE 774
                V++      E+ +L            K   E     N+   L+A     ++ +  +
Sbjct: 850  LKTSVDTGREAAAEVTNLDKDTAADDAELLKRLEEILRDNNKSGILDAVTSSKVNSITSK 909

Query: 775  VGEVCIRELDNLNAPL----IMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSL 830
            V   C+ +      P      MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++L
Sbjct: 910  VVSKCVPDGTMKKFPYNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTL 969

Query: 831  PHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKS 890
            P F        + G+++  F+SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K 
Sbjct: 970  PSFKPYETDAMAGGYIKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQ 1029

Query: 891  LEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSP 950
            LE +   YDN+VR     ++QF YGGD    +D+   +    F+    + + L LN  +P
Sbjct: 1030 LEGVHVSYDNSVRDGDGTLIQFLYGGDA---VDVTKESHMTEFDFCLDNYDAL-LNKYNP 1085

Query: 951  GLLPYQIIAETNVIL--QPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLRE 1008
              L   +  ET +    + L+N+ K          KE  HK+    ++D        L +
Sbjct: 1086 SALIEHLDVETALKYSKKTLKNRKKH--------AKEAHHKN--ATKYDP------VLSK 1129

Query: 1009 FMTEKALTLASLRGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKF 1068
            F   K L   S + +  L+  +D+ +   + F   +NV      AL QL           
Sbjct: 1130 FNPAKYLGSVSEKFQDKLESYLDKNS---KLFKSHDNVSEKKFRALMQL----------- 1175

Query: 1069 LSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII 1128
                  KY R+ + PG AVG I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII
Sbjct: 1176 ------KYMRSLINPGEAVGIIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREII 1229

Query: 1129 -NASKVISTPIINAVLVND-NDERAARVVKGRVEKTLLSDV 1167
              AS  I TP +   +  D +DE+A    K  + K +LS+V
Sbjct: 1230 MTASAAIKTPQMTLPIWQDVSDEQADTFCKS-ISKVVLSEV 1269

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 86/168 (51%), Gaps = 10/168 (5%)

Query: 1263 RALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEVY 1321
            R +PHI         R V    ++GKR L+ EG     +   +  I      +N +  V 
Sbjct: 1504 REVPHI--------DRCVHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVL 1555

Query: 1322 DVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSV 1381
               G+EAAR+ I+NEI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S+
Sbjct: 1556 KTYGVEAARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSL 1615

Query: 1382 LQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            +++ S+E T   L  A    + + +E  S  I++G+  ++GTGSF ++
Sbjct: 1616 MKM-SYETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1662

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + F  L++ +I   S  +I+   +  LDN      GG  D  +G       C++C 
Sbjct: 10  EITSVDFGILTSEEIRQLSAKQITNPTV--LDNLGHPISGGLYDLSLGAFLRNL-CSSCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L++ C  C  L L + +  +F  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHLKLKQIEVHRFACKLR 123

>Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON}
            complement(6642..11612) [4971 nt, 1657 aa]
          Length = 1656

 Score =  442 bits (1137), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 314/974 (32%), Positives = 495/974 (50%), Gaps = 116/974 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLE 304
            + +T+    +  PP   R PS +  +   + ++ L   L++I+ TS LI+      + L+
Sbjct: 346  KADTFFMEVVLVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 402

Query: 305  KG--------ISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLK 356
            K         +  + +M  +  +Q  V  +I+S         G++G K  PI G  Q L+
Sbjct: 403  KDKVSLQDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GNTGGKV-PIPGVKQALE 456

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 457  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQ 516

Query: 417  LVINGPKVHPGANYLLKKNEDARR----NLRYGDRVKLAKQLQ----------YGDVVER 462
             VINGP   PGA+ +  +NED        +    R  LA QL               V R
Sbjct: 517  AVINGPDKWPGASQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSSNIATHTLNKKVYR 574

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 575  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 634

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLL--- 578
             E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R Q  Q +   
Sbjct: 635  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 694

Query: 579  ---SMMSDSNLQFDIPPPSIMKPHYLWTGKQVFS-LLIKPSRKSPVVINLDAKNKVYLPP 634
                    +  +    PP++ KP  LWTGKQ+ + +L+  +      INL++ NK+    
Sbjct: 695  IRPEHGHTTRSKIVTVPPAVFKPVPLWTGKQIITTVLLNVTPSDMPGINLNSSNKI---- 750

Query: 635  PKKEY-PNEMSQNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMN 693
             K EY  N  ++ND  V+ +   +L G++DKS  G   K+ + +++   YGP+ AA+ ++
Sbjct: 751  -KNEYWGNGSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVAAKVLS 806

Query: 694  RMAKLCARYLGNRGFSIGINDVTPGSDLKQKKEQMVESAY-----AKCDELIDL------ 742
             + +L   Y+    F+ G++D+    +  + ++ +++++      A C E+ +L      
Sbjct: 807  VLGRLFTNYITATAFTCGMDDLRLTDEGNKWRKDILKTSVDTGRQAAC-EVTNLEKETAS 865

Query: 743  ----FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMAT 794
                  K   E     N+   L+A     ++ +  +V   C+ +      P      MA 
Sbjct: 866  DDSELLKRLEEILRDDNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMAL 925

Query: 795  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 854
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+
Sbjct: 926  SGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPFETDAMAGGYIKGRFYSGI 985

Query: 855  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 914
             P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF Y
Sbjct: 986  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFLY 1045

Query: 915  GGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAETNVILQPLENKLKR 974
            GGD    +D+   +    F     + ++L L   +P  L   +  ET +      +K ++
Sbjct: 1046 GGDS---VDVTKESHLTQFEFCLENYDSL-LKKYNPSALIEHLDVETALKYSKKASKSRK 1101

Query: 975  YDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKELVDEPA 1034
             +      RK        +  ++    +  +L +F   K L   S + +  L+  +D  A
Sbjct: 1102 KN------RK--------VPHYEQNIKYDPALAKFNPAKYLGAVSEKFQDKLELFLDSNA 1147

Query: 1035 EELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQS 1094
                 F  D++V      AL QL                 KY R+ + PG +VG I +QS
Sbjct: 1148 S---LFESDKSVNEKKFRALMQL-----------------KYMRSLINPGESVGIIASQS 1187

Query: 1095 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERAAR 1153
            +GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  +  A 
Sbjct: 1188 VGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVSDDQAD 1247

Query: 1154 VVKGRVEKTLLSDV 1167
            V    + K LLS+V
Sbjct: 1248 VFSKSISKVLLSEV 1261

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1269 VVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEVYDVLGIE 1327
            V++    I R V    ++GKR L+ EG   + +   +  IG     +N +  V    G+E
Sbjct: 1489 VIRQVPFIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIGVDGITSNDVSAVLKTYGVE 1548

Query: 1328 AARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVLQLASF 1387
            AAR+ I+NEI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1549 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1607

Query: 1388 EKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    +N+ ++  S  I+LG+  ++GTG+F V+
Sbjct: 1608 ETTCQFLTKAVLDNENEELKSPSARIVLGKLNNVGTGAFDVL 1649

 Score = 49.3 bits (116), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  I FS L+A +I + S  +I+   +  LDN      GG  D  +G       C+TC 
Sbjct: 10  EITSIDFSILTAQEIRNLSAKQITNPTV--LDNLGHPISGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L+S C  C    L   +  ++  +L+
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSIEVHRYTCKLK 123

>TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7.51
            YOR341W
          Length = 1648

 Score =  441 bits (1135), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 326/1057 (30%), Positives = 521/1057 (49%), Gaps = 151/1057 (14%)

Query: 247  TSKSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK----- 300
            T K  + + +    +  PP   R PS +  +   ++++ L   L++I+ TS LI+     
Sbjct: 340  TGKIVKADDFFMDVVLVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDE 396

Query: 301  ---------AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGF 351
                     A  ++ I  + +M  +  +Q  V  +I+S     S   G++  K  P+ G 
Sbjct: 397  ISKLQKDKVALDDRRIIFSRLMNAFVTIQNDVNSFIDS-----SKAQGNNSGKL-PVPGV 450

Query: 352  CQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNK 411
             Q L+ K+G FR ++ GKRV+++ R+VISPDPN+  DE+ VP   A  LTYPE VT YN 
Sbjct: 451  KQALEKKEGLFRKHMMGKRVNYAARSVISPDPNIETDEIGVPPVFATKLTYPEPVTSYNI 510

Query: 412  HKLQQLVINGPKVHPGANYLLKKNEDARR----NLRYGDRVKLAKQLQ----------YG 457
             +L+Q VINGP   PGA  +  +NED        +    R  LA QL             
Sbjct: 511  AELRQAVINGPDKWPGATQI--QNEDGSLVSLIGMTVEQRKALANQLMTPSSNPATHTLN 568

Query: 458  DVVERHIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMN 516
              V RHI++ DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN
Sbjct: 569  KKVYRHIKNRDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMN 628

