Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E21165g5.430ON62762723500.0
SAKL0G02442g5.430ON62362614810.0
Kwal_55.214445.430ON64463614060.0
KLTH0F16148g5.430ON64664914010.0
NCAS0F033505.430ON63962413760.0
Ecym_47905.430ON63059413710.0
CAGL0L11638g5.430ON60858813670.0
Kpol_1016.85.430ON63760113551e-180
NDAI0B056405.430ON66961713571e-180
Smik_4.6325.430ON62759813411e-178
Suva_2.5385.430ON62963113401e-178
YDR365C (ESF1)5.430ON62860113211e-175
TDEL0E019505.430ON61763413161e-174
ZYRO0F09944g5.430ON61158013151e-174
AER259W5.430ON61958713031e-172
TBLA0A065405.430ON65961312901e-170
KNAG0C049405.430ON64263512861e-170
Skud_4.6355.430ON62960012191e-160
KAFR0E039105.430ON62543311231e-145
TPHA0H017805.430ON62242411131e-144
KLLA0F18887g3.290ON11956659.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E21165g
         (627 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} simi...   909   0.0  
SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {...   575   0.0  
Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365...   546   0.0  
KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} simi...   544   0.0  
NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {O...   534   0.0  
Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {O...   532   0.0  
CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON} sim...   531   0.0  
Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON} (16620.....   526   e-180
NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] ...   527   e-180
Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {...   521   e-178
Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON...   520   e-178
YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}...   513   e-175
TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.4...   511   e-174
ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {...   511   e-174
AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic ...   506   e-172
TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...   501   e-170
KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.4...   499   e-170
Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {...   474   e-160
KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {O...   437   e-145
TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {O...   433   e-144
KLLA0F18887g Chr6 (1732170..1732529) [360 bp, 119 aa] {ON} conse...    30   9.4  

>KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 627

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/627 (75%), Positives = 471/627 (75%)

Query: 1   MNSKGEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGR 60
           MNSKGEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGR
Sbjct: 1   MNSKGEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGR 60

Query: 61  KIVDANKDVKDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSVDRARGEPPADYV 120
           KIVDANKDVKDFDRYFT                         VHAKSVDRARGEPPADYV
Sbjct: 61  KIVDANKDVKDFDRYFTKEKPEDKEDESNSSESSDDQEAEAAVHAKSVDRARGEPPADYV 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPASGNATNTLAVVNLDWDHVKSADLFVTF 180
                                         KPASGNATNTLAVVNLDWDHVKSADLFVTF
Sbjct: 121 SSSDEESSSESEEESGDSDIESEEIELEESKPASGNATNTLAVVNLDWDHVKSADLFVTF 180

Query: 181 KSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXXXXXXXXXEINVESIYE 240
           KSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQ            EINVESIYE
Sbjct: 181 KSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQSKKSKKNDKDDDEINVESIYE 240

Query: 241 EGDAEDYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYESTANVFDLRYVP 300
           EGDAEDYDSKA             AVVYCSDIRTAESIYQNCDGTEYESTANVFDLRYVP
Sbjct: 241 EGDAEDYDSKALRRYQLERLRYYYAVVYCSDIRTAESIYQNCDGTEYESTANVFDLRYVP 300

Query: 301 DGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAFTQKEIE 360
           DGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAFTQKEIE
Sbjct: 301 DGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAFTQKEIE 360

Query: 361 EMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFDQKEDEDDNEADMEITF 420
           EMDFKAYLA            QVKNKLKALVMDSVKVGQKSLFDQKEDEDDNEADMEITF
Sbjct: 361 EMDFKAYLASDSEESEVEHDDQVKNKLKALVMDSVKVGQKSLFDQKEDEDDNEADMEITF 420

Query: 421 TPGLDESGQQDTNDNEEESTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDT 480
           TPGLDESGQQDTNDNEEESTID                                    DT
Sbjct: 421 TPGLDESGQQDTNDNEEESTIDKIRRKEKERRKKRKDRVKELKKESEAKLKENLKKKKDT 480

Query: 481 SHSIDDDKKKGELELLMLDENEGESTINNKAHFNMNEILXXXXXXXXXXXXXXXXXIVDD 540
           SHSIDDDKKKGELELLMLDENEGESTINNKAHFNMNEIL                 IVDD
Sbjct: 481 SHSIDDDKKKGELELLMLDENEGESTINNKAHFNMNEILKSEKEKSKKAKYQNKEKIVDD 540

Query: 541 EFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTVXXXXXXXXXXXNHEIA 600
           EFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTV           NHEIA
Sbjct: 541 EFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTVRSSKKSRGKKRNHEIA 600

Query: 601 NTEHSKDINKIGGLVEKLKAKNKRTKH 627
           NTEHSKDINKIGGLVEKLKAKNKRTKH
Sbjct: 601 NTEHSKDINKIGGLVEKLKAKNKRTKH 627

>SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 623

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/626 (50%), Positives = 389/626 (62%), Gaps = 25/626 (3%)

Query: 12  TEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVDA-NKDVK 70
           T DPRFSGIH+DPKF+  K KN KIKLDDRFSK+DLE+++KAKVDKYGR++ D  NK+ K
Sbjct: 11  TNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVDNKETK 70

Query: 71  DFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSVDRARGEPPADYVXXXXXXXXXX 130
           DF+RYF                              S+DRARGE P+DY+          
Sbjct: 71  DFERYFEKEEESSSPSDEEGES----------TKVTSLDRARGEVPSDYLSSSEEESSSE 120

Query: 131 XXXXXXXXXXXXXXXXX--XXXKPASGNATNTLAVVNLDWDHVKSADLFVTFKSFVPKGG 188
                                 KP +G+AT  LAVVNLDWDHVKS DL VTF SFVPKGG
Sbjct: 121 SEEESENSELESEESDLEIEESKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGG 180

Query: 189 EIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXXXXXXXX--XEINVESIYEEGDAE- 245
           +I KIAIYPSEFGKERMQREE+EGPP+ELFQ              +++++ +YEEGDAE 
Sbjct: 181 KILKIAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKDGDDSDVDIKDLYEEGDAEK 240

Query: 246 DYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYESTANVFDLRYVPDGMEM 305
           DYDSKA             AVV+C+++ TAE+IYQNCDGTEYESTAN+FDLRYVP+GM+ 
Sbjct: 241 DYDSKALRRYQLDRLRYYYAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDF 300

Query: 306 DDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAFTQKEIEEMDFK 365
            D+P+DEC  +PKNYKPAQFSTDALQHS VKLTWDETPA+RVE+SKRAFTQKEIE+MDFK
Sbjct: 301 SDEPKDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFK 360

Query: 366 AYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFDQKEDEDDNEADMEITFTPGLD 425
           AYLA              +NKLK+LV +S+++G KSLFD K D +  + DMEITFTPGLD
Sbjct: 361 AYLASDSEGSEEEINEDSRNKLKSLVSESIRIGDKSLFD-KSDNEGGDVDMEITFTPGLD 419

Query: 426 ESGQQDTNDNEEESTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDTSHSID 485
           E+ ++D  D ++E+TI+                                      S + D
Sbjct: 420 EA-KKDDEDGKDETTIEKIRRKEKERRKMRKERVKELKKKAEEKKREKLNKSDSQSKTAD 478

Query: 486 ----DDKKKGELELLML-DENEGESTINNKAHFNMNEILXXXXXXXXXXXXXXXXXIVDD 540
               + K K ELELLM+ D+N+ ES +N KAHFNM EIL                 IV+D
Sbjct: 479 EVEKEKKSKAELELLMMDDDNDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVED 538

Query: 541 EFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTVXXXXXXXXXXXNHEIA 600
           EF PD+NDPRF+EVFEDHDFAIDP+QPEFK T AM++ILKER               ++ 
Sbjct: 539 EFKPDLNDPRFREVFEDHDFAIDPSQPEFKGTTAMKEILKERN--QRVSKKKGNKKRKLE 596

Query: 601 NTEHSKDINKIGGLVEKLKAKNKRTK 626
               + + N++ GLV KLK +NK+++
Sbjct: 597 QPRKNNNSNELNGLVAKLKRRNKKSR 622

>Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365C -
           Protein required for cell viability [contig 130] FULL
          Length = 644

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/636 (48%), Positives = 378/636 (59%), Gaps = 24/636 (3%)

Query: 12  TEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVDA-NKDVK 70
           + DPRF+ +H+DPKFR TK+K FKIKLDDRFSK+DL+ +RKA+VDKYGR +    NKD K
Sbjct: 12  SSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLKGQENKDKK 71

Query: 71  DFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAK-----------SVDRARGEPPADY 119
           DFD+Y+                            AK           S+DRARGE P+DY
Sbjct: 72  DFDKYYEKDDKKKEDKVKPDDEEKSDSEAESANEAKDIGDSAAVKPVSLDRARGEVPSDY 131

