Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E21143g5.431ON57257228250.0
SAKL0G02464g5.431ON56357814720.0
KLTH0F16126g5.431ON55454912601e-168
YOR118W (RTC5)5.431ON56755212481e-166
Kwal_55.214375.431ON55454712321e-163
Smik_15.2965.431ON56657412181e-161
TDEL0E019405.431ON56758012181e-161
Suva_8.1715.431ON56757612171e-161
Ecym_47645.431ON56657711731e-154
Skud_15.2815.431ON56756511661e-153
NDAI0C016105.431ON58459911661e-153
NCAS0H020505.431ON57358811641e-153
ZYRO0F09966g5.431ON55458111431e-150
Kpol_1016.75.431ON56257711051e-144
TPHA0H017905.431ON56558210781e-140
KNAG0B042305.431ON57758510391e-134
AER258C5.431ON55757310081e-130
CAGL0L11616g5.431ON5555819221e-117
TBLA0A065305.431ON4923155849e-68
SAKL0G12870g5.202ON399145751.5
KAFR0C05210na 1ON149368724.3
KAFR0C052205.500ON149968724.6
ZYRO0D17710gsingletonON148668724.7
Smik_15.3335.500ON151068715.3
Kwal_27.9666singletonON147468715.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E21143g
         (572 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]...  1092   0.0  
SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} simila...   571   0.0  
KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]...   489   e-168
YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Prote...   485   e-166
Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {...   479   e-163
Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118...   473   e-161
TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {O...   473   e-161
Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W ...   473   e-161
Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {O...   456   e-154
Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118...   453   e-153
NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {O...   453   e-153
NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.4...   452   e-153
ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} simila...   444   e-150
Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON...   430   e-144
TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.4...   419   e-140
KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {O...   404   e-134
AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}...   392   e-130
CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa...   359   e-117
TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa] ...   229   9e-68
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    33   1.5  
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            32   4.3  
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    32   4.6  
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    32   4.7  
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    32   5.3  
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    32   5.8  

>KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 572

 Score = 1092 bits (2825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/572 (93%), Positives = 532/572 (93%)

Query: 1   MGQSTSKEHENARTNESKLKGESLMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYVEV 60
           MGQSTSKEHENARTNESKLKGESLMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYVEV
Sbjct: 1   MGQSTSKEHENARTNESKLKGESLMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYVEV 60

Query: 61  SDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEXXXXXXXXXXXXXXXXERAIKY 120
           SDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYE                ERAIKY
Sbjct: 61  SDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEKVTFKTLLKATLLLVKERAIKY 120

Query: 121 TDWKKYNDLKMLFITLSLEKNIKAEPLMDSSALSDCKDWKGVIRSYNGTDFDELKVXXXX 180
           TDWKKYNDLKMLFITLSLEKNIKAEPLMDSSALSDCKDWKGVIRSYNGTDFDELKV    
Sbjct: 121 TDWKKYNDLKMLFITLSLEKNIKAEPLMDSSALSDCKDWKGVIRSYNGTDFDELKVNANN 180

Query: 181 XXXXXXXXXXXSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCLDSSI 240
                      SRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCLDSSI
Sbjct: 181 LLHFLALILALSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCLDSSI 240

Query: 241 TYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVNESELSQLAT 300
           TYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVNESELSQLAT
Sbjct: 241 TYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVNESELSQLAT 300

Query: 301 FLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYAV 360
           FLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYAV
Sbjct: 301 FLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYAV 360

Query: 361 KNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQL 420
           KNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQL
Sbjct: 361 KNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQL 420

Query: 421 HPRQEIFDADPFKTGNVYFNTVXXXXXXXXXQPIIKANGKKYFPGNVSLTIDSSLEFGIF 480
           HPRQEIFDADPFKTGNVYFNTV         QPIIKANGKKYFPGNVSLTIDSSLEFGIF
Sbjct: 421 HPRQEIFDADPFKTGNVYFNTVGGGIGIGSSQPIIKANGKKYFPGNVSLTIDSSLEFGIF 480