Query: 517  LHVPQTEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQ 576
            +H PQ E ARAEA NL    +  LTP SG P+    QD I+    ++ KDS+F R Q  Q
Sbjct: 629  MHFPQNENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSYFTREQYQQ 688

Query: 577  LLSMM------SDSNLQFDIPPPSIMKPHYLWTGKQVF-SLLIKPSRKSPVVINLDAKNK 629
             +           +N +    PP+I+KP  LWTGKQ+  ++L+  S      INL +KNK
Sbjct: 689  YIYGCIRPEDGHSANNKLLTIPPAIIKPVPLWTGKQIITTVLLNVSPVDMPGINLKSKNK 748

Query: 630  VYLPPPKKEYPNEMSQNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAA 689
            +     K EY  + S+ +  VL +   +L G++DKS  G   K+ + + +   YGP  AA
Sbjct: 749  I-----KDEYWGQHSEENE-VLFKDGALLCGILDKSQYG-ASKYGIVHALQEVYGPEVAA 801

Query: 690  QAMNRMAKLCARYLGNRGFSIGINDVTPGSDLKQKKEQMVESAYAKCDE-LIDLFNKGKL 748
            + ++ + +L   Y+ N  F+ G++D+    +  + +  +++++  +  +  +++ N  K 
Sbjct: 802  KVLSVLGRLFTNYITNTAFTCGMDDLRLTDEGNKWRTDILKTSVDRGRQAAVEVTNLEKD 861

Query: 749  ETQPGC-------------NEEQTLEAKIGGLLSKVREEVGEVCI----RELDNLNAPLI 791
             +                 N+   L+A     ++ +  +V   C+     +    N+   
Sbjct: 862  TSADDSELLKRLEEILRDDNKSGILDAVTSSKVNAITSQVVSKCVPGGTMKRFPENSMQS 921

Query: 792  MATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFF 851
            MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+
Sbjct: 922  MALSGAKGSNVNVSQIMCLLGQQALEGRRVPIMVSGKTLPSFKPFETDAMAGGYIKGRFY 981

Query: 852  SGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQ 911
            SG+ P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++
Sbjct: 982  SGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLIE 1041

Query: 912  FTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAETNVILQPLENK 971
            F YGGD +D               S+ +  +  L++    L  Y   A  + +   +++ 
Sbjct: 1042 FLYGGDAVDVT-----------KESYMNQFDFCLDNYDSLLKRYNPAALIDFL--DVDSA 1088

Query: 972  LKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKELVD 1031
            LK Y     + RK++++   Y+        +   L ++   K L   S + +  L+  +D
Sbjct: 1089 LK-YSKKTLKHRKKNKNVPHYLQNI----KYDPVLAKYNPAKYLGSVSEKFQDKLENFLD 1143

Query: 1032 EPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIG 1091
              ++  +              ++N+         +KF ++   KY R+ + PG AVG I 
Sbjct: 1144 SNSQLFKSHK-----------SVNE---------KKFRALMQLKYMRSLINPGEAVGIIA 1183

Query: 1092 AQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDER 1150
            +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  + 
Sbjct: 1184 SQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVTDD 1243

Query: 1151 AARVVKGRVEKTLLSDV---------------------SFYVQDIYRDN----------- 1178
             A +    + K +LS+V                      FY QD Y +            
Sbjct: 1244 QADIFAKSISKVILSEVIDSVSVTETTTSQSRSYVISMKFYEQDEYNEEYDISKEELQNV 1303

Query: 1179 -----MAFLQIKIDSETIEKLQLELTLEDIVVAIAKA 1210
                 +  L+I I  E   K Q + T  D+ +AI KA
Sbjct: 1304 VANNFLTSLEIAIHKEI--KKQKKTTASDVGIAIPKA 1338

 Score = 86.7 bits (213), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 88/167 (52%), Gaps = 12/167 (7%)

Query: 1269 VVKGFSDISRAVINIRDDGKRELLVEGYGLR------DVMTTDGVIGSKTKTNHILEVYD 1322
            VV+   +I R V    ++GKR L+ EG   +      D +  DG+      +N +  V  
Sbjct: 1481 VVRQVPNIDRCVHPNAENGKRVLVTEGVNFQAMWEQNDFVNVDGIT-----SNDVSSVLK 1535

Query: 1323 VLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVL 1382
              G+EAAR+ I+NEI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1536 TYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGSYLAFNRQGMETSTSSLM 1595

Query: 1383 QLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            ++ S+E T   L  A    + + +   S  I+LG+  ++GTG+F V+
Sbjct: 1596 KM-SYETTCQFLTKAVLDNEREELNSPSARIVLGKLNNVGTGAFDVL 1641

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + FS LSA +I + S  +I+   +  LDN      GG  D  +G       C+TC 
Sbjct: 10  EITSVDFSILSAEEIRNLSTKQITNPTV--LDNLGHPISGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L+S C  C    L   +  ++  +L+
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSVEVHRYTCKLK 123

>KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] {ON}
            highly similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1654

 Score =  440 bits (1132), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 320/980 (32%), Positives = 495/980 (50%), Gaps = 128/980 (13%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            R + +    +  PP   R PS + ++   + ++ L   L++I+ TS LI           
Sbjct: 346  RADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 402

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLK 356
              K  +E K +  N +M  +  +Q  V  +I+S         G++G K  PI G  Q L+
Sbjct: 403  KDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDSTKAQ-----GNTGGKV-PIPGVKQALE 456

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 457  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQ 516

Query: 417  LVINGPKVHPGANYLLKKNEDARRNLRYG----DRVKLAKQL----------QYGDVVER 462
             VINGP   PGA  +  +NED       G     R  LA QL               V R
Sbjct: 517  AVINGPDKWPGATQI--QNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATHSLNKKVYR 574

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 575  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 634

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLL--- 578
             E ARAEA NL    +  LTP SG P+    QD I+    +++KDSFF R +  Q +   
Sbjct: 635  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREEYQQYIYGC 694

Query: 579  ----SMMSDSNLQFDIPPPSIMKPHYLWTGKQVF-SLLIKPSRKSPVVINLDAKNKVYLP 633
                   +  N    + PP++ KP  LWTGKQ+  ++L+  +      INL +KNK+   
Sbjct: 695  IRPEDGHATRNKLLTV-PPAVFKPVPLWTGKQIITTVLLNVTPADMPGINLLSKNKI--- 750

Query: 634  PPKKEYPNEMS-QNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAM 692
              K EY  + S +ND  V+ +   +L G++DKS  G   K+ + +++   YGP+ +A+ +
Sbjct: 751  --KNEYWGKGSTEND--VVFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVSAKVL 805

Query: 693  NRMAKLCARYLGNRGFSIGINDVTPGSDLKQKKEQMVESAY----AKCDELIDL-----F 743
            + + +L   Y+    F+ G++D+    +  + +  +++++         E+ +L      
Sbjct: 806  SVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRSDILKTSTDVGRVAAAEVTNLDKDVSA 865

Query: 744  NKGKL-----ETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI-----RELDNLNAPLIMA 793
            N  +L     E     N+   L+A     ++ +  +V   C+     ++  N N+   MA
Sbjct: 866  NDSELLKRLEEILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPN-NSMQAMA 924

Query: 794  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 853
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 925  LSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAMAGGYIKGRFYSG 984

Query: 854  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFT 913
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF 
Sbjct: 985  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFL 1044

Query: 914  YGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLL----PYQIIAETNVILQPLE 969
            YGGD +D +  E +     F             DN   LL    P  +I   +V     E
Sbjct: 1045 YGGDAVD-VTQESHMTQFKF-----------CADNYDALLKKYNPAALIEHLDV-----E 1087

Query: 970  NKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKEL 1029
            + LK Y     + RK    K E +  +  +  +   + +F   K L   S   +  L+  
Sbjct: 1088 SALK-YSKKALKHRK----KTEKVPHYSQKVKYDPVVSKFNPSKYLGSVSENFQDKLESF 1142

Query: 1030 VDEPAEELREFNWDENVPASITIALNQLCKISKILVQ-KFLSIAISKYHRARVEPGTAVG 1088
            +D                     + N L K    + + KF ++   KY R+ + PG AVG
Sbjct: 1143 ID---------------------SNNDLFKSRDTVSEKKFRALMQLKYMRSLINPGEAVG 1181

Query: 1089 AIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDN 1147
             I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D 
Sbjct: 1182 IIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILADV 1241

Query: 1148 DERAARVVKGRVEKTLLSDV 1167
             +  A      V K +LS+V
Sbjct: 1242 TDPQADTFCKSVTKVMLSEV 1261

 Score = 87.0 bits (214), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1269 VVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEVYDVLGIE 1327
            V++   +I R V    ++GKR L+ EG   +++   D  I  +   +N +  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFIDVNGITSNDVASVLKTYGVE 1546