Query: 120 VXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XKPASGNATNTLAVVNLDWDHVKSADLF 177
           V                                KP SG+++ TLAVVNLDWDHVKS DL 
Sbjct: 132 VSSSEDESSSESEAGSEDSDIESEESEVEIEDTKPQSGDSSKTLAVVNLDWDHVKSTDLM 191

Query: 178 VTFKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXXXXXXXXXEINVES 237
           +TF SFVP GG+I KIA+YPSEFGKER++REE+EGPP+E+F+              +   
Sbjct: 192 ITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFKSKNSKKKSHDDDSDSDVD 251

Query: 238 ---IYEEGDAEDYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYESTANVF 294
              +YEEGDAEDYD+K+             AVVYC+++ TAE+IY+NCDGTE+ESTAN+F
Sbjct: 252 VRDLYEEGDAEDYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCDGTEFESTANMF 311

Query: 295 DLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAF 354
           DLRYVPDGM  DD+ RDECTS+PKNY+P+QFSTDALQHSKVKLTWDETPADRV +SKRAF
Sbjct: 312 DLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETPADRVAMSKRAF 371

Query: 355 TQKEIEEMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFDQKEDEDDNEA 414
           TQKEIE+MDFKAYLA             +K KLK+LV  SVKVG KS+FDQ  +E +++ 
Sbjct: 372 TQKEIEDMDFKAYLASDSEESEPENNQDLKTKLKSLVSQSVKVGDKSIFDQAPEEGESDV 431

Query: 415 DMEITFTPGLDESGQQDTNDNEEESTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 474
           DM+ITF PGL E  + D  +N EE+T++                                
Sbjct: 432 DMQITFAPGLAEGAEDDKQENAEETTLEKLKRKEKERKKMRKERIKELKKQAEEEKKQKR 491

Query: 475 XXXXDTSHS-IDDDKKKGELELLML--DENEGESTINNKAHFNMNEILXXXXXXXXXXXX 531
                   S ++D K K ELELLM+  DEN   S +N KAHFNMNEI+            
Sbjct: 492 KESRYKPESTVEDAKSKAELELLMMDDDENNSSSKLNKKAHFNMNEIVRSEKEKGKKSRY 551

Query: 532 XXXXXIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTVXXXX-XX 590
                IV+DEF PD+NDPRF EVFED DFAIDP+QPEFK T AM++IL+ERT        
Sbjct: 552 QNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQILQERTKRSHKGQN 611

Query: 591 XXXXXNHEIANTEHSKDINKIGGLVEKLKAKNKRTK 626
                +  +AN     D+    GLV+KLK  +K  K
Sbjct: 612 KKRKADGNLANQNGQSDLK---GLVKKLKHSSKAKK 644

>KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 646

 Score =  544 bits (1401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/649 (46%), Positives = 388/649 (59%), Gaps = 25/649 (3%)

Query: 1   MNSKGEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGR 60
           M+ + E ++  + DPRF+G+ NDPKFR T++K FKIKLDDRFSK+DLE +RKA+VDKYGR
Sbjct: 1   MSKENETRQGGSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGR 60

Query: 61  KIVDA-NKDVKDFDRYF-------TXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSV--DR 110
           ++    +KD +DFD+Y+       T                           AK+V  DR
Sbjct: 61  RLKGQESKDKRDFDKYYEKEKSGKTAPDSELVGKPSEEDSEGGSSDEEGAASAKTVSLDR 120

Query: 111 ARGEPPADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKP--ASGNATNTLAVVNLDW 168
           ARGE  +DYV                              +    SG+++ TLAVVNLDW
Sbjct: 121 ARGEVHSDYVSSSDEESSSESEEDSADSDLESEESEVQIEEGEVKSGDSSKTLAVVNLDW 180

Query: 169 DHVKSADLFVTFKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXXXXXX 228
           DHVKS DL VTF SFVPKGG+I ++AIYPSEFGKER+ +EE EGPP+E+F+         
Sbjct: 181 DHVKSTDLMVTFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSH 240

Query: 229 ---XXXEINVESIYEEGDAEDYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGT 285
                 E+ V+ +YEEGDA+D+D+K+             AVVYC++ +TAESIY+NCDGT
Sbjct: 241 GDDSDEELTVKDLYEEGDADDFDAKSLRRYQLERLRYYYAVVYCNNKQTAESIYKNCDGT 300

Query: 286 EYESTANVFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPAD 345
           EYESTAN+FDLRYVPDGM+ DD+ RDEC S+PKNY+P++FSTDALQHSKVK TWDETPAD
Sbjct: 301 EYESTANMFDLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPAD 360

Query: 346 RVEISKRAFTQKEIEEMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFDQ 405
           R  ++KRAFTQ+EIE+MDFKAYLA            ++KNKLK+LV  SV+VG+KS+FDQ
Sbjct: 361 RTAMAKRAFTQREIEDMDFKAYLASDSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQ 420

Query: 406 KEDEDDNEADMEITFTPGLDESGQQDTNDNE--EESTIDXXXXXXXXXXXXXXXXXXXXX 463
              + +++ DM+ITF P L E G  D +D E  EE+T++                     
Sbjct: 421 DPKDGESDVDMQITFAPALAEGGSGDADDGEKTEETTLEKVRRKEKERKKMRKERIKELK 480

Query: 464 XXXXXXXXXXXXXXXDTSH-SIDDDKKKGELELLMLDEN-EGESTINNKAHFNMNEILXX 521
                               S  D K + ELELLM+D++ E  S +N KAHFNMNEI+  
Sbjct: 481 KQAEDDKKQKLKEARRKPEPSATDSKSQAELELLMMDDSEEANSKLNKKAHFNMNEIVRS 540

Query: 522 XXXXXXXXXXXXXXXIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKE 581
                          IV+DEF PD+NDPRF EVFEDHDFAIDP+QPEFK T AM++IL+E
Sbjct: 541 EKEKGKKAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQE 600

Query: 582 RTVXXXX-XXXXXXXNHEIANTEHSKDINKIGGLVEKLK--AKNKRTKH 627
           R              N +IA    + D+    GLV KLK  +KNKR + 
Sbjct: 601 RNKRSQKGKNKKREANGDIAEPSGNNDLK---GLVNKLKHSSKNKRQRR 646

>NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {ON}
           Anc_5.430 YDR365C
          Length = 639

 Score =  534 bits (1376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/624 (47%), Positives = 369/624 (59%), Gaps = 33/624 (5%)

Query: 10  KITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVD----A 65
           K T+D RFSGI+NDPKFR TK+KN KIKLD+RFSK+DLE+RRKAKVDKYGRKI +     
Sbjct: 8   KGTDDSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGRKIHEDNDMN 67

Query: 66  NKDVKDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSVDRARGEPPADYVXXXXX 125
           NK++KDFD+YF                              +VDRARGE PADYV     
Sbjct: 68  NKELKDFDKYFEKEGESADEKKEEEEIETV-----------TVDRARGEVPADYVSSSDE 116

Query: 126 XXXXXXXXXXXXXXXXXXXXXXX--XXKPASGNATNTLAVVNLDWDHVKSADLFVTFKSF 183
                                       P +G+AT TLAVVNLDWDHV+S+DL +TF  F
Sbjct: 117 YTSSESEDSGESDLESEGESEIEVDEATPETGDATKTLAVVNLDWDHVRSSDLMITFSGF 176

Query: 184 VPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXXXXXXXXXEIN------VES 237
           +PKGG+I+KI + PSEFGKERMQREE EGPP+ELFQ              +      ++ 
Sbjct: 177 LPKGGKIEKIVVLPSEFGKERMQREETEGPPRELFQKKKKKGKRASVESDSDDSDVDIKD 236

Query: 238 IYEEGDAE-DYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYESTANVFDL 296
           +YEEGDA+ D D++A             AVVYC+ +  A +IY+NCDGTEYESTAN+FDL
Sbjct: 237 LYEEGDADKDVDTRALRQYQLERLRYYYAVVYCNSVEAARAIYENCDGTEYESTANMFDL 296

Query: 297 RYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAFTQ 356
           RYVPDGM+ DD+PRD+C+SLPKNYKP QFSTDALQHS VKLTWDETPA+RVE++KRAFTQ
Sbjct: 297 RYVPDGMDFDDEPRDQCSSLPKNYKPHQFSTDALQHSNVKLTWDETPAERVEVAKRAFTQ 356

Query: 357 KEIEEMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFDQKE--DEDDNEA 414
           KEIE+MDFKAYLA              KNKLK+LV DS+++G + +F  K+  + +D E 
Sbjct: 357 KEIEDMDFKAYLASDSDGSEDEVNQDAKNKLKSLVGDSLRIGNQPIFGSKDTLEGEDEEV 416

Query: 415 DMEITFTPGLDESGQQDTNDNEEESTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 474
           DMEITF PGL E  ++     E                                      
Sbjct: 417 DMEITFDPGLSEGVEKTEEHEETTIEKVARKEKERRKARKQKLKELKNNAQKEKKDKLKS 476