Query: 481 RHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEAK 540
           RHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEAK
Sbjct: 481 RHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEAK 540

Query: 541 RRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572
           RRQKINLQSMGEDRALLEMAGLVGQHQSGGSI
Sbjct: 541 RRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572

>SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/578 (50%), Positives = 391/578 (67%), Gaps = 21/578 (3%)

Query: 1   MGQSTSKEHENARTNESKLKGES---LMDFFNDRCLKQLTTAELISFKNNIPEGKELNDY 57
           MGQ+ S       T  + L+ ES   L+ +F  R  KQ TT EL++FK+N+ +GK+ ND 
Sbjct: 1   MGQTAS---SGTGTTGNVLQFESQHDLLGYFAARATKQFTTPELVAFKSNL-KGKDQNDK 56

Query: 58  VEVSDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEXXXXXXXXXXXXXXXXERA 117
           V V ++ ++  IP  + ++  +  N   TL+NFPL+++SY+                +R 
Sbjct: 57  VSVEEMLQLLKIPLGNELLADLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRC 116

Query: 118 IKYTDWKKYNDLKMLFITLSLEKNIKAEPLMDSSALSDCKDW--KGVIRSYNGTDFDELK 175
           IKY  +K Y+ LK+++I L+L K +K  P    S+    K W  K +IR+YN  D D+L 
Sbjct: 117 IKYVGFKNYDQLKLIYIALALRKTVKELP----SSPDPAKPWDAKSIIRNYNSVDIDDLY 172

Query: 176 VXXXXXXXXXXXXXXXSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDC 235
           V               SR C +NN KI   V  +  +D+K  A+N++RTMNP+I++  D 
Sbjct: 173 VPADSMLQLLTLSLVLSRHCTVNNAKIRESVF-QHWDDYKANAMNLLRTMNPDIVNTQDT 231

Query: 236 LDSSITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVNESEL 295
           +   I++ QFS A+  V P +L PL++L+EH+LY+DRDL D      + + +K+V E  L
Sbjct: 232 VQCVISFEQFSNAIAAVFPQVLKPLEILVEHMLYLDRDLTDELNSTSMPSTSKLVTEPLL 291

Query: 296 SQLATFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDG 355
           +QL+T LPKE+V+S+ +KLYVGRESGFSMRSFQSK FKWMAP+IL + GMRI D    D 
Sbjct: 292 AQLSTMLPKELVYSKLRKLYVGRESGFSMRSFQSKAFKWMAPSILLIGGMRITD----DQ 347

Query: 356 DAYAVKNPRYRNFLQEYGKLKSEDQHL-DTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSS 414
           +    KNPRY+ FL+EY +LK +DQH+ D  S  +RKLLFAV + +PWKV+NK+LFGD  
Sbjct: 348 EYATTKNPRYKKFLEEYPRLKDKDQHIIDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLK 407

Query: 415 TKIIQLHPRQEIFDADPFKTGNVYFNTVXXXXXXXXXQPIIKANGKKYFPGNVSLTIDSS 474
           T ++QL P+QE+F A   +TGNVYFNT+         QP+IK NGKKYFPGNVSLTIDSS
Sbjct: 408 TTVVQLSPKQELFKA--VRTGNVYFNTLGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSS 465

Query: 475 LEFGIFRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQW 534
           LEF  FRH+G GG+  PG L++   EE+ +FEY+FI+QDVEVWGCGGEKEL+EQ+KQW+W
Sbjct: 466 LEFASFRHVGYGGAISPGTLMTKLEEEKTTFEYKFIVQDVEVWGCGGEKELQEQIKQWEW 525

Query: 535 EEAEAKRRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572
           EEAEAKRRQ+INLQS+GEDRALLEMAGLVGQHQSGGS+
Sbjct: 526 EEAEAKRRQRINLQSIGEDRALLEMAGLVGQHQSGGSM 563

>KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 554

 Score =  489 bits (1260), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 252/549 (45%), Positives = 357/549 (65%), Gaps = 18/549 (3%)

Query: 24  LMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYVEVSDISRMYYIPKDSAVMLSVFMNM 83
           L+ +++ + LK ++T EL+S+K NI +GK L+  +   ++ R+  +   +  +  +  N 
Sbjct: 24  LLSWYDKKALKLVSTPELVSYKGNI-DGKPLDAALNRKELMRVLRLQNANEAVEGLLFNC 82

Query: 84  FHTLANFPLLQDSYEXXXXXXXXXXXXXXXXERAIKYTDWKKYNDLKMLFITLSLEKNIK 143
             TLANFPL++D YE                 R ++Y   K+YN  K+++I+L+L K +K
Sbjct: 83  VQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLALNKAVK 142

Query: 144 AEPLMDSSALSDCKDWKGVIRSYNGTDFDELKVXXXXXXXXXXXXXXXSRCCILNNCKID 203
               + +S  +D  D   VI ++N    +EL V               S+  ++ N ++D
Sbjct: 143 EMSSLPNS--NDSLDAPKVIATFNNVAEEELVVPAETMLEFLTLMLTMSKATVIKNSRLD 200

Query: 204 NDVLAKSLEDFKHQALNIVRTMNPEIISMSDCLDSSITYTQFSMAVNDVAPNLLNPLKML 263
            ++ ++  + FK  AL+I+RTMN +I++  D L + I+YTQF   ++ V PNLL PL+ L
Sbjct: 201 VNI-SEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNLLVPLECL 259

Query: 264 MEHVLYMDRDLVDADVLQPISNPTKIVNESELSQLATFLPKEIVFSRFQKLYVGRESGFS 323
           MEHVL+++RDLVD +  +P+   +K+V E  L+QLAT  P+E+VFSR QKLYVGR+SGFS
Sbjct: 260 MEHVLFLNRDLVDLEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLYVGRDSGFS 319

Query: 324 MRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYAVKNPRYRNFLQEYGKLKSEDQHLD 383
           MRSFQ+K FKWMAP+IL V+G RI D+ D   +    KN RY+ FL EY +LK EDQH+ 
Sbjct: 320 MRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKN----KNQRYKKFLDEYPRLKDEDQHIL 375

Query: 384 TLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQLHPRQEIFDADPFKTGNVYFNTVX 443
                KRKLLFA+ I +PWKV+N +LFGD  T I+QL P QE++ A   K GNVYFNT+ 
Sbjct: 376 PALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKAS--KPGNVYFNTLG 433

Query: 444 XXXXXXXXQPIIKANGKKYFPGNVSLTIDSSLEFGIFRHLGAGGSFKPGRLISGRGEERN 503
                   QPIIK++G K+ PGNVSLTID +LEF  FR++G GGS  P    +       
Sbjct: 434 GGIGIGSPQPIIKSSGVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPSNTPTS------ 487

Query: 504 SFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEAKRRQKINLQSMGEDRALLEMAGLV 563
             E++F+IQD+E WGCGGEKELEEQ+K W+WEEAEA+RRQ+INL+S+ +DRALLE+AGLV
Sbjct: 488 --EHKFLIQDIETWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSVNDDRALLELAGLV 545

Query: 564 GQHQSGGSI 572
           GQ+QSGGS+
Sbjct: 546 GQNQSGGSV 554

>YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Protein
           of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; null
           mutation suppresses cdc13-1 temperature sensitivity
          Length = 567

 Score =  485 bits (1248), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 256/552 (46%), Positives = 348/552 (63%), Gaps = 14/552 (2%)