Query: 1328 AARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVLQLASF 1387
            AAR+ I+NEI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1388 EKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    + + ++  S  I+LG+  ++GTG+F V+
Sbjct: 1606 ETTCQFLTKAVLDNECENLDSPSARIVLGKLNNVGTGAFDVL 1647

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + F  ++A DI + S ++I+   +  LDN      GG  D  +G       C TC 
Sbjct: 10  EITSVDFGVMTAQDIRNFSAMQITNPTV--LDNLGHPISGGLYDLALGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L+S C  C    L   +  ++  +L+
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSCLYCHGFRLKASEVHRYACKLK 123

>TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7.51
            YOR341W
          Length = 1659

 Score =  440 bits (1132), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 317/977 (32%), Positives = 496/977 (50%), Gaps = 120/977 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            +P+ +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 353  KPDAFFMDVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 409

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLK 356
              K  LE + +  + +M  +  +Q  V  +I+S     S   G++G  +  I G  Q L+
Sbjct: 410  KDKVSLEDRRVIFSRLMNAFVTIQNDVNSFIDS-----SKAQGNTGG-NDVIPGVKQALE 463

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 464  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTSYNIAELRQ 523

Query: 417  LVINGPKVHPGANYLLKKNEDARR----NLRYGDRVKLAKQLQ----------YGDVVER 462
             VINGP   PGA  +  +NED        +    R  LA QL               V R
Sbjct: 524  AVINGPDKWPGA--IQIQNEDGTLVSLIGMTLEQRKALANQLMTPSSNSSSHVLNKKVYR 581

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 582  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 641

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMM 581
             E ARAE++ L    +  LTP SG P+    QD I+    +++KDSFF R Q  Q +   
Sbjct: 642  NENARAESLFLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGC 701

Query: 582  ------SDSNLQFDIPPPSIMKPHYLWTGKQVFS---LLIKPSRKSPVVINLDAKNKVYL 632
                    +  +    PP+I KP  LWTGKQ+ +   L I PS      INL +KNK+  
Sbjct: 702  IRPEDGHATRAKIVTLPPTIFKPIPLWTGKQIITTVLLNITPSDMPG--INLHSKNKI-- 757

Query: 633  PPPKKEYPNEMSQNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAM 692
               K EY  + S N+  V+ +   +L G++DK+  G   K+ + +++   YGP+ AA+ +
Sbjct: 758  ---KNEYWGKGS-NENEVIFKDGALLCGILDKNQYG-SSKYGIVHSLHELYGPDVAAKVL 812

Query: 693  NRMAKLCARYLGNRGFSIGINDVTPGSDLKQKKEQM----VESAYAKCDELIDLFNKGKL 748
            + + +L   Y+    F+ G++D+    +  + +  +    V++      E+ +L +K   
Sbjct: 813  SVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRRDILKTSVDTGRQAAAEVTNL-SKDTP 871

Query: 749  ETQPGC-----------NEEQTLEAKIGGLLSKVREEVGEVCI----RELDNLNAPLIMA 793
               P             N+   L+A     ++ +  +V   C+     +    N+   MA
Sbjct: 872  ADDPELLKRLEEILRDDNKSGILDAVTSSKVNAITSKVVSTCVPGGTMKKFPYNSMQAMA 931

Query: 794  TCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 853
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 932  LSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPYETDAMAGGYIKGRFYSG 991

Query: 854  LSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFT 913
            + P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++F 
Sbjct: 992  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIEFL 1051

Query: 914  YGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAETNVILQPLENKLK 973
            YGGD    +D+   +    F     + + L    N     P  +I   NV     E+ LK
Sbjct: 1052 YGGDA---VDVTKESYMTQFKFCLENYDGLVKKYN-----PSALIEHLNV-----ESALK 1098

Query: 974  RYDNIGQELRKEDEHKDEYIDQFDAERSFYQS-LREFMTEKALTLASLRGERGLKELVDE 1032
             Y     + RK+      Y+     + S Y   L ++   K L   S + +  L+E ++E
Sbjct: 1099 -YSKKALKYRKKHSSVPHYL-----QNSKYDPVLAKYNPSKYLGSVSEKFQDKLEEFLNE 1152

Query: 1033 PAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGA 1092
             ++ ++            T  +N+         +KF ++   KY R+ ++PG +VG I +
Sbjct: 1153 NSKLVKS-----------TEGVNE---------KKFRALMQLKYMRSLIDPGESVGIIAS 1192

Query: 1093 QSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERA 1151
            QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +N  ++ND   + 
Sbjct: 1193 QSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSSIKTPQMNLPILNDVSNQQ 1252

Query: 1152 ARVVKGRVEKTLLSDVS 1168
            A      + K LLS V+
Sbjct: 1253 AETFCKSITKVLLSQVT 1269

 Score = 91.7 bits (226), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEVYDVLGIE 1327
            V++   +I R V    ++G R L+ EG   + +   D  I   K  +N +  V    G+E
Sbjct: 1492 VIREVPNIERCVYPEANNGDRSLITEGVNFQAMWDQDTFIDVDKITSNDVSAVLRTYGVE 1551

Query: 1328 AARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVLQLASF 1387
            AAR+ I+NEID   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1552 AARNTIVNEIDRVFSTYAISVSSRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1610

Query: 1388 EKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    +++ +   S  I+LG+  ++GTGSF ++
Sbjct: 1611 ETTCQFLTKAVLDNEHEELNSPSARIVLGKLNNVGTGSFDIL 1652

 Score = 47.4 bits (111), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + F  LS+  I + S  +I+   +  LDN      GG  D  +G       C+TC 
Sbjct: 10  EITSVDFEILSSDQIRNLSAKQITNPTV--LDNLGHPISGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L+S C  C    L   D   +  +L+
Sbjct: 67  QDEKFCPGHQGHIELPVPCYNPLFFNQLFIYLRSSCLYCHHFRLKSLDTHLYSCKLK 123

>Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  439 bits (1130), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 318/977 (32%), Positives = 492/977 (50%), Gaps = 122/977 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLK 356
              K  LE + +  + +M  +  +Q  V  +I+S         G +  K  PI G  Q L+
Sbjct: 408  KDKVSLEDRKVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSGKV-PIPGVKQALE 461

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQ 521

Query: 417  LVINGPKVHPGANYLLKKNEDARR----NLRYGDRVKLAKQL----------QYGDVVER 462
             VINGP   PGA  +  +NED        + +  R  LA QL               V R
Sbjct: 522  AVINGPDKWPGATQI--QNEDGSLVSLIGMSFEQRKALANQLLTPSSNVSTHTLNKKVYR 579

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMM 581
             E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R Q  Q +   
Sbjct: 640  NENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 582  ------SDSNLQFDIPPPSIMKPHYLWTGKQVF-SLLIKPSRKSPVVINLDAKNKVYLPP 634
                    +  +    PP+I KP+ LWTGKQ+  ++L+  +      INL +KNK+    
Sbjct: 700  IRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKI---- 755

Query: 635  PKKEYPNEMSQNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNR 694
             K EY  + S  +  VL +   +L G++DKS  G   K+ + +++   YGP  AA+ ++ 
Sbjct: 756  -KNEYWGKGSL-ESEVLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLSV 812

Query: 695  MAKLCARYLGNRGFSIGINDVTPGSDLKQKKEQM----VESAYAKCDELIDL-------- 742
            + +L   Y+    F+ G++D+   ++  + +  +    V++      E+ +L        
Sbjct: 813  LGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKETPSDD 872

Query: 743  --FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMATCG 796
                K   E     N+   L+A     ++ +  +V   C+ +      P      MA  G
Sbjct: 873  PELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQAMALSG 932

Query: 797  SKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSP 856
            +KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P
Sbjct: 933  AKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKP 992

Query: 857  PEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGG 916
             E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   ++QF YGG
Sbjct: 993  QEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQFMYGG 1052

Query: 917  DGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLL----PYQIIAETNVILQPLENKL 972
            D +D +  E +     F             DN   LL    P  +I   +V     E+ L
Sbjct: 1053 DAVD-ITKESHMTQFEF-----------CLDNYYALLKKYNPSALIEHLDV-----ESAL 1095

Query: 973  KRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKELVDE 1032
            K Y     + RK+   +  Y         +   L ++   K L   S   +  L+  +DE
Sbjct: 1096 K-YSKKTLKYRKKHSKEPHYKQSM----KYDPVLAKYSPAKYLGSVSENFQDKLESFLDE 1150

Query: 1033 PAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGA 1092
             ++  +            T  +N+         +KF ++   KY R+ + PG AVG I +
Sbjct: 1151 NSKLFKS-----------TDGVNE---------KKFRALMQLKYMRSLINPGEAVGIIAS 1190

Query: 1093 QSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVND-NDER 1150
            QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + +D +DE+
Sbjct: 1191 QSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWDDVSDEQ 1250