Query: 475 XXXXDTSHSIDDD----KKKGELELLML-DENEGESTINNKAHFNMNEILXXXXXXXXXX 529
                 + S + D    K K ELELLM+ DE++ E+ IN KAHFNM EIL          
Sbjct: 477 LKGKKHNDSTEGDASTAKSKAELELLMMDDEDDTETGINKKAHFNMKEILRSEKEKSKKG 536

Query: 530 XXXXXXXIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTVXXXXX 589
                  IV+D F PD+NDPRFKEVFEDHDFAIDP++PEFK+TPAM++ILKER+      
Sbjct: 537 KYQDKRRIVEDNFKPDLNDPRFKEVFEDHDFAIDPSRPEFKETPAMKEILKERSKRSSKN 596

Query: 590 XXXXXXNHEIANTE--HSKDINKI 611
                 +H + + +   + DI+ I
Sbjct: 597 AQKKKRSHSLMDNQANETSDISNI 620

>Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {ON}
           similar to Ashbya gossypii AER259W + AER260C
          Length = 630

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/594 (50%), Positives = 365/594 (61%), Gaps = 20/594 (3%)

Query: 1   MNSKGEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGR 60
           M+ K EK++ +T D RF+GIHNDPKFR  K    KI LDDRFSK+DLE +RKAKVDKYGR
Sbjct: 1   MSDKREKRDPVTNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGR 60

Query: 61  KIVDAN-KDVKDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSVDRARGEPPADY 119
           +I   + K+ KDFDRYF+                         +   ++DRARGE P DY
Sbjct: 61  RIGSYDEKEAKDFDRYFSKNESVEKIQSDDEEGETED------IAVSALDRARGEVPLDY 114

Query: 120 VXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXKPASGNATNTLAVVNLDWDHVKSADLFV 178
                                           KP +G+ T   AVVNLDWDHV+S DL  
Sbjct: 115 ESSSDENSSSESEEESEDSALDPDSELEIEESKPETGDPTKVFAVVNLDWDHVRSVDLLA 174

Query: 179 TFKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELF---QXXXXXXXXXXXXEINV 235
           TF SFVP GG I+K+AIYPSEFGKERM+REE+EGPP+ELF   Q            +I++
Sbjct: 175 TFNSFVPNGGSIKKVAIYPSEFGKERMKREEVEGPPRELFKRKQSKKEKDSDDENSDIDI 234

Query: 236 ESIYEEGDAE-DYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYESTANVF 294
             +YE  DAE DYDSKA             AVVYCSD+ TA++IYQNCDGTE+ESTAN+F
Sbjct: 235 NDLYEVDDAEKDYDSKALRRYQLDRLRYYYAVVYCSDVLTAKAIYQNCDGTEFESTANMF 294

Query: 295 DLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAF 354
           DLRYVPD M+ +DDPRD+C S+PK+YKP QFST ALQHS+VKLTWDETPADRVEISKRAF
Sbjct: 295 DLRYVPDNMKFEDDPRDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAF 354

Query: 355 TQKEIEEMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFDQKEDEDDNEA 414
            QKEIEEMDFKAYLA            + KN L++LV DS++V  KS+FD+   E+  EA
Sbjct: 355 NQKEIEEMDFKAYLASDSDSSEGETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEE--EA 412

Query: 415 DMEITFTPGLDESGQQDTNDNEEESTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 474
           D+EITFTPGL E+G     +NEEE+ +D                                
Sbjct: 413 DVEITFTPGL-ENGDAPKEENEEETALDKIKRKEKERRKKRKERVKELKMQAIDEKKARR 471

Query: 475 XXXXDTSHSIDD----DKKKGELELLMLDENEG-ESTINNKAHFNMNEILXXXXXXXXXX 529
               D + +  +     KK+ ELELLML++  G +ST+NN AHFNMNEI+          
Sbjct: 472 RKGDDGAVTEAEKELRKKKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKS 531

Query: 530 XXXXXXXIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERT 583
                  IVDD F PD+NDPRFKEVFEDHDFAIDP+QPEFKKTPAM++IL+ERT
Sbjct: 532 RYQNKNVIVDDNFKPDLNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERT 585

>CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON}
           similar to uniprot|Q06344 Saccharomyces cerevisiae
           YDR365c
          Length = 608

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/588 (49%), Positives = 361/588 (61%), Gaps = 30/588 (5%)

Query: 9   EKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVD-ANK 67
           E+ + DPRFS I+NDPKF+ + SK  KIKLDDRF K+DLEV R+AKVDKYGRKI + ++K
Sbjct: 3   EEKSNDPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGRKIKEGSSK 62

Query: 68  DVKDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSVDRARGEPPADYVXXXXX-- 125
           D++DFD+YF                             K VDRARGE P+DYV       
Sbjct: 63  DIEDFDKYFEKDEKSAEEESADEGDVAKSK--------KIVDRARGEVPSDYVSSEDEFT 114

Query: 126 --XXXXXXXXXXXXXXXXXXXXXXXXXKPASGNATNTLAVVNLDWDHVKSADLFVTFKSF 183
                                      K  +G+AT TLA VNLDWDHV+S D+ VTF SF
Sbjct: 115 SSDSDTSGDSDYDSEIESGDEAQEEQTKVETGDATKTLAAVNLDWDHVRSVDMMVTFSSF 174

Query: 184 VPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXX-----XXXXXXXXEINVESI 238
           +PKGG+I+KI IYPSEFGKERM+REE+EGPP+ELFQ                 +++++ +
Sbjct: 175 LPKGGKIEKICIYPSEFGKERMKREEVEGPPRELFQKNKKKKKKNSSEDEEESDVDIKDL 234

Query: 239 YEEGDAED-YDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYESTANVFDLR 297
           YEEG+A+D  D +A             AV+YC+++ +A++IY+NCDGTEYESTAN+ DLR
Sbjct: 235 YEEGNADDQVDKRALRQYQLDRLRYYYAVIYCNNVESAKAIYENCDGTEYESTANIIDLR 294

Query: 298 YVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAFTQK 357
           YVPDGM+ DD+P+D+C  LPKNYKP QFSTDALQHS VKLTWDETP DRVE++KRAFTQK
Sbjct: 295 YVPDGMDFDDEPKDQCEELPKNYKPHQFSTDALQHSNVKLTWDETPVDRVEVAKRAFTQK 354

Query: 358 EIEEMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFDQKEDEDDNEADME 417
           EIE+MDFKAYLA            + KNKLK+LV +S+K+  K   D+     D   DME
Sbjct: 355 EIEDMDFKAYLASDSDESEEEVNEEAKNKLKSLVGESLKIDGKDGSDE-----DEGMDME 409

Query: 418 ITFTPGLDES---GQQDTNDNEEESTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 474
           ITFTPGLDE+   G+    ++ EE+TI+                                
Sbjct: 410 ITFTPGLDEANAEGEDKDGEDNEETTIEKVRRKEKERRKARKQKLKELKQKSEEEKKQKL 469

Query: 475 XXXXDTSHSIDDDKKKGELELLMLDENEGESTINNKAHFNMNEILXXXXXXXXXXXXXXX 534
               D   S   DKKK ELELLM+DENE  S IN+KAHFNMNEIL               
Sbjct: 470 KSKHDEPLS---DKKKAELELLMMDENESNSGINSKAHFNMNEILRSEKEKSKKGKFQKK 526

Query: 535 XXIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKER 582
             IV+D+F P+++D RFKEVFEDHDFAIDP+QPEFK+T AM++ILKER
Sbjct: 527 QRIVEDDFKPNLDDDRFKEVFEDHDFAIDPSQPEFKETKAMKEILKER 574

>Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON}
           (16620..18533) [1914 nt, 638 aa]
          Length = 637

 Score =  526 bits (1355), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 298/601 (49%), Positives = 363/601 (60%), Gaps = 35/601 (5%)

Query: 5   GEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVD 64
           GE   K + DPRFSGI++DPKF+++K KN KIKLDDRF K DL+++ K+KVDKYGRK+ D
Sbjct: 3   GEDSMKQSSDPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGRKLKD 62

Query: 65  A--NKDVKDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSVDRARGEPPADYVXX 122
              NK+++DFD+YF                             K +DRARGE P+DY   
Sbjct: 63  VKDNKELEDFDKYFEKEDEEDKEEEIGTE-----------AKVKVLDRARGEVPSDYESS 111

Query: 123 XXXXXXXXXXXXXXXXXXXXXXXXXX--XXKPASGNATNTLAVVNLDWDHVKSADLFVTF 180
                                         KP SG+++ TLAVVNLDWD+VKS DL +TF
Sbjct: 112 SEEFTSSDSESSGESEVDSDEESEDEVETSKPESGDSSKTLAVVNLDWDYVKSQDLMITF 171

Query: 181 KSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXXXXXXXXXE-------- 232
            SF+PKGG+I+KI IYPSEFGKERM REE+EGPP+ELF             +        
Sbjct: 172 SSFLPKGGKIEKICIYPSEFGKERMAREEVEGPPRELFNKKKNKKSSKKSSKDDDEDDES 231