Query: 24  LMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYVEVSDISRMYYIPKDSAVMLSVFMNM 83
           ++ +FN++  +Q+T  EL+SFK N+ + ++LN  +    +    Y P++ A+++ +  NM
Sbjct: 27  ILAYFNNKAQQQVTIPELVSFKGNL-QIEDLNTPISHKALCNSLYFPQNHAMIVGIVTNM 85

Query: 84  FHTLANFPLLQDSYEXXXXXXXXXXXXXXXXERAIKYTDWKKYNDLKMLFITLSLEKNIK 143
              L+NFPL++ SYE                 R  K+   K Y+ LK+LFI+LSL+K  K
Sbjct: 86  LRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISLSLQKTDK 145

Query: 144 AEPLMDSSALSDCKDW--KGVIRSYNGTDFDELKVXXXXXXXXXXXXXXXSRCCILNNCK 201
            E L + S     K+   K +I  ++  D + L +               +  C   N K
Sbjct: 146 EE-LSEESENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVDCPTTNSK 204

Query: 202 IDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCLDSSITYTQFSMAVNDVAPNLLNPLK 261
           +DN        +FK  ALN++RTMNP+++   D    SIT+ QFS A+  V PNLL PL+
Sbjct: 205 LDNTETHDQWGNFKVSALNLLRTMNPDVVG--DIESHSITFQQFSTAIRTVMPNLLKPLE 262

Query: 262 MLMEHVLYMDRDLVDADVLQPISNPTKIVNESELSQLATFLPKEIVFSRFQKLYVGRESG 321
            LMEH  Y+  DLVD D        +K++  + L+QL+T LPKE+   + Q LY+GR+SG
Sbjct: 263 NLMEHFFYLQHDLVDHDTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLYIGRKSG 322

Query: 322 FSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYAV-KNPRYRNFLQEYGKLKSEDQ 380
           FSMRS Q+KVFKWMAP+IL V GMRI + ++     YA  KNPRYR+FL+E+ KLK  DQ
Sbjct: 323 FSMRSLQAKVFKWMAPSILVVSGMRITNSEE-----YAAEKNPRYRHFLEEFPKLKESDQ 377

Query: 381 HLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQLHPRQEIFDADPFKTGNVYFN 440
            +D     KRK  FAV I DPWKV+NKD FGD +T+II++ PRQ+I+  +  + G +YFN
Sbjct: 378 MMDASHLNKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVN--QKGTIYFN 435

Query: 441 TVXXXXXXXXXQPIIKANGKKYFPGNVSLTIDSSLEFGIFRHLGAGGSFKPGRLISGRGE 500
           T+         QP+IK   K+Y PGNVSLT DS+LEF +FR+ G GGS  PG L   R E
Sbjct: 436 TIGGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKE 495

Query: 501 ERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEAKRRQKINLQSMGEDRALLEMA 560
           E + +E  F+IQDVEVWGCGGEKELEEQ+KQ +WEEAE+KRRQ+INL+S+GEDRALLEMA
Sbjct: 496 ENSPYELHFLIQDVEVWGCGGEKELEEQIKQLEWEEAESKRRQQINLRSLGEDRALLEMA 555

Query: 561 GLVGQHQSGGSI 572
           GLVGQHQ GGS+
Sbjct: 556 GLVGQHQGGGSM 567

>Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {ON}
           YOR118W - Hypothetical ORF [contig 130] FULL
          Length = 554

 Score =  479 bits (1232), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 255/547 (46%), Positives = 350/547 (63%), Gaps = 20/547 (3%)

Query: 27  FFNDRCLKQLTTAELISFKNNIPEGKELNDYVEVSDISRMYYIPKDSAVMLSVFMNMFHT 86
           +F+ + +K LT+ EL+SFK NI  GK+L+D V   ++ ++  +   +  + S+  N   T
Sbjct: 27  WFDKKAIKSLTSPELVSFKANI-NGKDLSDVVTSDELLKVLRLDGVNETVSSLIFNCVQT 85