Query: 1151 AARVVKGRVEKTLLSDV 1167
            A    K  + K LLS+V
Sbjct: 1251 ADTFCKS-ISKVLLSEV 1266

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 85/162 (52%), Gaps = 2/162 (1%)

Query: 1269 VVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEVYDVLGIE 1327
            +++    I R V    ++GKR L+ EG   + +   +  I      +N +  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1328 AARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVLQLASF 1387
            AAR+ I+NEI+   S + +SV  RH+ LL D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1388 EKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    + + ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + F  L+A +I + S  +I+   +  LDN      GG  D  +G       C+TC 
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTV--LDNLGHPVSGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L++ C  C    L   +  ++  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RNA
            polymerase I largest subunit A190
          Length = 1664

 Score =  439 bits (1130), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 319/977 (32%), Positives = 492/977 (50%), Gaps = 122/977 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    L  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLK 356
              K  LE + +  + +M  +  +Q  V  +I+S         G +  K  PI G  Q L+
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSGKV-PIPGVKQALE 461

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQ 521

Query: 417  LVINGPKVHPGANYLLKKNEDARR----NLRYGDRVKLAKQL----------QYGDVVER 462
             VINGP   PGA  +  +NED        +    R  LA QL               V R
Sbjct: 522  AVINGPDKWPGATQI--QNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHTLNKKVYR 579

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMM 581
             E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R Q  Q +   
Sbjct: 640  NENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 582  ------SDSNLQFDIPPPSIMKPHYLWTGKQVFS-LLIKPSRKSPVVINLDAKNKVYLPP 634
                    +  +    PP+I KP+ LWTGKQ+ + +L+  +      INL +KNK+    
Sbjct: 700  IRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKI---- 755

Query: 635  PKKEYPNEMSQNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNR 694
             K EY  + S  +  VL +   +L G++DKS  G   K+ + +++   YGP  AA+ ++ 
Sbjct: 756  -KNEYWGKGSLENE-VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLSV 812

Query: 695  MAKLCARYLGNRGFSIGINDVTPGSDLKQKKEQM----VESAYAKCDELIDL-------- 742
            + +L   Y+    F+ G++D+   ++  + +  +    V++      E+ +L        
Sbjct: 813  LGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTPADD 872

Query: 743  --FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMATCG 796
                K   E     N+   L+A     ++ +  +V   C+ +      P      MA  G
Sbjct: 873  PELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMALSG 932

Query: 797  SKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSP 856
            +KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P
Sbjct: 933  AKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKP 992

Query: 857  PEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGG 916
             E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF YGG
Sbjct: 993  QEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMYGG 1052

Query: 917  DGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLL----PYQIIAETNVILQPLENKL 972
            D +D +  E +     F             DN   LL    P  +I   +V     E+ L
Sbjct: 1053 DAID-ITKESHMTQFEF-----------CLDNYYALLKKYNPSALIEHLDV-----ESAL 1095

Query: 973  KRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKELVDE 1032
            K Y     + RK+   +  Y         +   L ++   K L   S   +  L+  +D+
Sbjct: 1096 K-YSKKTLKYRKKHSKEPHYKQSV----KYDPVLAKYNPAKYLGSVSENFQDKLESFLDK 1150

Query: 1033 PAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGA 1092
             ++  +  +            +N+         +KF ++   KY R+ + PG AVG I +
Sbjct: 1151 NSKLFKSSD-----------GVNE---------KKFRALMQLKYMRSLINPGEAVGIIAS 1190

Query: 1093 QSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVND-NDER 1150
            QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + ND +DE+
Sbjct: 1191 QSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVSDEQ 1250

Query: 1151 AARVVKGRVEKTLLSDV 1167
            A    K  + K LLS+V
Sbjct: 1251 ADTFCKS-ISKVLLSEV 1266

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 86/168 (51%), Gaps = 10/168 (5%)

Query: 1263 RALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEVY 1321
            R +PHI         R V    ++GKR L+ EG   + +   +  I      +N +  V 
Sbjct: 1499 RQIPHI--------DRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVL 1550

Query: 1322 DVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSV 1381
               G+EAAR+ I+NEI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S 
Sbjct: 1551 KTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSF 1610

Query: 1382 LQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            +++ S+E T   L  A    + + ++  S  I++G+  ++GTGSF V+
Sbjct: 1611 MKM-SYETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1657

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + F  L+A +I + S  +I+   +  LDN      GG  D  +G       C+TC 
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTV--LDNLGHPVSGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L++ C  C    L   +  ++  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7.51
            YOR341W
          Length = 1671

 Score =  438 bits (1127), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 314/961 (32%), Positives = 490/961 (50%), Gaps = 113/961 (11%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLEKG--------IS 308
            PP   R PS M ++   ++++ L   L++I+ T+ LI+      + L+K         I 
Sbjct: 367  PPTRFRLPSKMGEEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRII 423

Query: 309  INNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGRFRGNLSG 368
             + +M  +  +Q  V  +I+S         GS+G  + P+ G  Q L+ K+G FR ++ G
Sbjct: 424  FSRLMNGFVTIQNDVNAFIDSTKAQ-----GSTGG-NVPVPGVKQALEKKEGLFRKHMMG 477

Query: 369  KRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVINGPKVHPGA 428
            KRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q VINGP   PGA
Sbjct: 478  KRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWPGA 537

Query: 429  NYLLKKNEDARR----NLRYGDRVKLAKQLQ-----------YGDVVERHIEDGDVVLFN 473
              L  +NED        +    R  LA QL                V RHI++ D+V+ N
Sbjct: 538  --LQIQNEDGSLVSLIGMTLEQRKALANQLMTPSYVGGATHTLNKKVYRHIKNRDIVIMN 595

Query: 474  RQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINL 532
            RQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA NL
Sbjct: 596  RQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNL 655

Query: 533  MGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLL-SMMSDSNLQFDIP 591
                +  LTP SG P+    QD I+    ++ KDSFF R Q  Q +   +   +     P
Sbjct: 656  ANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHATRP 715

Query: 592  -----PPSIMKPHYLWTGKQVFS-LLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQ 645
                 PP++ KP  LWTGKQ+ + +L+  +      INL + NK+     K EY  + S+
Sbjct: 716  KLVTVPPAVWKPVPLWTGKQIITTVLLNVTPADMPGINLKSNNKI-----KNEYWGKSSE 770

Query: 646  NDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGN 705
             +  VL +   +L G++DK+  G   K+ + +++   YGP+ AA+ ++ + +L   Y+  
Sbjct: 771  ENE-VLFKNGELLCGILDKNQYG-ASKYGIVHSLHEVYGPDIAAKVLSVLGRLFTNYIMA 828

Query: 706  RGFSIGINDVTPGSDLKQKKEQM----VESAYAKCDELIDL----------FNKGKLETQ 751
              F+ G++D+   ++  + ++ +    V++      E+ +L            K   E  
Sbjct: 829  TAFTCGMDDLRLTAEGNKWRKDILKTSVDTGREAAAEVTNLEKDTTADDPELLKRLQEVL 888

Query: 752  PGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMATCGSKGSTLNVSQM 807
               N+   L+A     ++ +  +V   C+ +      P      MA  G+KGS +NVSQ+
Sbjct: 889  RDNNKSGILDAVTSSKVNAITSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGSNVNVSQI 948

Query: 808  VAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFHAISGR 867
            + ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ FH ++GR
Sbjct: 949  MCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMAGR 1008

Query: 868  EGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPLDMEGN 927
            EGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD    +D+   
Sbjct: 1009 EGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDA---VDVTKE 1065

Query: 928  AQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAETNVILQPLENKLKRYDNIGQELRKEDE 987
            +    F+    + + L    N     P  +I   +V     E+ LK Y     + RK  +
Sbjct: 1066 SHMTKFDFCLENYDALLKKYN-----PSALIEHLDV-----ESALK-YSKKSLKYRK--K 1112

Query: 988  HKDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKELVDEPAEELREFNWDENVP 1047
            H  E    +     +   L ++   K L   S + +  L+  +D+ + +L + N D    
Sbjct: 1113 HAKEA--HYKQSPKYDPVLAKYNPAKYLGSVSEKFQDKLETFIDKNS-KLFKHNDD---- 1165

Query: 1048 ASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQMTLKTF 1107
                           I  +KF ++   KY R+ + PG AVG I +QS+GEP TQMTL TF
Sbjct: 1166 ---------------ISEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTF 1210

Query: 1108 HFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERAARVVKGRVEKTLLSD 1166
            HFAG  + NVTLG+PR++EII  AS  I TP +   +++D  ++ A      + K LLS+
Sbjct: 1211 HFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVSDQQADTFSKSISKVLLSE 1270

Query: 1167 V 1167
            V
Sbjct: 1271 V 1271

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 86/167 (51%), Gaps = 12/167 (7%)