Query: 233 ---INVESIYEEGDAE-DYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYE 288
              +++  +YEEGDAE D DSKA             AVVYC++I +AESIY+NCDGTEYE
Sbjct: 232 DSDVDIRELYEEGDAEKDVDSKALRQYQLERLRYYYAVVYCNNIASAESIYENCDGTEYE 291

Query: 289 STANVFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVE 348
           S+AN+FDLRYVPDG E DD+PRDEC  LPKNYK  QF+TDALQHS VKLTWDETPADRVE
Sbjct: 292 SSANIFDLRYVPDGTEFDDEPRDECLQLPKNYKVRQFTTDALQHSNVKLTWDETPADRVE 351

Query: 349 ISKRAFTQKEIEEMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFDQKED 408
           I+KRAFTQKEIEEMDFKAYLA             VKNKLK+LV  S  +G KS+FD K D
Sbjct: 352 IAKRAFTQKEIEEMDFKAYLASDSDESEEEPNDDVKNKLKSLVSQSTTIGDKSIFDDKGD 411

Query: 409 ED-DNEADMEITFTPGLDESGQQDTNDNE-EESTIDXXXXXXXXXXXXXXXXXXXXXXXX 466
            + +++ DMEITFTPGL E G+    D + EE+TI+                        
Sbjct: 412 NNEEDDVDMEITFTPGLGEGGEDGDEDKDNEETTIEKVRRKEKERRKARKDKLKQLKQQS 471

Query: 467 XX-----XXXXXXXXXXDTSHSIDDDKKKGELELLML-DENEGESTINNKAHFNMNEILX 520
                            +  ++  D K K ELELLM+ DE E  ST+N KAHFNMNEI+ 
Sbjct: 472 ENEKKEKLKELKKERNGNGKNTNVDAKAKAELELLMMDDETESTSTLNKKAHFNMNEIVR 531

Query: 521 XXXXXXXXXXXXXXXXIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILK 580
                           IV+D+F PD+NDPRFKE+FEDHDFAIDPTQ EFK+T AM++ILK
Sbjct: 532 SEKEKGKKSKYQDKNKIVEDDFKPDLNDPRFKEIFEDHDFAIDPTQSEFKETTAMKEILK 591

Query: 581 E 581
           E
Sbjct: 592 E 592

>NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa]
           {ON} Anc_5.430 YDR365C
          Length = 669

 Score =  527 bits (1357), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 295/617 (47%), Positives = 366/617 (59%), Gaps = 39/617 (6%)

Query: 3   SKGEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKI 62
           S  E KE  + DPRF+ I+NDPKFR TK+K+ KIKLDDRFSK+DLE+RRK+KVDKYGRK+
Sbjct: 4   SNSENKE--STDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKL 61

Query: 63  VDAN---KDVKDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAK---------SVDR 110
            D+    K++ DFD+YF                             +         ++DR
Sbjct: 62  ADSKGNEKEMNDFDKYFEKDDEKKESEEIATEKSVSVEEKEDEEEERKETELEDDTNIDR 121

Query: 111 ARGEPPADYVXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXKPASGNATNTLAVVNLDW 168
           ARG+ PADYV                                +P SG  + TLAVVNLDW
Sbjct: 122 ARGDVPADYVSSSDEYTSSESEASDEEELDSDVESGEEVTTQEPESGEPSKTLAVVNLDW 181

Query: 169 DHVKSADLFVTFKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXX----- 223
           DHVKS+DL +TF SF+P+GG I+ IAIYPSEFGKERMQRE++EGPPKELFQ         
Sbjct: 182 DHVKSSDLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQKRKKKTSKS 241

Query: 224 -----XXXXXXXXEINVESIYEEGDAE-DYDSKAXXXXXXXXXXXXXAVVYCSDIRTAES 277
                        +++++ +YEEGDA+ D D+KA             AVVYC++I TA +
Sbjct: 242 KKISDEANDSDVSDVDIKDLYEEGDADKDVDTKALRQYQLERLRYYYAVVYCNNIETATA 301

Query: 278 IYQNCDGTEYESTANVFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKL 337
           IYQNCDGTEYESTAN+FDLRYVPDGM+  D+PRD+C SLPKNYKP QFSTDALQHS VKL
Sbjct: 302 IYQNCDGTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKL 361

Query: 338 TWDETPADRVEISKRAFTQKEIEEMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKV 397
           TWDETP +R E++KRAFTQKEI++MDFKAYLA              KNKLKALV      
Sbjct: 362 TWDETPVERQEVAKRAFTQKEIDDMDFKAYLASDSDGSEDELNEDAKNKLKALVGGG-GF 420

Query: 398 GQKSLF---DQKEDEDDNEADMEITFTPGLDESGQQDTNDNEEESTIDXXXXXXXXXXXX 454
           G + +F     K  ED++E DMEITF P LDE+  ++  ++EE +               
Sbjct: 421 GSREIFGGKGAKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIEKVARKEKERRKAR 480

Query: 455 XXXXXXXXXXXXXXXXXXXXXXXXDTSHSIDDD-------KKKGELELLMLDEN-EGEST 506
                                     +H+ +DD       K + ELELLM+D++ E  ST
Sbjct: 481 KQKLKELKTKAQQEKKDKLKLSKNKKNHTKEDDAEAKKNQKSRAELELLMMDDDEETGST 540

Query: 507 INNKAHFNMNEILXXXXXXXXXXXXXXXXXIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQ 566
           INNKAHFNMNEIL                 IV+DEF PD+NDPRFKEVFEDHDFAIDP++
Sbjct: 541 INNKAHFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSR 600

Query: 567 PEFKKTPAMEKILKERT 583
           PEFK+T AM++ILKER+
Sbjct: 601 PEFKETKAMKEILKERS 617

>Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {ON}
           YDR365C (REAL)
          Length = 627

 Score =  521 bits (1341), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 294/598 (49%), Positives = 355/598 (59%), Gaps = 42/598 (7%)

Query: 6   EKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVDA 65
           EK +K   D RF+GI++DPKF++T++K+ KIKLD RFSK+DLEV+ K+KVDKYGRKI + 
Sbjct: 4   EKPQKEGADTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKNT 63

Query: 66  --NKDVKDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSVDRARGEPPADYVXXX 123
             NK+++DFD+YF                               VDRARGE   DYV   
Sbjct: 64  QNNKELEDFDKYFQKEAENDEDTEASVKTV--------------VDRARGEISGDYVSSS 109

Query: 124 XXXXXXXXXXXXXXXXXXXXXXXXXXX--KPASGNATNTLAVVNLDWDHVKSADLFVTFK 181
                                        KP  G+ + TLAVVNLDWDHVKS DL +TF 
Sbjct: 110 DEFTSSDSESSEQSEVESEVESEVEIEDPKPECGDVSKTLAVVNLDWDHVKSEDLMITFS 169

Query: 182 SFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXXXXXXXXX--------EI 233
           SFVPKGG+++++AIYPSEFGKERMQREE+EGPPKELFQ                    +I
Sbjct: 170 SFVPKGGKLERVAIYPSEFGKERMQREEVEGPPKELFQKKNKNKVSRKKKSDESDSDIDI 229

Query: 234 NVESIYEEGDAE-DYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYESTAN 292
            +  +YEEGDA+ D DS+A             A+VYCSDI T+++IY NCDGTEYESTAN
Sbjct: 230 GINDLYEEGDADKDVDSRALRQYQLDRLRYYYAIVYCSDITTSKAIYDNCDGTEYESTAN 289

Query: 293 VFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKR 352
           +FDLRYVPDGM  DD  RDECT LPKNY+P QFSTDALQHS VKLTWDETPADR+E++KR
Sbjct: 290 MFDLRYVPDGMTFDDAVRDECTLLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKR 349

Query: 353 AFTQKEIEEMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFDQKED--ED 410
           AFTQKEI++MDFKAYLA              KNKLK+L      VG  +   +KE+  + 
Sbjct: 350 AFTQKEIDDMDFKAYLASDSDESDEQIDEDAKNKLKSL------VGGINFNSKKENVKDS 403

Query: 411 DNEADMEITFTPGLDESGQQDTNDNEEESTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 470
           D E DMEITFTP L E G +  ++ +EE+TI+                            
Sbjct: 404 DEEVDMEITFTPAL-EGGNEQPSEEQEETTIEKIRRKEKERRKARKQKVKELKQQSEKDK 462

Query: 471 XXXXXXXXDTSHSIDDD-----KKKGELELLMLDEN-EGESTINNKAHFNMNEILXXXXX 524
                         ++D     K K ELELLM D++ E + TINNKAHFNMNEIL     
Sbjct: 463 KTKLKSINKKYAEGEEDIKNNAKAKAELELLMDDDDAEAQGTINNKAHFNMNEILRSEKE 522

Query: 525 XXXXXXXXXXXXIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKER 582
                       IV+D FTPD+NDPRFKEVFEDHDFAIDPTQPE+K T AM KILKER
Sbjct: 523 KNKKSRYQNKERIVEDNFTPDLNDPRFKEVFEDHDFAIDPTQPEYKSTQAMNKILKER 580

>Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  520 bits (1340), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 306/631 (48%), Positives = 370/631 (58%), Gaps = 41/631 (6%)

Query: 6   EKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVDA 65
           +K EK + D RF+GI+NDPKF++T++++ KIKLD RFSK+DLEV+ K+KVDKYGRKI DA
Sbjct: 4   DKLEKESVDARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKDA 63

Query: 66  N--KDVKDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSVDRARGEPPADYVXXX 123
           +  K+++DFD+YF                          V A +VDRARGE P DYV   
Sbjct: 64  HNTKELEDFDKYF-------------EKEAENEEDTEADVKA-TVDRARGEVPNDYVSSG 109

Query: 124 X--XXXXXXXXXXXXXXXXXXXXXXXXXXKPASGNATNTLAVVNLDWDHVKSADLFVTFK 181
                                        KP SG+A+ TLAVVNLDWDHVKS DL +TF 
Sbjct: 110 DEFTSSDSESSGESEIESEEESEVEAEDAKPESGDASKTLAVVNLDWDHVKSEDLMITFS 169

Query: 182 SFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXXXXXXXXX--------EI 233
            FVPKGG+I++I++YPSEFGKERMQREEIEGPPKELFQ                    +I
Sbjct: 170 GFVPKGGKIERISVYPSEFGKERMQREEIEGPPKELFQRKKQVKASKKENADDSDSDIDI 229

Query: 234 NVESIYEEGDAE-DYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYESTAN 292
            ++ +YEEGDA+ D DS+A             A+V CSDI TA +IY+NCDGTEYESTAN
Sbjct: 230 GIKDLYEEGDADKDVDSRALRQYQLDRLRYYYAIVDCSDISTARAIYENCDGTEYESTAN 289

Query: 293 VFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKR 352
           +FDLRYVPDGM  DD  RD C++LPKNY+P QFSTDALQHS VKLTWDETPADRVE++KR
Sbjct: 290 MFDLRYVPDGMTFDDTARDACSTLPKNYRPHQFSTDALQHSNVKLTWDETPADRVEVAKR 349

Query: 353 AFTQKEIEEMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFDQKEDEDDN 412
           AFTQKEI++MDFKAYLA              K+KLK+LV     +G  S  +   D D+ 
Sbjct: 350 AFTQKEIDDMDFKAYLASDSDESDEEVNEDAKSKLKSLVGG---LGFNSKKENANDGDEE 406

Query: 413 EADMEITFTPGLDESGQQDTNDNEEESTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 472
           E DMEITFTP L E G +   + +EE++I+                              
Sbjct: 407 EVDMEITFTPAL-EGGDEKPIEGQEETSIE-KIRRKEKERRKARKQKVKELKQQSEKEKR 464

Query: 473 XXXXXXDTSHSIDDD------KKKGELELLMLDEN--EGESTINNKAHFNMNEILXXXXX 524
                 +  H  D++      K K ELELLM D+   E ES+IN+KAHFNMNEIL     
Sbjct: 465 GKFKSANKKHVADEEEIKNNAKSKAELELLMDDDGDAEAESSINSKAHFNMNEILRSEKE 524

Query: 525 XXXXXXXXXXXXIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTV 584
                       IV+D FTPD+ DPRFKEVFEDHDFAIDPTQPE+K T AM KILKER  
Sbjct: 525 KHKKSRYQKKERIVEDNFTPDLEDPRFKEVFEDHDFAIDPTQPEYKGTQAMNKILKERGK 584

Query: 585 XXXXXXXXXXXNHEIANTEHSKDINKIGGLV 615
                      N E   TE   D   IG LV
Sbjct: 585 RVHDRKRKHGKN-ENDVTEDGNDNKNIGNLV 614

>YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}
           ESF1Nucleolar protein involved in pre-rRNA processing;
           depletion causes severely decreased 18S rRNA levels
          Length = 628

 Score =  513 bits (1321), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 298/601 (49%), Positives = 365/601 (60%), Gaps = 43/601 (7%)

Query: 5   GEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVD 64
           GE  +K   D RF+GI++DPKF++TK+K+ KIKLD RFSK+DLEV+ K+KVDKYGRKI +
Sbjct: 3   GENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKN 62

Query: 65  A--NKDVKDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSV-DRARGEPPADYVX 121
           A  N++++DFD+YF                          V+AK+V DRARGE P DYV 
Sbjct: 63  AQNNRELEDFDKYF---------------EKEAENDEDSEVNAKTVVDRARGEVPDDYVS 107

Query: 122 XXX--XXXXXXXXXXXXXXXXXXXXXXXXXXKPASGNATNTLAVVNLDWDHVKSADLFVT 179
                                          KP SG+ +  LAVVNLDWDHVKS DL +T
Sbjct: 108 SSDEFTSSDSESSGESEVESEEENEVEIENAKPESGDISKNLAVVNLDWDHVKSEDLMIT 167

Query: 180 FKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXXXXXXXX--------X 231
           F SFVPKGG+I+++AIYPSEFGKERMQREE+EGPPKELFQ                    
Sbjct: 168 FSSFVPKGGKIERVAIYPSEFGKERMQREEVEGPPKELFQKKNKNKTSKKKKTDDSDSDM 227

Query: 232 EINVESIYEEGDAE-DYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYEST 290
           +I ++ +YEEGDA+ D DS+A             A+VYCSD  T+++IY NCDGTEYEST
Sbjct: 228 DIGIKDLYEEGDADKDVDSRALRQYQLDRLRYYYAIVYCSDTTTSKAIYDNCDGTEYEST 287

Query: 291 ANVFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEIS 350
           AN+FDLRYVPDGM  DDD RDEC+ LPKNY+P QFSTDALQHS VKLTWDETPADRVE++
Sbjct: 288 ANMFDLRYVPDGMTFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVA 347

Query: 351 KRAFTQKEIEEMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFDQKEDED 410
           KRAFTQKEI++MDFKAYLA            + KNKLK+LV D    G  S  +   DED
Sbjct: 348 KRAFTQKEIDDMDFKAYLASDSDESDGQVDEEAKNKLKSLVGD---FGFNSKKETPNDED 404

Query: 411 DNEADMEITFTPGLDESGQQDTNDNEEESTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXX 470
           + E DMEITFTP L E G + +++++EE+TI+                            
Sbjct: 405 E-EVDMEITFTPAL-EGGNEKSSEDKEETTIE-KIRRKEKERRKARKQKVKELKQQSEKD 461

Query: 471 XXXXXXXXDTSHSIDDD--------KKKGELELLMLDENEGESTINNKAHFNMNEILXXX 522
                   +  H+ D++        K + EL +   D+ E + TINNKAHFNMNEIL   
Sbjct: 462 KKSKLKSVNKKHTNDEEEIEKNAKSKAELELLMDDDDDTETQGTINNKAHFNMNEILRSE 521

Query: 523 XXXXXXXXXXXXXXIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKER 582
                         IV+D FTPD+ DPRFKEVFEDHDFAIDPTQPEFK T AM KILKER
Sbjct: 522 KEKHKKGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKER 581

Query: 583 T 583
           +
Sbjct: 582 S 582

>TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.430
           YDR365C
          Length = 617

 Score =  511 bits (1316), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 298/634 (47%), Positives = 371/634 (58%), Gaps = 42/634 (6%)

Query: 9   EKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVDA--N 66
           EK ++DPRFS I++DPKF + K+K FK+KLDDRFSK+DLE++RK KVDKYGR++ D   +
Sbjct: 3   EKRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDS 62

Query: 67  KDVKDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSVDRARGEPPADYVXXXXX- 125
           K+ KDFD+YF                              +VDRARGE P+DYV      
Sbjct: 63  KESKDFDKYF--------------EQSDEEKKKDKDTEILTVDRARGEVPSDYVSSSDEF 108

Query: 126 XXXXXXXXXXXXXXXXXXXXXXXXXKPASGNATNTLAVVNLDWDHVKSADLFVTFKSFVP 185
                                    +P+SG+++ TLAVVNLDWD+V+S+DL +TF SF+P
Sbjct: 109 TSSDSEVSDNEVESESESEVELEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLP 168

Query: 186 KGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXX----XXXXXXXEINVESIYEE 241
            GG I+KIAIYPSEFGKERMQREE+EGPPKELFQ                +I+V+ +YEE
Sbjct: 169 AGGRIEKIAIYPSEFGKERMQREEVEGPPKELFQKKKKKSKKGQQEDSDSDIDVKDLYEE 228

Query: 242 GDAE-DYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYESTANVFDLRYVP 300
           GDA+ + D+KA             AVVYC+++  AESIY NCDGTEYESTAN+FD+RYVP
Sbjct: 229 GDADKNVDNKALRQYQLDRLRYYYAVVYCNNVAAAESIYNNCDGTEYESTANIFDIRYVP 288