Query: 87  LANFPLLQDSYEXXXXXXXXXXXXXXXXERAIKYTDWKKYNDLKMLFITLSLEKNIKAEP 146
           L+NFP ++D YE                 R + Y   K+Y+  K+++I+L+L K +K   
Sbjct: 86  LSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLALNKTVKE-- 143

Query: 147 LMDSSALSDCKDWKGVIRSYNGTDFDELKVXXXXXXXXXXXXXXXSRCCILNNCKIDNDV 206
           +  SS   +  D   +I ++N    +EL V               S+  I+ N K+D +V
Sbjct: 144 VSSSSNSQESLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTIIKNSKLDPNV 203

Query: 207 LAKSLEDFKHQALNIVRTMNPEIISMSDCLDSSITYTQFSMAVNDVAPNLLNPLKMLMEH 266
            ++  E F+  AL+I+RTMN  I + +D L   IT++QF   ++ V PNLL P + LMEH
Sbjct: 204 -SEGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPNLLLPFESLMEH 262

Query: 267 VLYMDRDLVDADVLQPISNPTKIVNESELSQLATFLPKEIVFSRFQKLYVGRESGFSMRS 326
           VL++ RDLVD D  QP    +K+V+E  L+QLAT  P+E+VFSR QKLYVGR+SGFSMRS
Sbjct: 263 VLFLGRDLVDIDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKLYVGRDSGFSMRS 322

Query: 327 FQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYA-VKNPRYRNFLQEYGKLKSEDQHLDTL 385
           FQ+K FKWMAP+IL + G+RI ++++     YA  KN RY+NFL+EY +LK EDQ L   
Sbjct: 323 FQAKAFKWMAPSILLIHGVRIPNDEE-----YAKSKNHRYKNFLEEYPRLKEEDQVLLPP 377

Query: 386 SKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQLHPRQEIFDADPFKTGNVYFNTVXXX 445
              K+KLLFAV +  PWKV+N +LFGD  T IIQL P QE++ A   + GN+YFNT+   
Sbjct: 378 FSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKAS--RPGNIYFNTLGGG 435

Query: 446 XXXXXXQPIIKANGKKYFPGNVSLTIDSSLEFGIFRHLGAGGSFKPGRLISGRGEERNSF 505
                 QPI+K   +KY PGNVSLTID +LEF +FR  G GGS KP   I          
Sbjct: 436 IGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN-------- 487

Query: 506 EYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEAKRRQKINLQSMGEDRALLEMAGLVGQ 565
           E++F+IQD+E WGCGGEKELEEQ+K W+WEEAEA+RRQ+INL+S+ +DRALLEMAGLVGQ
Sbjct: 488 EHKFLIQDIEAWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSINDDRALLEMAGLVGQ 547

Query: 566 HQSGGSI 572
           +QSGGSI
Sbjct: 548 NQSGGSI 554

>Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118W
           (REAL)
          Length = 566

 Score =  473 bits (1218), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 259/574 (45%), Positives = 353/574 (61%), Gaps = 24/574 (4%)

Query: 2   GQSTSKEHENARTNESKLKGESLMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYVEVS 61
           G S S++  N R          ++ +FN +  +Q+T  EL+S K N+ + + LN  +   
Sbjct: 14  GSSHSRKFANDR---------DVLTYFNTKAQRQITVPELVSLKGNL-QIENLNTPISHK 63

Query: 62  DISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEXXXXXXXXXXXXXXXXERAIKYT 121
            +    Y P++  +++ +  NM   L+NFPL+  SYE                 R  K+ 
Sbjct: 64  RLCNFLYFPQNHTIIVGIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFL 123