Query: 1269 VVKGFSDISRAVINIRDDGKRELLVEGYGLR------DVMTTDGVIGSKTKTNHILEVYD 1322
            ++     I R V    ++GKR L+ EG   +      D +  DG+      +N +  V  
Sbjct: 1501 IINQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEDFIDVDGIT-----SNDVSAVLK 1555

Query: 1323 VLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVL 1382
            V G+EAAR+ I+NEI      + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1556 VYGVEAARNTIVNEISNVFGRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLM 1615

Query: 1383 QLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            ++ S+E T   L  A    + + ++  S  I++G+  ++GTGSF ++
Sbjct: 1616 KM-SYETTCQFLTKAVLDHERENLDSPSARIVVGKLNNVGTGSFDIL 1661

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 53/117 (45%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + F   SA ++ + S  +I+   +  LDN      GG  D  +G +  +  C +C 
Sbjct: 10  RISSVDFDVFSAKEVRALSVKQITNPTV--LDNLGHPISGGLYDLALG-AFLRNMCASCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L+S C  C    L   +   F  +LR
Sbjct: 67  LDEKFCPGHLGHIELPVPCYNPLFFNQLYIYLRSSCLFCYRFRLKALEVHAFAMKLR 123

>NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1674

 Score =  438 bits (1126), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 303/908 (33%), Positives = 472/908 (51%), Gaps = 100/908 (11%)

Query: 304  EKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGRFR 363
            ++ I  + +M  +  +Q  V  +I+S         G++G K  PI G  Q L+ K+G FR
Sbjct: 423  DRRIIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GTAGGKL-PIPGVKQALEKKEGLFR 476

Query: 364  GNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVINGPK 423
             ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q VINGP 
Sbjct: 477  KHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPD 536

Query: 424  VHPGANYLLKKNEDARR----NLRYGDRVKLAKQLQ----------YGDVVERHIEDGDV 469
              PGA  +  +NED        +    R  LA QL               V RHI++ D+
Sbjct: 537  KWPGATQI--QNEDGSLVSLIGMSTEQRKALANQLMTPSSNITTHTLNKKVYRHIKNRDI 594

Query: 470  VLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAE 528
            V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAE
Sbjct: 595  VIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAE 654

Query: 529  AINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMM------S 582
            A NL    +  LTP SG P+    QD I+    ++ KDSFF R Q  Q +          
Sbjct: 655  ASNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGH 714

Query: 583  DSNLQFDIPPPSIMKPHYLWTGKQVFS-LLIKPSRKSPVVINLDAKNKVYLPPPKKEYPN 641
             +  +    PP+I KP  LWTGKQ+ S +L+  +  +   INL + NK+     K EY  
Sbjct: 715  ATRSKLITMPPTIHKPVPLWTGKQIISTVLLNITPANMPGINLKSSNKI-----KNEYWG 769

Query: 642  EMSQNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCAR 701
              SQ +  VL +   +L G++DKS  G   K  + +++   YGP+ AA+ ++ + +L   
Sbjct: 770  TGSQENE-VLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSVAAKVLSVLGRLFTN 827

Query: 702  YLGNRGFSIGINDVTPGSDLKQKKEQM----VESAYAKCDELIDLFNKGKLETQPGC--- 754
            Y+ +  F+ G++D+    +  + +  +    V++      E+ +L +K      P     
Sbjct: 828  YIMSTAFTCGMDDLRLTEEGNKWRSDILKTSVDTGREAAAEVTNL-DKDTPANDPELLKR 886

Query: 755  --------NEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMATCGSKGSTL 802
                    N+   L+A     ++ +  +V   C+ +      P      MA  G+KGS +
Sbjct: 887  LQEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMALSGAKGSNV 946

Query: 803  NVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSPPEFLFH 862
            NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ FH
Sbjct: 947  NVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFH 1006

Query: 863  AISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGGDGLDPL 922
             ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF YGGD    +
Sbjct: 1007 CMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHISYDNSVRDTDGTLIQFLYGGDA---V 1063

Query: 923  DMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAETNVILQPLENKLK-RYDNIGQE 981
            D+   +    F+    + + L LN  +P  L   +  E+   L+  +  LK R  +I + 
Sbjct: 1064 DVTKESHMTEFDFCLDNYDAL-LNKYNPSALIEHLDVES--ALKYSKKSLKNRKKHIKEP 1120

Query: 982  LRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKELVDEPAEELREFN 1041
              K++   D  + +F+  + +  S+ E   +K            L+  +D+ ++  +  +
Sbjct: 1121 HYKQNIKYDPVLSKFNPAK-YLGSVSEKFQDK------------LEGYLDKNSKLFKSHD 1167

Query: 1042 WDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQSIGEPGTQ 1101
                       ++N+         +KF ++   KY R+ + PG AVG I +QS+GEP TQ
Sbjct: 1168 -----------SVNE---------KKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQ 1207

Query: 1102 MTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVND-NDERAARVVKGRV 1159
            MTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + ND +DE+A    K  +
Sbjct: 1208 MTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWNDVSDEQADTFCKS-I 1266

Query: 1160 EKTLLSDV 1167
             K +LS+V
Sbjct: 1267 SKVVLSEV 1274

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 86/168 (51%), Gaps = 10/168 (5%)

Query: 1263 RALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEVY 1321
            R +PHI         R +    ++GKR L+ EG     +   +  I      +N +  V 
Sbjct: 1507 REVPHI--------DRCIHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVL 1558

Query: 1322 DVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSV 1381
               G+EAAR+ I+NEI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S+
Sbjct: 1559 KTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSL 1618

Query: 1382 LQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            +++ S+E T   L  A    + + +E  S  I++G+  ++GTGSF ++
Sbjct: 1619 MKM-SYETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1665

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + F  L++ +I   S  +I+   +  LDN      GG  D  +G       C+TC 
Sbjct: 10  EITSVDFGILTSDEIRQLSAKQITNPTV--LDNLGHPITGGLYDLSLGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L++ C  C    L   +  +F ++LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHFRLRSIEVHRFASKLR 123

>KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1662

 Score =  436 bits (1120), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 304/974 (31%), Positives = 490/974 (50%), Gaps = 139/974 (14%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLEKG--------IS 308
            PP   R PS + ++   ++++ L   L++I+ TS LI+      + L+K         I 
Sbjct: 362  PPTRFRLPSKLGEEVHENSQNQL---LSKILTTSLLIRDLNDEMSKLQKDKVSVDDRRII 418

Query: 309  INNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQGRFRGNLSG 368
             + +M  +  +Q  V  +I+S         G++  K  P+ G  Q L+ K+G FR ++ G
Sbjct: 419  FSRLMNAFVTIQNDVNAFIDSTKAQ-----GNTSGKV-PVPGVKQALEKKEGLFRKHMMG 472

Query: 369  KRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVINGPKVHPGA 428
            KRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT +N  +L+Q VINGP   PGA
Sbjct: 473  KRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSFNIAELRQAVINGPDKWPGA 532

Query: 429  NYLLKKNEDARR----NLRYGDRVKLAKQLQ-----------YGDVVERHIEDGDVVLFN 473
              +  +NED        +    R  LA QL                V RHI++ D+V+ N
Sbjct: 533  TQI--QNEDGSLVSLIGMSAEQRKALANQLMTPTSHNGATHTLNKKVYRHIKNRDIVIMN 590

Query: 474  RQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINL 532
            RQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ E ARAEA NL
Sbjct: 591  RQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNL 650

Query: 533  MGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMM------SDSNL 586
                +  LTP SG P+    QD I+    +++KDSFF R Q  Q +           +  
Sbjct: 651  ANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCIRPEDGHATRA 710

Query: 587  QFDIPPPSIMKPHYLWTGKQVFS-LLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQ 645
            +    PP++MKP  LWTGKQ+ + +L+  +      INL + NK+     K +Y  + S 
Sbjct: 711  KLATVPPAVMKPVPLWTGKQIITTVLLNITPPDMPGINLKSSNKI-----KNDYWGKGS- 764

Query: 646  NDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGN 705
            N+  V+ +   +L G++DKS  G   K+ + + +   YGP+ +A+A++ + +L   Y+  
Sbjct: 765  NENEVIFKNGELLCGILDKSQYG-ASKYGIIHCLHEVYGPDVSAKALSVLGRLFTNYITA 823

Query: 706  RGFSIGINDVTPGSDLKQKKEQMVESA-------------------------YAKCDELI 740
              F+ G++D+    +  + ++++++++                           + +E+I
Sbjct: 824  TAFTCGMDDLRLTEEGNKWRKEILKTSVDTGREAAAEVTNLPKDTPSNDPELLKRLEEII 883

Query: 741  DLFNKGKLETQPGCNEEQTLEAKI------GGLLSKVREEVGEVCIRELDNLNAPLIMAT 794
               NK  +      ++  T+ +K+      GG + K  E             N+   MA 
Sbjct: 884  RDNNKSGILDAVTSSKVNTITSKVVSTCVPGGTMKKFPE-------------NSMQSMAL 930