Query: 301 DGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAFTQKEIE 360
           DGM+ D  P+D CT LPKNYKP QFSTDALQHS VKLTWDETPADR++++KRAFTQKEIE
Sbjct: 289 DGMDFDGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIE 348

Query: 361 EMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFD------QKEDEDDNEA 414
           +MDFKAYLA            Q K+KLK+LV  S      S FD       + D +D E 
Sbjct: 349 DMDFKAYLASDSDDSEDEVDAQSKSKLKSLVTGS------SAFDFTRKNADEVDGNDEEV 402

Query: 415 DMEITFTPGLDESGQQDTNDNEEESTIDXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXX 472
           DMEITFTPGLDE+ +      EEESTID                                
Sbjct: 403 DMEITFTPGLDEANKDGQEGQEEESTIDKVRRKEKERRKARKAKVKELKHQAEQDKKVKL 462

Query: 473 XXXXXXDTSHSIDDDKKKGELELLML-DENEGESTINNKAHFNMNEILXXXXXXXXXXXX 531
                  TS    D K K ELELLM+ DE++ E +IN KAHFNM EIL            
Sbjct: 463 KKGRGKQTSDIEQDPKSKAELELLMMDDEDDTEKSINKKAHFNMKEILKSEKEKKKKNKY 522

Query: 532 XXXXXIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTVXXXXXXX 591
                IV D+F PD+ DPRFKE+FE HDFAIDPTQ EF+ T AM+++L +R+        
Sbjct: 523 QDKNKIVVDDFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRS----KQAH 578

Query: 592 XXXXNHEIANTEHSKDINK-IGGLVEKLKAKNKR 624
                 +IA  E+  + N  I  +V KLK   ++
Sbjct: 579 RVNSKRKIATQENDTNENGDIANIVAKLKKGGRK 612

>ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 611

 Score =  511 bits (1315), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 279/580 (48%), Positives = 350/580 (60%), Gaps = 23/580 (3%)

Query: 10  KITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVDANKDV 69
           K + DPRF+GI NDPKFR+ K K  K+KLDDRFSK+DL+VRRKAKVDKYGR+I   +KD+
Sbjct: 8   KGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRITGESKDL 67

Query: 70  KDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSVDRARGEPPADYVXXXXXXXXX 129
           KDFD+YF                          V    VDRARGE P  Y          
Sbjct: 68  KDFDKYFEKEGKEGKEDESSSSSEDEEEETESKV----VDRARGELPEAYTSSESEDSES 123

Query: 130 XXXXXXXXXXXXXXXXXXXXXKPASGNATNTLAVVNLDWDHVKSADLFVTFKSFVPKGGE 189
                                KP SG+ + TLAVVNLDWDHV++ADL +TF SF+P GG+
Sbjct: 124 DLSEEESEADVAEAVEEA---KPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGK 180

Query: 190 IQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXXXXXXXXXEINVESIYEEGDAE-DYD 248
           I+KI IYPSEFGKERMQREE EGPP+E+F             ++++  +YEEGDA+ + D
Sbjct: 181 IEKICIYPSEFGKERMQREEKEGPPREIFNKKKKHHDEDSDSDVDIRDLYEEGDADKEVD 240

Query: 249 SKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYESTANVFDLRYVPDGMEMDDD 308
           + A             A+VYC+++ T ESIY NCDGTEYESTAN+FDLRYVP+GME DD+
Sbjct: 241 NAALRQYQLERLRYYYAIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEFDDE 300

Query: 309 PRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAFTQKEIEEMDFKAYL 368
           P+DEC  LPKNYKP +FSTDALQHS VKLTWDETP DR+E+SKRAF+QKE+E+MDF+AYL
Sbjct: 301 PKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQAYL 360

Query: 369 AXXXXXX--XXXXXXQVKNKLKALVMDSVKVGQKSLFDQKEDEDDNEADMEITFTPGLDE 426
           A              + KNKLK+LV  S+  G++          + E DMEITFTPGLD+
Sbjct: 361 ASGTDESDGEENNNEEAKNKLKSLVGQSLAYGKQQ---------EEEPDMEITFTPGLDD 411

Query: 427 SGQQDTNDNEEESTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDTSHSID- 485
           S  Q  +++ EE+TI+                                    +     D 
Sbjct: 412 SKPQ-ADEDHEETTIEKVKRKEQERRKARKQRLKELKQQAEQEKKEKLRSGKNKKQVEDE 470

Query: 486 -DDKKKGELELLML-DENEGESTINNKAHFNMNEILXXXXXXXXXXXXXXXXXIVDDEFT 543
            D K K ELELLM+ DE++ E ++N KAHFNMNEIL                 I++DEF 
Sbjct: 471 SDAKSKAELELLMMEDEDDTEKSLNKKAHFNMNEILKSEKEKKKKGKYQDKGKIMEDEFK 530

Query: 544 PDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERT 583
           PD+NDPRF EVFE+ DFAIDP+QPE+K T AM++IL+ER+
Sbjct: 531 PDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERS 570

>AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR365C (ESF1)
          Length = 619

 Score =  506 bits (1303), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 288/587 (49%), Positives = 362/587 (61%), Gaps = 23/587 (3%)

Query: 2   NSKGEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRK 61
           N++G  K+ I  D RF+ I +DPKFR+ K KN KIKLDDRFSKQDLE +RKAKVDKYGR+
Sbjct: 4   NNEGTGKDSI--DKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRR 61

Query: 62  IVDA-NKDVKDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSVDRARGEPPADYV 120
           I  A  K+ KDF++YFT                              +DRARGE PADYV
Sbjct: 62  IGTAPGKEEKDFEKYFTKESSESAAEESDKEDS----------SVAKLDRARGEVPADYV 111

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPA-SGNATNTLAVVNLDWDHVKSADLFVT 179
                                         +   SG+ +  LAVVNLDWDHVK ADL V 
Sbjct: 112 SSSDEESSSESEADSDDATAESDEEVEIEEEKPESGDPSKVLAVVNLDWDHVKCADLLVA 171

Query: 180 FKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXXXXXXXXX-EINVESI 238
           F SFVP+GG+I+++AIYPSEFGKERMQREE+EGPP+E+F+             EI ++ +
Sbjct: 172 FNSFVPEGGKIERVAIYPSEFGKERMQREEVEGPPREVFKSKKDKKAKQDDDDEIGLKDL 231

Query: 239 YEEGDAE-DYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYESTANVFDLR 297
           YE+GDAE DYDSKA             AVVYC+++ TAE+IYQNCDGTEYESTAN+FDLR
Sbjct: 232 YEQGDAEKDYDSKALRRYQLERLRYYYAVVYCNNVATAEAIYQNCDGTEYESTANMFDLR 291

Query: 298 YVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAFTQK 357
           YVP+G+  DD+PR+EC S+PK+YKP QFST ALQH +VKLTWDETPADRVE++KRAF+QK
Sbjct: 292 YVPEGVTFDDEPREECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQK 351

Query: 358 EIEEMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFDQKEDEDDNEADME 417
           EIE+MDFKAYLA            + KNKL++LV  SVKV  K LF  + DE+  EAD++
Sbjct: 352 EIEDMDFKAYLASDSEESEADDNSEAKNKLRSLV-SSVKVADKPLFADESDEE--EADVQ 408

Query: 418 ITFTPGLDESGQQDTNDNEEESTIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 477
           ITFTPGL E G+    D EEE+ ++                                   
Sbjct: 409 ITFTPGL-EGGEAKEEDAEEENILEKLKRKEKERRKKRKERVKELKKQAEEEKKSSKKEK 467

Query: 478 XDT---SHSIDDDKKKGELELLMLDENEGESTINNKAHFNMNEILXXXXXXXXXXXXXXX 534
             +   S    ++ K+ ELELLM++++E   +IN+ AHFNMN+IL               
Sbjct: 468 HASKSESEQKSENDKRAELELLMMEDDENSQSINSSAHFNMNDILRSEKERGKKSKYQKK 527

Query: 535 XXIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKE 581
             IV+D+F PD+NDPRFKEVFED DFAIDP+QPEFK+T AM++IL+E
Sbjct: 528 DKIVEDDFKPDLNDPRFKEVFEDRDFAIDPSQPEFKETAAMKQILQE 574

>TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON}
           Anc_5.430 YDR365C
          Length = 659

 Score =  501 bits (1290), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 293/613 (47%), Positives = 357/613 (58%), Gaps = 41/613 (6%)

Query: 10  KITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVDAN-KD 68
           K  ED RF+G+  DPKFR +K  + K+KLD+RFSK+DL+V  K+KVD+YGRKI+D N KD
Sbjct: 5   KPKEDARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDRNEKD 64