Query: 122 DWKKYNDLKMLFITLSLEKNIKAEPLMDS--SALSDCKDWKGVIRSYNGTDFDELKVXXX 179
             K Y+ LK+LFI+LSL+K  K E   D+  + + + K+ K +I  ++  D + L +   
Sbjct: 124 KIKSYDQLKLLFISLSLQKTDKEELSEDNENNGVKE-KNIKQIITGFDDVDTEVLYLPAD 182

Query: 180 XXXXXXXXXXXXSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCLDSS 239
                       S  C   N  I+N+   +  + FK  A+N++RTMNP++++  +     
Sbjct: 183 FMLQFLTWLLILSVECPTTNSTINNETNVQ-WDKFKIPAMNLLRTMNPDVVN--NIESHF 239

Query: 240 ITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVNESELSQLA 299
           ITY QFS A+  V PNLL PL+ LMEH LY+  DLVD D        +KI+  + L+QL+
Sbjct: 240 ITYQQFSTAIRTVMPNLLKPLENLMEHFLYLQHDLVDYDTNLSSIQDSKIMTPALLAQLS 299

Query: 300 TFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYA 359
           T LPKE+   + Q LY+GR+SGFSMRS Q+KVFKWMAP+IL V G+RI + ++     YA
Sbjct: 300 TGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEE-----YA 354

Query: 360 V-KNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKII 418
             KNPRYR+FL+E+  LK  DQ +D     K+K  FAV I DPWKV+NKD FGD +T+II
Sbjct: 355 ANKNPRYRHFLEEFPILKDSDQKMDASLMNKKKTTFAVYIDDPWKVTNKDYFGDLNTRII 414

Query: 419 QLHPRQEIFDADPFKTGNVYFNTVXXXXXXXXXQPIIKANGKKYFPGNVSLTIDSSLEFG 478
           Q+ PRQ+I+  +  K G VYFNT+         QP+IK+  K+Y PGNVSLT DS+LEF 
Sbjct: 415 QISPRQDIYKVN--KKGTVYFNTIGGGIGIGNKQPLIKSASKRYVPGNVSLTFDSTLEFA 472

Query: 479 IFRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAE 538
           +FR+ G GGS  PG L   R EE +SFE   +IQDVEVWGCGGEKELEEQ+KQ  WEEAE
Sbjct: 473 VFRNTGYGGSLDPGLLSMERKEENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAE 532

Query: 539 AKRRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572
           +KRRQ+INL+S+GEDRALLEMAGLVGQHQ GGS+
Sbjct: 533 SKRRQQINLRSLGEDRALLEMAGLVGQHQGGGSM 566

>TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {ON}
           Anc_5.431 YOR118W
          Length = 567

 Score =  473 bits (1218), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 256/580 (44%), Positives = 352/580 (60%), Gaps = 21/580 (3%)

Query: 1   MGQSTSKEHENARTNESKLKGES---LMDFFNDRCLKQLTTAELISFKNNIPEGKELNDY 57
           MGQ+ S + ++A     K +  S   LM+FF+ R +   T  EL +FK+ + EGK L D 
Sbjct: 1   MGQNASVQQDHAEIGHEKRQFTSNSELMEFFDKRAVHMFTATELAAFKSKL-EGKTLKDP 59

Query: 58  VEVSDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEXXXXXXXXXXXXXXXXERA 117
           V   +++R   IP ++ ++          L+NFPL++DS++                 + 
Sbjct: 60  VRSEELTRWLRIPCENVLLCEAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKC 119

Query: 118 IKYTDWKKYNDLKMLFITLSLEKNIKAEPLMDSS-ALSDCKDWKGVIRSYNGTDFDELKV 176
            KY   K Y+ +K+LFI LS+ K++K EP   SS +L D      ++R+YN    D+L +
Sbjct: 120 HKYVGVKNYDHMKLLFIALSMRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAI 179

Query: 177 XXXXXXXXXXXXXXXSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCL 236
                          +  C  +NC+   DV+      FK  A N++RTMN  I++  +  
Sbjct: 180 PATSLVQLLAWLLILTSYCPTSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVT--NLE 237