Query: 795  CGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 854
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+
Sbjct: 931  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDARAGGYIKGRFYSGI 990

Query: 855  SPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTY 914
             P E+ FH ++GREGL+DTAVKTA +GY+ R L K LE +   YDN++R +   ++Q  Y
Sbjct: 991  RPQEYYFHCMAGREGLIDTAVKTASSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQMLY 1050

Query: 915  GGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAETNVILQPLENKLKR 974
            GGD    +D+   +    FN    + + L L   +P  L   +  ET +          +
Sbjct: 1051 GGDA---IDVTKESHLTKFNFCLENYDAL-LKKYNPSALIEHLDVETAL----------K 1096

Query: 975  YDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKELVDEPA 1034
            Y     + RK+            A+ + YQ   ++       L+     + L  + +   
Sbjct: 1097 YSKKSLKYRKK-----------HAKEAHYQQTVKYDP----ILSKYNPAKYLGSVSENFQ 1141

Query: 1035 EELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGAQS 1094
            ++L  F  D +        +N+         +KF ++   KY R+ + PG AVG I +QS
Sbjct: 1142 DQLENFLHDNSKLLKSHEDVNE---------KKFRALMQLKYMRSLINPGEAVGIIASQS 1192

Query: 1095 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERAAR 1153
            +GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +++D  +  A 
Sbjct: 1193 VGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIIMTASAAIKTPQMTLPILDDVTDEQAD 1252

Query: 1154 VVKGRVEKTLLSDV 1167
                 + K +LS+V
Sbjct: 1253 TFAKSISKVVLSEV 1266

 Score = 85.9 bits (211), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 53/167 (31%), Positives = 88/167 (52%), Gaps = 12/167 (7%)

Query: 1269 VVKGFSDISRAVINIRDDGKRELLVEG------YGLRDVMTTDGVIGSKTKTNHILEVYD 1322
            V++    I R V    ++GKR L+ EG      +   D +  DG+     ++N +  V  
Sbjct: 1495 VIRQVPKIDRCVHPEPENGKRVLVTEGVNFNAMWDQEDFIDVDGI-----RSNDVSAVLK 1549

Query: 1323 VLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVL 1382
              G+EAAR+ ++NEI+   S + +SV  RH+ LL D+MT +G  L   R G+     S++
Sbjct: 1550 TYGVEAARNTVVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSLM 1609

Query: 1383 QLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            ++ S+E T   L  A    + + +   S  I+LG+  ++GTGSF V+
Sbjct: 1610 KM-SYETTCQFLTKAVLDNEREELNTPSARIVLGKLNNVGTGSFDVL 1655

 Score = 56.2 bits (134), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 59/126 (46%), Gaps = 6/126 (4%)

Query: 6   IDIAP---KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSS 62
           +DIA     +I  + FS L++ DI S S  +I    +  LDN      GG  D  +G   
Sbjct: 1   MDIAKPVGSEITSVDFSILTSKDIRSLSAKQIINPTV--LDNLGHPISGGLYDLSLGAFL 58

Query: 63  SQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRK 122
               CTTC  +   C GH GHI+L +PV++  +F      L+S C  C    L   +  +
Sbjct: 59  RNL-CTTCGLDEKFCPGHVGHIELPVPVYNPLFFNQLYIYLRSSCLFCHHFRLKSAEVHR 117

Query: 123 FLTELR 128
           F  +L+
Sbjct: 118 FALKLK 123

>Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  434 bits (1116), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 319/977 (32%), Positives = 489/977 (50%), Gaps = 122/977 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS + ++   ++++ L   L++++ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLK 356
              K  LE + +  + +M  +  +Q  V  +I+S         G +  K  P+ G  Q L+
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSGKV-PVPGVKQALE 461

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQ 521

Query: 417  LVINGPKVHPGANYLLKKNEDARR----NLRYGDRVKLAKQL----------QYGDVVER 462
             VINGP   PGA  +  +NED        +    R  LA QL               V R
Sbjct: 522  AVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKVYR 579

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMM 581
             E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R Q  Q +   
Sbjct: 640  NENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 582  ------SDSNLQFDIPPPSIMKPHYLWTGKQVF-SLLIKPSRKSPVVINLDAKNKVYLPP 634
                    +  +    PP+I KP+ LWTGKQ+  ++L+  +      INL +KNK+    
Sbjct: 700  IRPEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLLNVTPPDMPGINLLSKNKI---- 755

Query: 635  PKKEYPNEMSQNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNR 694
             K EY  + S  +  VL +   +L G++DKS  G   K+ + +++   YGP  AA+ ++ 
Sbjct: 756  -KNEYWGKGSLENE-VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLSV 812

Query: 695  MAKLCARYLGNRGFSIGINDVTPGSDLKQKKEQM----VESAYAKCDELIDL-------- 742
            + +L   Y+    F+ G++D+   ++  + +  +    V++      E+ +L        
Sbjct: 813  LGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKDTPADD 872

Query: 743  --FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMATCG 796
                K   E     N+   L+A     ++ +  +V   C+ +      P      MA  G
Sbjct: 873  PELLKRLQEILRDNNKSGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMALSG 932

Query: 797  SKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSP 856
            +KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P
Sbjct: 933  AKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKP 992

Query: 857  PEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGG 916
             E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF YGG
Sbjct: 993  QEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMYGG 1052

Query: 917  DGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLL----PYQIIAETNVILQPLENKL 972
            D +D +  E +     F             DN   LL    P  +I   +V     E+ L
Sbjct: 1053 DAID-ITKESHMTQFEF-----------CLDNYYALLKKYNPSALIEHLDV-----ESAL 1095

Query: 973  KRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKELVDE 1032
            K Y     + RK+   +  Y         +   L ++   K L   S   +  L+  +D+
Sbjct: 1096 K-YSKKTLKYRKKHIKEPHYKQSI----KYDPVLAKYNPAKYLGSVSENFQDKLESFLDK 1150

Query: 1033 PAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGA 1092
             +   + F   + V      AL QL                 KY R+ + PG AVG I +
Sbjct: 1151 GS---KLFKSADGVNEKKFRALMQL-----------------KYMRSLINPGEAVGIIAS 1190

Query: 1093 QSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVND-NDER 1150
            QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + +D +DE+
Sbjct: 1191 QSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWDDVSDEQ 1250

Query: 1151 AARVVKGRVEKTLLSDV 1167
            A    K  + K LLS+V
Sbjct: 1251 ADTFCKS-ISKVLLSEV 1266

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 86/168 (51%), Gaps = 10/168 (5%)

Query: 1263 RALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEVY 1321
            R +PHI         R V    ++GKR L+ EG   + +   +  I      +N +  V 
Sbjct: 1500 RQIPHI--------DRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVL 1551

Query: 1322 DVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSV 1381
               G+EAAR+ I+NEI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S 
Sbjct: 1552 KTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSF 1611

Query: 1382 LQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            +++ S+E T   L  A    + + ++  S  I++G+  ++GTGSF V+
Sbjct: 1612 MKM-SYETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + F  L+A +I + S  +I+   +  LDN      GG  D  +G       C+TC 
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTV--LDNLGHPVSGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L++ C  C    L   +  ++  +LR
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLR 123

>Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  431 bits (1108), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 316/978 (32%), Positives = 492/978 (50%), Gaps = 124/978 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++++ T+ LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTALLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLK 356
              K  LE + +  + +M  +  +Q  V  +I+S         G +  K  PI G  Q L+
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSGKV-PIPGVKQALE 461

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQ 521

Query: 417  LVINGPKVHPGANYLLKKNEDARR----NLRYGDRVKLAKQL----------QYGDVVER 462
             VINGP   PGA  +  +NED        +    R  LA QL               V R
Sbjct: 522  AVINGPDKWPGATQI--QNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKVYR 579

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 580  HIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQ 639

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMM 581
             E ARAEA+NL    +  LTP SG P+    QD I+    ++ KDSFF R Q  Q +   
Sbjct: 640  NENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 699

Query: 582  ------SDSNLQFDIPPPSIMKPHYLWTGKQVF-SLLIKPSRKSPVVINLDAKNKVYLPP 634
                    +  +    PP+I KP+ LWTGKQ+  ++L+  +      INL + NK+    
Sbjct: 700  IRPEDGHTTRNKIITLPPAIFKPYPLWTGKQIITTVLLNVTPPDMPGINLISTNKI---- 755

Query: 635  PKKEYPNEMS-QNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMN 693
             K EY  + S +N+  VL +   +L G++DKS  G   K+ + +++   YGP  AA+ ++
Sbjct: 756  -KNEYWGKGSLENE--VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLS 811

Query: 694  RMAKLCARYLGNRGFSIGINDVTPGSDLKQKKEQM----VESAYAKCDELIDL------- 742
             + +L   Y+    F+ G++D+   ++  + +  +    V++      E+ +L       
Sbjct: 812  VLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLNKDTPAD 871