Query: 69  VKDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKS------------VDRARGEPP 116
            KDFD+Y+T                         V  K+            +DRARG+ P
Sbjct: 65  KKDFDKYYTKDEDEENKDEEQDKSDQEEESEEEDVDEKADDDEDVLAELARLDRARGDVP 124

Query: 117 ADYVXXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXKPASGNATNTLAVVNLDWDHVKSA 174
           +DYV                                KP +G+ + T+AVVNLDWDHVKS 
Sbjct: 125 SDYVSSSDDYSSSESESSGESEVDSDEESDAEIESAKPETGDPSKTVAVVNLDWDHVKST 184

Query: 175 DLFVTFKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXXXXXXXX---- 230
           DL +TF  F+PKGG+I KIAIYPSEFGKERMQREEIEGPPKELF+               
Sbjct: 185 DLMITFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPKELFKKKNKKGKKSTAEDNE 244

Query: 231 ---XEINVESIYEEGDAE-DYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTE 286
               ++++  +YEEGDA+ + DSK+             AVVYC++I TAESIY+NCDGTE
Sbjct: 245 DDVSDVDINDLYEEGDADKNIDSKSLRQYQLERLRYYYAVVYCNNIGTAESIYKNCDGTE 304

Query: 287 YESTANVFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADR 346
           YESTANVFD+RYVPD M  DD PRDEC  LPKNYKP QFSTDALQHS VKLTWDETPADR
Sbjct: 305 YESTANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDETPADR 364

Query: 347 VEISKRAFTQKEIEEMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSV---KVGQKSLF 403
           VEISKRAF+QKEI+EMDFKAYLA              KNKLK+LV         G+ + +
Sbjct: 365 VEISKRAFSQKEIDEMDFKAYLASDSDESESELNNDSKNKLKSLVGGGAFGNVFGKDTEY 424

Query: 404 DQKEDEDDNEADMEITFTPGLDESGQQDTNDNE---EESTIDXXXXXXXXXXXXXXXXXX 460
           D    +D++  DMEITFTPGLDE  +++ +DNE   EESTI+                  
Sbjct: 425 DLDGSDDEDGVDMEITFTPGLDE--KKEASDNETKKEESTIEKLQRKEKERRKLRKQKVK 482

Query: 461 XXXXXXXXXXXXXXXXXXDTSHSID----------DDKKKGELELLMLDENEGESTINNK 510
                             + +   +           DK K ELELLM+DE++  S +NNK
Sbjct: 483 DLKEKSVQERKEKLNSNRNRNKKNNNELLKDEKEKQDKSKAELELLMMDEDDRISGVNNK 542

Query: 511 AHFNMNEILXXXXXXXXXXXXXXXXXIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFK 570
           AHFNMNEIL                 IV DEF P++ND RF E+FEDH FAIDPTQPEFK
Sbjct: 543 AHFNMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQPEFK 602

Query: 571 KTPAMEKILKERT 583
           +T AM++IL ERT
Sbjct: 603 QTSAMKEILNERT 615

>KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.430
           YDR365C
          Length = 642

 Score =  499 bits (1286), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 296/635 (46%), Positives = 368/635 (57%), Gaps = 41/635 (6%)

Query: 9   EKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIV--DAN 66
           +K++ DPRFSG++NDPKFRSTK K  K+KLD RFSK+DLEV++KAKVDKYGRKI   DAN
Sbjct: 3   DKMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGRKIKNGDAN 62

Query: 67  K-DVKDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSVDRARGEPPADYVXXXXX 125
           K +++DFD+YF                               VDRARGE P DYV     
Sbjct: 63  KKELEDFDKYFEKEDEAKESEDAEAPEAPVKVV---------VDRARGEVPDDYVSSADE 113

Query: 126 XXXXXXXXXXXXXXXXXXXX-------XXXXXKPASGNATNTLAVVNLDWDHVKSADLFV 178
                                           KP SG+ + TLAVVNLDWDHVKS DL +
Sbjct: 114 FTSSDSESSGSSESESESEQSDVEDEIEANSGKPESGDPSKTLAVVNLDWDHVKSVDLMI 173

Query: 179 TFKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQX-------------XXXXX 225
           TF  F+PKGG+I++I IYPSEFGKER+ REE EGPPKELF                    
Sbjct: 174 TFTGFIPKGGKIERICIYPSEFGKERLNREEKEGPPKELFHKKKSKKNSAAKSKGAESGK 233

Query: 226 XXXXXXEINVESIYEEGDAE-DYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDG 284
                 +++++ +YEEGDAE D DSKA             AVVYC+++ TA++IY NCD 
Sbjct: 234 SDDDVSDVDIKDLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDA 293

Query: 285 TEYESTANVFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPA 344
           TEYESTAN+FDLRYVP+GM  DDDPRDEC +LPKNYKP  F+TDALQHS VKLTWDETPA
Sbjct: 294 TEYESTANMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPA 353

Query: 345 DRVEISKRAFTQKEIEEMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFD 404
           DRVEI+KRAF+QKEI++MDFKAYLA             +KN+LKALV  ++K  +     
Sbjct: 354 DRVEIAKRAFSQKEIDDMDFKAYLASDSEDSDAKVDETMKNRLKALVGGTLKASRPKGGA 413

Query: 405 QKEDEDDNEADMEITFTPGLD-ESGQQDTNDNEEESTIDXXXXXXXXXXXXXXXXXXXXX 463
           +++++D+   DMEITFTPGLD     +     EEESTID                     
Sbjct: 414 EEDEDDEEGMDMEITFTPGLDEAQVAEQEAAAEEESTIDKIRRKEKERRKNRKQKLKELK 473

Query: 464 XXXXXXXXXXXXXXXDTSHSID----DDKKKGELELLMLDENE---GESTINNKAHFNMN 516
                              + +    DDK K ELELLM+DE+E    +ST+N K HFNMN
Sbjct: 474 KNAEKEKRDKLKSLKKGRKNGEEEPVDDKAKAELELLMMDEDEERDSKSTLNKKMHFNMN 533

Query: 517 EILXXXXXXXXXXXXXXXXXIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAME 576
           EI+                 IV+DEF PD++D RFKEVFEDHDFAIDP++PEFK+TPAM+
Sbjct: 534 EIMRSEKEKKKKSKFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQ 593

Query: 577 KILKERTVXXXXXXXXXXXNHEIANTEHSKDINKI 611
           KIL+ER+              +  +T    DI++I
Sbjct: 594 KILQERSNRARSKGKKRKSAEQSTDTSDKTDISQI 628

>Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  474 bits (1219), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 290/600 (48%), Positives = 355/600 (59%), Gaps = 42/600 (7%)

Query: 5   GEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVD 64
           G+K EK + D RF+GI +DPKF++T++++ KIKLD RFSK+DLEV+ K+KVDKYGRKI D
Sbjct: 3   GDKSEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKIKD 62

Query: 65  A--NKDVKDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAK-SVDRARGEPPADYVX 121
           A  NK+++DFD+YF                          V AK  VDRARGE P+DYV 
Sbjct: 63  ARNNKELEDFDKYF---------------EKEAEHDEDSEVAAKIVVDRARGEVPSDYVS 107

Query: 122 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPA--SGNATNTLAVVNLDWDHVKSADLFVT 179
                                          A  SG+ + TLAVVNLDWDHVKS DL +T
Sbjct: 108 SSDEFTSSDSESSGESEVESEVEGEVETEDVAAESGDVSKTLAVVNLDWDHVKSEDLMIT 167

Query: 180 FKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXXXXXXXXXEINVES-- 237
           F SFVP+GG+I++IAI+PSEFG+ERM+REE+EGPPKELFQ             +  +S  
Sbjct: 168 FSSFVPRGGKIERIAIFPSEFGRERMEREEVEGPPKELFQKKNKNKHAKEKNSVGTDSDG 227

Query: 238 ------IYEEGDAE-DYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYEST 290
                 +YEEGDA+ D DS+A             AVV CSD  +A++IY NCDGTEYEST
Sbjct: 228 DIGINDLYEEGDADKDVDSRALRQYQLDRLRYYYAVVCCSDTTSAKAIYDNCDGTEYEST 287

Query: 291 ANVFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEIS 350
           AN+FDLRYVPDGM  DD  RDECTSLPKNY+P QFSTDALQHS VKLTWDETPADR+E++
Sbjct: 288 ANMFDLRYVPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVA 347

Query: 351 KRAFTQKEIEEMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMD-SVKVGQKSLFDQKEDE 409
           KRAFTQKEI++MDFKAYLA              KNKLK+LV      + +K   D KE  
Sbjct: 348 KRAFTQKEIDDMDFKAYLASDSDESDEQVDEDAKNKLKSLVGGLDFNMKKKGANDGKE-- 405

Query: 410 DDNEADMEITFTPGLDESGQQDTNDNEEESTIDXXXXXXXXXXXXXXXXXXXXXXXXXXX 469
            + E DMEITFTP L E   +   + ++E+TI+                           
Sbjct: 406 -EGEVDMEITFTPAL-EGENEKPIEGQDETTIE-KIRRKEKERRKARKQKVKELKQQSEK 462