Query: 237 DSSITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVD--ADVLQPI--SNPTKIVNE 292
             S+ + QFS A++ V PN+   L+ +MEH+LY D DLV   ++   PI  S PT    +
Sbjct: 238 SYSVKFEQFSKAISTVMPNIFRALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPT---TQ 294

Query: 293 SELSQLATFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDD 352
           + L+QL T L  E+ F++FQ LYVGRESGFSMRS Q+KVFKWMAPT++ + G  + D++D
Sbjct: 295 AVLAQLITALSNEMTFAKFQNLYVGRESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDED 354

Query: 353 EDGDAYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGD 412
                ++ KN RYR+FL +Y KLK  DQHL  L K K K++FAV I +PWK +NKD FG 
Sbjct: 355 -----FSKKNSRYRDFLSKYPKLKDRDQHLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGG 409

Query: 413 SSTKIIQLHPRQEIFDADPFKTGNVYFNTVXXXXXXXXXQPIIKANGKKYFPGNVSLTID 472
           S T I+QL P Q++F A   +   +YFNT+         QP IK   K Y PGNVSLTID
Sbjct: 410 SGTTIVQLSPTQDVFKAASNEV--MYFNTLGGGIGIGNNQPHIKNGVKSYSPGNVSLTID 467

Query: 473 SSLEFGIFRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQW 532
           S+LEF  FRH+G GG+F PG L++    E + FE +F+IQDVEVWGCGG++ELEEQ K+W
Sbjct: 468 STLEFAAFRHVGYGGTFNPGLLLTQFNREDDPFEIKFLIQDVEVWGCGGKEELEEQYKKW 527

Query: 533 QWEEAEAKRRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572
           QWEEAEAKRRQ INL+S GEDRALLEMAGLVG  Q+GGS+
Sbjct: 528 QWEEAEAKRRQNINLRSFGEDRALLEMAGLVGHSQNGGSM 567

>Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  473 bits (1217), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 252/576 (43%), Positives = 357/576 (61%), Gaps = 13/576 (2%)

Query: 1   MGQSTS--KEHENARTNESKLKGES-LMDFFNDRCLKQLTTAELISFKNNIPEGKELNDY 57
           MGQS+S    +E   +N  K      ++ +FN +  +Q+T  EL+S K N+ + +++N  
Sbjct: 1   MGQSSSTPSSNEEKSSNLRKFTNNGDVLAYFNHKAQQQVTVPELVSLKGNL-QIEDMNTP 59

Query: 58  VEVSDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEXXXXXXXXXXXXXXXXERA 117
           +    +  + + P+   ++  +  NM   L+NFPL+  SYE                 R 
Sbjct: 60  ISHKSLCSVLHFPQKHTLLSGIVTNMLRVLSNFPLMNSSYEPITGYGLLKCILLLNKGRC 119

Query: 118 IKYTDWKKYNDLKMLFITLSLEKNIKAEPLMDSSA-LSDCKDWKGVIRSYNGTDFDELKV 176
            KY  +K Y+ LK+LFI+LSL+K  K E   ++   +   ++ K +I +++  D + L V
Sbjct: 120 GKYLKFKSYDQLKLLFISLSLQKTDKEELSEENENNVKKERNIKQIIANFDDVDSEVLYV 179

Query: 177 XXXXXXXXXXXXXXXSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCL 236
                          S  C  +N K+ N  +    + FK  A+N++RTMNP+++S ++  
Sbjct: 180 PADFMLQFLSWLLILSVECPTSNSKMGNSKIYDQWDSFKISAMNLLRTMNPDVVSNTES- 238

Query: 237 DSSITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVNESELS 296
              IT+ QFS ++  V PNLL PL+ LMEH  Y++ DLV+ D        ++I+  + L+
Sbjct: 239 -HLITFDQFSTSIRTVMPNLLKPLENLMEHFFYLENDLVNYDTSLSSVRDSRIMTPALLT 297