Query: 743  ---FNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMATC 795
                 K   E     N+   L+A     ++ +  +V   C+ +      P      MA  
Sbjct: 872  DAELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQAMALS 931

Query: 796  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLS 855
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ 
Sbjct: 932  GAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIK 991

Query: 856  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYG 915
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF YG
Sbjct: 992  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMYG 1051

Query: 916  GDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLL----PYQIIAETNVILQPLENK 971
            GD +D +  E +     F             DN   LL    P  +I   +V     E+ 
Sbjct: 1052 GDAVD-ITKESHMTQFEF-----------CLDNYYALLKKYNPSALIEHLDV-----ESA 1094

Query: 972  LKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKELVD 1031
            LK Y     + RK+   +  Y         +   L ++   K L   S   +  L+  +D
Sbjct: 1095 LK-YSKKTLKYRKKHSKEPHYKQAV----KYDPVLAKYNPAKYLGSVSENFQDKLESFLD 1149

Query: 1032 EPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIG 1091
            + ++  +  +            +N+         +KF ++   KY R+ + PG AVG I 
Sbjct: 1150 KNSKLFKSAD-----------GVNE---------KKFRALMQLKYMRSLINPGEAVGIIA 1189

Query: 1092 AQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVND-NDE 1149
            +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + +D +DE
Sbjct: 1190 SQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASSAIKTPQMTLPIWDDVSDE 1249

Query: 1150 RAARVVKGRVEKTLLSDV 1167
            +A    K  + K LLS+V
Sbjct: 1250 QADTFCKS-ISKVLLSEV 1266

 Score = 82.0 bits (201), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 85/162 (52%), Gaps = 2/162 (1%)

Query: 1269 VVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEVYDVLGIE 1327
            +++    I R V    ++GKR L+ EG   + +   +  I      +N +  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLRTYGVE 1557

Query: 1328 AARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVLQLASF 1387
            AAR+ ++NEI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTVVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1388 EKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    + + ++  S  I++G+  ++GTGSF V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGRLNNVGTGSFDVL 1658

 Score = 46.6 bits (109), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + F  L+A +I + S  +I+   +  LDN      GG  D  +G       C+TC 
Sbjct: 10  EITSVDFGILTAKEIRNLSAKQITNPTV--LDNLGHPVSGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L++ C  C    L   +  ++  +L+
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLK 123

>ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR341W
            (RPA190)
          Length = 1640

 Score =  427 bits (1099), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 318/979 (32%), Positives = 493/979 (50%), Gaps = 126/979 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLI----------- 299
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI           
Sbjct: 331  KADMFFMEVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 387

Query: 300  --KAGLE-KGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLK 356
              K  LE + I  N +M  +  +Q  V  +I+S         GS+G K  PI G  Q L+
Sbjct: 388  KDKVSLEDRKIIFNRLMNAFVTIQNDVNAFIDSTKAQ-----GSTGGKV-PIPGVKQALE 441

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +++Q
Sbjct: 442  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEMRQ 501

Query: 417  LVINGPKVHPGANYLLKKNEDARR----NLRYGDRVKLAKQLQ----YGDV------VER 462
             VINGP   PGA  +  +NED        +    R  LA QL     +G        V R
Sbjct: 502  AVINGPDKWPGATQI--QNEDGSLVSLVGMTSDQRKALANQLMTPSTHGSTHTLNKKVYR 559

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 560  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 619

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMM 581
             E AR+EA  L    +  LTP SG P+    QD I+    +++KDSFF R Q  Q +   
Sbjct: 620  NENARSEAFTLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGC 679

Query: 582  ------SDSNLQFDIPPPSIMKPHYLWTGKQVFSLLIKPSRKSPVV-INLDAKNKVYLPP 634
                    S  +    PP+++KP  LWTGKQ+ + ++  +  + +  INL +KNK+    
Sbjct: 680  IRPEDGHASRSKIITVPPAVVKPVPLWTGKQIITTVLLNATPADIPGINLVSKNKI---- 735

Query: 635  PKKEYPNEMSQNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNR 694
             K EY  + S  +  +   G+ +L G++DKS  G   K+ + +++   YGP+ +++ ++ 
Sbjct: 736  -KNEYWGKSSYENEVIFKNGA-LLCGILDKSQYG-ASKYGIVHSLHELYGPDVSSKVLSI 792

Query: 695  MAKLCARYLGNRGFSIGINDVTPGS-------DLKQKKEQMVESAYAKCDEL-------- 739
            + +L   Y+ +  F+ G++D+           D+ +K   +  +A A+   L        
Sbjct: 793  LGRLFTNYITSTAFTCGMDDLRLTDEGNKWRIDILKKSTDIGRAAAAEVTNLGGDVRPDD 852

Query: 740  IDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMATC 795
             +L  + + E     N+   L+A     ++ +  EV   C+ +      P      MA  
Sbjct: 853  AELLKRLE-EILRDDNKLGILDAVTSSKVNTITSEVVSKCVPDGTMKKFPYNSMQAMALS 911

Query: 796  GSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLS 855
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ 
Sbjct: 912  GAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAKAGGYIKGRFYSGIK 971

Query: 856  PPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYG 915
            P E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQF YG
Sbjct: 972  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLVQFLYG 1031

Query: 916  GDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLL----PYQIIAETNVILQPLENK 971
            GD +D +  E +     F             DN   LL    P  +I   +V     E+ 
Sbjct: 1032 GDAID-VTKESHMSEFKF-----------CVDNYDALLKRYNPSALIQHLDV-----ESA 1074

Query: 972  LKRYDNIGQELRKEDEHKDEYI--DQFDAERSFYQSLREFMTEKALTLASLRGERGLKEL 1029
            LK Y     + RK++ +   Y   D++D        L ++   K L   S   +  L+  
Sbjct: 1075 LK-YSKKAMKNRKKNLNLPHYARHDKYDP------VLSKYNPSKFLGSVSENFQDKLESF 1127

Query: 1030 VDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGA 1089
            +D  A   +               +N+         +KF ++   KY R+ + PG AVG 
Sbjct: 1128 IDSNASLFKG-----------QATVNE---------KKFRALMQLKYMRSLINPGEAVGI 1167

Query: 1090 IGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDND 1148
            I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D  
Sbjct: 1168 IASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVT 1227

Query: 1149 ERAARVVKGRVEKTLLSDV 1167
            +  A +      K +LS+V
Sbjct: 1228 DETADIFCKNTTKVILSEV 1246

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1269 VVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEVYDVLGIE 1327
            V+K   +I R V    ++GKR L+ EG   + +   +  I  +   +N +  V    G+E
Sbjct: 1473 VIKEVPNIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVNGITSNDVSAVLKTYGVE 1532

Query: 1328 AARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVLQLASF 1387
            AAR+ I+NEI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1533 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1591

Query: 1388 EKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    + + ++  S  ++LG+  S+GTG+F ++
Sbjct: 1592 ETTCQFLTKAVLDNEREELKSPSAKLVLGKLNSVGTGAFDIL 1633

 Score = 48.9 bits (115), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + FS +SAA+I + S  +I+   +  LD+      GG  D  +G       C TC 
Sbjct: 10  EISSVDFSVMSAAEIRALSVKQITNPTV--LDHLGHPIRGGLYDLSLGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P +   +F      L+S C  C    L   +  ++  +L+
Sbjct: 67  LDEKFCSGHQGHIELPVPCYSPLFFNQLYIYLRSSCLYCHHFRLKAVEVHRYACKLK 123

>SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1650

 Score =  427 bits (1098), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 318/976 (32%), Positives = 489/976 (50%), Gaps = 120/976 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEIVWTSSLIK------AGLE 304
            + + +    +  PP   R PS +  +   + ++ L   L++I+ TS LI+      + L+
Sbjct: 340  KADMFFMEVVVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 396

Query: 305  KG--------ISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLK 356
            K         +  N +M  +  +Q  V  +I+          G++G K  PI G  Q L+
Sbjct: 397  KDKVSVDDRKVIFNRLMNAFVTIQNDVNAFIDVTKAQ-----GNTGGKV-PIPGVKQALE 450

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 451  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELRQ 510

Query: 417  LVINGPKVHPGANYLLKKNEDARR----NLRYGDRVKLAKQLQYGDV----------VER 462
             VINGP   PGA  +  +NED        +    R  LA QL               V R
Sbjct: 511  AVINGPDKWPGATQI--QNEDGSLVSLIGMTLEQRKALANQLMTPSTHNSTHILNKKVYR 568

Query: 463  HIEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQ 521
            HI++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ
Sbjct: 569  HIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQ 628

Query: 522  TEEARAEAINLMGVKNNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMM 581
             E ARAEA NL    +  LTP SG P+    QD I+    ++ KDSFF R Q  Q +   
Sbjct: 629  NENARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGC 688