Query: 470 XXXXXXXXXDTSHSIDDD------KKKGELELLM-LDENEGESTINNKAHFNMNEILXXX 522
                    +  H  D++      K K ELELLM  D+ E E ++N+KAHF+M EIL   
Sbjct: 463 DKKSKLKSVNKKHVADEEEIKNNAKSKAELELLMDEDDAETEGSMNSKAHFSMKEILRSE 522

Query: 523 XXXXXXXXXXXXXXIVDDEFTPDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKER 582
                         IV+D F PD+ DPRFKEVFEDHDFAIDPTQPE+K T AM  ILKER
Sbjct: 523 KEKHKRGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKER 582

>KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {ON}
           Anc_5.430 YDR365C
          Length = 625

 Score =  437 bits (1123), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 235/433 (54%), Positives = 279/433 (64%), Gaps = 30/433 (6%)

Query: 3   SKGEKKEKITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKI 62
           S+G KK   ++DPRFS I+NDPKF++ K+K+ KI+LD RFSK+DLE+R KAKVDKYGRK 
Sbjct: 2   SEGGKK---SDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKT 58

Query: 63  VD--ANKDVKDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSVDRARGEPPADYV 120
            D  + K++ DF++YF                               VDRARGE P+DYV
Sbjct: 59  KDEGSKKELDDFEKYFEKEDEEEKKDTEET------------EEKPKVDRARGEVPSDYV 106

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXXXXX--XXKPASGNATNTLAVVNLDWDHVKSADLFV 178
                                           KP +G+A+ TLAVVNLDWDHVKSADL V
Sbjct: 107 SSSDEYTSSESEDSEEEELDSDVESEVEIENTKPETGDASKTLAVVNLDWDHVKSADLMV 166

Query: 179 TFKSFVPKGGEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXXXXXXXX-----XEI 233
           TF SFVPKGG+I +I IYPSEFGKER+QREE+EGPPKELFQ                 ++
Sbjct: 167 TFSSFVPKGGKISRICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEDFDSDSDV 226

Query: 234 NVESIYEEGDAE-DYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYESTAN 292
           +++ +YEEGDAE D DSKA             AVVYC++I TA +IY+NCDGTEYESTAN
Sbjct: 227 DIKDLYEEGDAEKDVDSKALRQYQLERLRYYYAVVYCNNIDTARAIYENCDGTEYESTAN 286

Query: 293 VFDLRYVPDGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKR 352
           +FDLRYVPDGM  DD+PRDEC SLPKNYKP QFSTDALQHS VKLTWDETPADRVE++KR
Sbjct: 287 MFDLRYVPDGMTFDDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKR 346

Query: 353 AFTQKEIEEMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFDQKEDEDDN 412
           AF+QKEIE+MDFKAYLA              KNKLKALV +S+  G     D      ++
Sbjct: 347 AFSQKEIEDMDFKAYLASDSDESEEEVNENSKNKLKALVGESLDFGTNGASD-----GES 401

Query: 413 EADMEITFTPGLD 425
           E DMEITFTPGLD
Sbjct: 402 EVDMEITFTPGLD 414

 Score =  117 bits (293), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 65/139 (46%), Positives = 85/139 (61%), Gaps = 2/139 (1%)

Query: 488 KKKGELELLML-DENEGESTINNKAHFNMNEILXXXXXXXXXXXXXXXXXIVDDEFTPDV 546
           K K ELELLM+ DE++ E ++N KAHFN+NEI+                 IV+D+F PD+
Sbjct: 481 KAKAELELLMIEDEDDTEQSLNKKAHFNLNEIIRSEKEKGKKGKYQRKEKIVEDDFKPDL 540

Query: 547 NDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTVXXXXXXXXXXXNHEIANTEHSK 606
           +DPRFKEVFEDHDFAIDP+QPEFK+T AM++IL ER+                 +T  SK
Sbjct: 541 SDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQILNERSKRSKERSKGGKNKKRKLDTSTSK 600

Query: 607 D-INKIGGLVEKLKAKNKR 624
           +  N I  +V KLK   K+
Sbjct: 601 NGKNAISNIVNKLKKNGKQ 619

>TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {ON}
           Anc_5.430 YDR365C
          Length = 622

 Score =  433 bits (1113), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 228/424 (53%), Positives = 272/424 (64%), Gaps = 26/424 (6%)

Query: 11  ITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVDAN-KDV 69
           +  D RFSG+ NDPKF++ + KN KIKLD RFSK DLEV RKA+VDKYGRKI + N ++ 
Sbjct: 7   VNTDERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGRKISNLNNQEA 66

Query: 70  KDFDRYFTXXXXXXXXXXXXXXXXXXXXXXXXXVHAKSVDRARGEPPADYVXXX--XXXX 127
           KDFD+YF                               +DRARGE P+DY          
Sbjct: 67  KDFDKYFEKEEDGKGEEIAVKPL---------------IDRARGEVPSDYQSSLDDYTSS 111

Query: 128 XXXXXXXXXXXXXXXXXXXXXXXKPASGNATNTLAVVNLDWDHVKSADLFVTFKSFVPKG 187
                                  KP SG+++ T+AVVNLDWDHVK+ DL VTF SFVPKG
Sbjct: 112 ESEDSEDEDLESEGESEAEIEETKPESGDSSKTIAVVNLDWDHVKATDLLVTFSSFVPKG 171

Query: 188 GEIQKIAIYPSEFGKERMQREEIEGPPKELFQXXXXXXXXXXXXEIN------VESIYEE 241
           G+I++IAI+PSEFGK+RM+REE+EGPPKELFQ            E N      +  +YEE
Sbjct: 172 GKIERIAIFPSEFGKQRMEREELEGPPKELFQKKKKKNSKKSNAEFNDDSDVDINDLYEE 231

Query: 242 GDAE-DYDSKAXXXXXXXXXXXXXAVVYCSDIRTAESIYQNCDGTEYESTANVFDLRYVP 300
           GD + + DSK+             AVV+C++I TAE+IY NCDGTEYESTANVFDLRYVP
Sbjct: 232 GDVDKEVDSKSLRQYQLDRLRYYYAVVFCNNISTAEAIYNNCDGTEYESTANVFDLRYVP 291

Query: 301 DGMEMDDDPRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAFTQKEIE 360
           DGM+ +D P DECT LPKNY P  F+TDALQHS VKLTWDETPADRVEI+KRAFTQKEI+
Sbjct: 292 DGMDFEDQPYDECTELPKNYTPLNFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEID 351

Query: 361 EMDFKAYLAXXXXXXXXXXXXQVKNKLKALVMDSVKVGQKSLFDQKEDEDDNEADMEITF 420
           EMDFKAYLA            +VKNKLK+LV  S+K+G KS+ D K D +D E DMEITF
Sbjct: 352 EMDFKAYLA-SDSEESEGENEEVKNKLKSLVGLSMKIGDKSIMDNKSDNEDGEVDMEITF 410

Query: 421 TPGL 424
           TPGL
Sbjct: 411 TPGL 414

 Score =  113 bits (282), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 79/129 (61%), Gaps = 3/129 (2%)

Query: 486 DDKKKGELELLMLDENE--GESTINNKAHFNMNEILXXXXXXXXXXXXXXXXXIVDDEFT 543
           D   K ELELLM+DE+E  G STIN KAHFNM EIL                 IV+D F 
Sbjct: 481 DKNAKAELELLMMDEDEINGTSTINKKAHFNMKEILRSEKEKTKKSKFQNKEKIVEDNFK 540

Query: 544 PDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTVXXXXXXXXXXXNHEIANTE 603
            D+NDPRF E+FEDHDFAIDPTQ E+K+T AM++ILKER+              +I+ ++
Sbjct: 541 ADLNDPRFNEMFEDHDFAIDPTQSEYKETAAMKEILKERSKRSTMKKANRSEKRKISPSD 600

Query: 604 HS-KDINKI 611
            S KDI+ I
Sbjct: 601 GSQKDISNI 609

>KLLA0F18887g Chr6 (1732170..1732529) [360 bp, 119 aa] {ON}
           conserved hypothetical protein
          Length = 119

 Score = 29.6 bits (65), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 390 LVMDSVKVGQKSLFD----QKEDEDDNEADMEITFTPGLDESGQQDTNDNEEESTI 441
           + MDSV     S+ D    Q+  ED+NE DME+ F    D +   D N  E ES +
Sbjct: 53  MTMDSVLSRDNSIMDLLLEQQTLEDENENDMEVVFLTKDDTNADLDWNIWEAESYV 108

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.131    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,699,038
Number of extensions: 2164415
Number of successful extensions: 8711
Number of sequences better than 10.0: 53
Number of HSP's gapped: 8779
Number of HSP's successfully gapped: 90
Length of query: 627
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 511
Effective length of database: 40,180,143
Effective search space: 20532053073
Effective search space used: 20532053073
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 69 (31.2 bits)