Query: 582  ------SDSNLQFDIPPPSIMKPHYLWTGKQVFS-LLIKPSRKSPVVINLDAKNKVYLPP 634
                    +  +    PP+++KP  LWTGKQ+ + +L+  +      INL +KNK+    
Sbjct: 689  IRPEDGHATRNKIVTVPPAVVKPVPLWTGKQIITTVLLNSTPPEMPGINLISKNKI---- 744

Query: 635  PKKEYPNEMSQNDGFVLIRGSNILSGVMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNR 694
             K EY  E S N+  V+ +   +L G++DKS  G   K  + +++   YGP+ A + ++ 
Sbjct: 745  -KNEYWGEGS-NESEVIFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPDIAGKVLSV 801

Query: 695  MAKLCARYLGNRGFSIGINDVTPGSDLKQKKEQMVESAY----AKCDELIDLFNKGKL-- 748
            + +L   Y+    F+ G++D+    +  + + ++++++     A   E+ +L    K   
Sbjct: 802  LGRLFTNYITATAFTCGMDDLRLTEEGNKWRTEILKTSVDIGRAAAAEVTNLEGDVKADD 861

Query: 749  --------ETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIRELDNLNAPL----IMATCG 796
                    E     N+   L+A     ++ +  +V   C+ +      P      MA  G
Sbjct: 862  PELLKRLEEILRDDNKLGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPYNSMQAMALSG 921

Query: 797  SKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLSP 856
            +KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P
Sbjct: 922  AKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGIRP 981

Query: 857  PEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDNTVRTSSNGIVQFTYGG 916
             E+ FH ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     ++QF YGG
Sbjct: 982  QEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIQFLYGG 1041

Query: 917  DGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLL----PYQIIAETNVILQPLENKL 972
            D +D +  E +     F             DN   LL    P  +I   +V     E+ L
Sbjct: 1042 DAVD-VTKESHMTEFKF-----------CVDNYDALLKKYNPSALIEHLDV-----ESAL 1084

Query: 973  KRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASLRGERGLKELVDE 1032
            K Y     + RK    K+E I  +     +   L ++   K L   S   +  L++ +D 
Sbjct: 1085 K-YSKKAMKNRK----KNEKIPHYAHNIKYDPVLSKYNPSKYLGSVSENFQDKLEKFIDS 1139

Query: 1033 PAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRARVEPGTAVGAIGA 1092
             ++ L+     +NV      AL QL                 KY R+ + PG AVG I +
Sbjct: 1140 NSKLLKS---KDNVNEKKFRALMQL-----------------KYMRSLINPGEAVGIIAS 1179

Query: 1093 QSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNDNDERA 1151
            QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ D  +  
Sbjct: 1180 QSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVTDDQ 1239

Query: 1152 ARVVKGRVEKTLLSDV 1167
            A      + K +LS+V
Sbjct: 1240 ADTFCKSITKVMLSEV 1255

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIG-SKTKTNHILEVYDVLGIE 1327
            V+    +I R V    ++GKR L+ EG   + +   +  I  +   +N +  V    G+E
Sbjct: 1483 VITEVPNIDRCVHPEPENGKRVLVTEGVNFQSMWDQEAFIDVNGITSNDVASVLKTYGVE 1542

Query: 1328 AARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDSVLQLASF 1387
            AAR+ I+NEI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1543 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1601

Query: 1388 EKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVV 1429
            E T   L  A    + + ++  S  I++G+   +GTGSF ++
Sbjct: 1602 ETTCQFLTKAVLDNEREELKSPSAKIVMGKLNGVGTGSFDIL 1643

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 3/117 (2%)

Query: 12  KIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTCH 71
           +I  + FS L+A +I   S  +I+   +  LDN      GG  D  +G       C TC 
Sbjct: 10  EIISVDFSVLTAQEIRKLSAKQITNPTV--LDNLGHPISGGLYDLSLGAFLRNL-CATCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKRKFLTELR 128
            +   C GH GHI+L +P ++  +F      L+S C  C    L   +  ++  +L+
Sbjct: 67  LDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLYCHHFRLKTSEVHRYACKLK 123

>Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {ON}
           complement(51067..52161) [1095 nt, 365 aa]
          Length = 364

 Score = 83.6 bits (205), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 87/287 (30%), Positives = 128/287 (44%), Gaps = 32/287 (11%)

Query: 11  KKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGVSSSQAECTTC 70
           + IK + F   S  ++ + S  +I   +  D    R AK GG  DPR+G      +C TC
Sbjct: 12  RTIKEVQFGLFSPEEVRAISVAKIRFPETMDETQTR-AKIGGLNDPRLGSIDRNVKCQTC 70

Query: 71  HGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDKR-KFLTELRR 129
              +  C GHFGHI LA PVFH+G+     ++ + VC  CG LLL E +++     +++ 
Sbjct: 71  QEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHNEQMNQAIKIKD 130

Query: 130 PGMDNLRRMNILKKILDQCKKQRRCFECGELNX-XXXXXXXXXXXXXLKIIHDTFRWVGK 188
           P     +R N +  +   CK +  C    E +                     T R  G 
Sbjct: 131 PK----KRFNAVWTL---CKTKMIC----ETDVPSEDDPTKLVSRGGCGNAQPTIRKDGL 179

Query: 189 KSAPEKEQWIGDWKQVLENN--PELERYVKRCMDDLNPLKVLNLFKQIKPNDCELLGIDS 246
           K        +G WK+    N   E E+ V      L+  ++LN+FK I   D   LG + 
Sbjct: 180 K-------LVGSWKKDKNTNDGDEPEQRV------LSTEEILNIFKHISSEDYIRLGFN- 225

Query: 247 TSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIV 293
             +  RPE  +   LP PP  +RPS+   +S    EDDLT KL +I+
Sbjct: 226 -EEFARPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADIL 270

>TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {ON}
           Anc_5.359
          Length = 875

 Score = 38.9 bits (89), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 339 GSSGTK-SKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAV 392
           GSSGTK S PIR F  + K  QGRF  N++ + VD        P P   +D V V
Sbjct: 227 GSSGTKGSLPIRLFTAKGKSHQGRFAMNVTRRVVDLFSELFEIPYPLPKLDIVCV 281

>KLLA0F18128g Chr6 (1661367..1663535) [2169 bp, 722 aa] {ON} similar
            to uniprot|Q07825 Saccharomyces cerevisiae YLL029W
            Hypothetical ORF
          Length = 722

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 5/77 (6%)

Query: 931  VNFNRSWTHANNLTLNDNSPGLLPYQIIA-----ETNVILQPLENKLKRYDNIGQELRKE 985
            +NF+R  +H  N  L+  S  +     I      ET   L  L  ++  +D     +  E
Sbjct: 59   INFSRRHSHFGNPPLSPTSESIYSTDSICQLKSTETAKRLLALRKQMDTHDLCCYIIPSE 118

Query: 986  DEHKDEYIDQFDAERSF 1002
            DEH+ EY+ Q D  R+F
Sbjct: 119  DEHQSEYVSQADERRAF 135

>Kwal_27.11232 s27 (697964..707974) [10011 bp, 3336 aa] {ON} YDR150W
            (NUM1) - Protein with variable number of tandem repeats
            of a 64 amino-acid polypeptide, potential Ca2+-binding
            site, and pleckstrin homology domain [contig 29] FULL
          Length = 3336

 Score = 33.9 bits (76), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 99   TIQILQSVCKGCGALLLSEEDKRKFLTELRRPGMDNLRRM 138
            +I+ L + CK  G LL++E D+ +   +L  P MD + +M
Sbjct: 1510 SIEFLAAKCKEAGYLLVNERDQAELSRKLNEPTMDEMEQM 1549

>KLTH0F18568g Chr6 (1507739..1511242) [3504 bp, 1167 aa] {ON} some
           similarities with uniprot|Q06211 Saccharomyces
           cerevisiae YPR164W MMS1 Protein likely involved in
           protection against replication-dependent DNA damage
           mutants are sensitive to methyl methanesulfonate (MMS)
           implicated in regulation of Ty1 transposition
          Length = 1167

 Score = 32.7 bits (73), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 38/77 (49%), Gaps = 5/77 (6%)

Query: 53  ALDPRMGVSSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGA 112
            LDP++G  +S+ E   CH    S +G     KL  P     +FK + ++   +   CG 
Sbjct: 2   VLDPQIGTFASKEETENCHWFDVSSYGS----KLNKPGNEEKWFKESAELHSQLPIFCGN 57

Query: 113 LLLS-EEDKRKFLTELR 128
           + +S EEDK K L  +R
Sbjct: 58  IRISLEEDKFKQLVGVR 74

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 153,608,784
Number of extensions: 6886456
Number of successful extensions: 20042
Number of sequences better than 10.0: 80
Number of HSP's gapped: 20254
Number of HSP's successfully gapped: 184
Length of query: 1457
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1335
Effective length of database: 39,492,147
Effective search space: 52722016245
Effective search space used: 52722016245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)