Query: 297 QLATFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGD 356
           QL+T LP+E+   + Q LY+GR+SGFSMRS Q+KVFKWMAP+IL V G RI + D+    
Sbjct: 298 QLSTVLPRELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILIVSGTRITNSDE---- 353

Query: 357 AYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTK 416
             A KNPRYR+FL+E+ KLK  DQ +D     K+K  FAV I DPWKV+NKD FGD +T+
Sbjct: 354 YAAQKNPRYRHFLEEFPKLKDSDQKMDASYTNKKKTTFAVYIDDPWKVTNKDYFGDMNTR 413

Query: 417 IIQLHPRQEIFDADPFKTGNVYFNTVXXXXXXXXXQPIIKANGKKYFPGNVSLTIDSSLE 476
           IIQ+ PRQ+I+  +  + G +YFNT+         QP+IK   K++ PGNVSLT DS+LE
Sbjct: 414 IIQISPRQDIYKVN--RKGTIYFNTIGGGIGIGDKQPLIKPASKRFIPGNVSLTFDSTLE 471

Query: 477 FGIFRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEE 536
           F +FRH G GGS +PG L   R EE + FE  F+IQDVEVWGCGGEKELEEQ+KQ  WEE
Sbjct: 472 FAVFRHTGYGGSLEPGSLSVERKEEDSFFELHFLIQDVEVWGCGGEKELEEQMKQMAWEE 531

Query: 537 AEAKRRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572
           AE+KRRQ+INL+S+GEDRALLEMAGLVGQ++ GGS+
Sbjct: 532 AESKRRQQINLRSLGEDRALLEMAGLVGQNRGGGSM 567

>Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {ON}
           similar to Ashbya gossypii AER258C
          Length = 566

 Score =  456 bits (1173), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 239/577 (41%), Positives = 347/577 (60%), Gaps = 16/577 (2%)

Query: 1   MGQSTSKEHENARTNESKL---KGESLMDFFNDRCLKQLTTAELISFKNNIPEGKELNDY 57
           MGQ+ S    +A + E +L     + +++FF+++ ++QL   EL++F+NNI    +L DY
Sbjct: 1   MGQNASSR--SAESVEGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDY 58

Query: 58  VEVSDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSY--EXXXXXXXXXXXXXXXXE 115
           +    + ++  +P+     + VF  M    + FPL+      +                +
Sbjct: 59  LSCEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYK 118

Query: 116 RAIKYTDWKKYNDLKMLFITLSLEKNIKAEPLMDSSALSDCKDWKGVIRSYNGTDFDELK 175
           + +KY   K Y+ + ++FI L+LE + K     +        D + ++ S+N  + + ++
Sbjct: 119 KLLKYAQCKTYDQVSLIFILLALEPHAKVSK-KELGRPPSSYDARKIMESFNDINLETIE 177

Query: 176 VXXXXXXXXXXXXXXXSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDC 235
           V               ++ CI  N ++ N  + ++ +D++ QALNI+RTMNP I+S SD 
Sbjct: 178 VSADDLLQFMTFLLVITKYCIFENVEV-NPSIYENWKDYESQALNILRTMNPCIVSYSDA 236

Query: 236 LDSSITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVNESEL 295
             + +T  QF   +  V PNLL PL + M+HVLY    LV           + ++ +  L
Sbjct: 237 AKNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLVSDSGATINDRSSTVMTDPLL 296

Query: 296 SQLATFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDG 355
           +QL T  PK I++   +KL++ ++SGFS+RSFQ+KV  WMAP+IL V GM+I D+     
Sbjct: 297 AQLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSK--- 353

Query: 356 DAYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSST 415
                KN RY++FLQEY KLK EDQ  D++   KRK+ FAV + + WKV+NK+ FG+  T
Sbjct: 354 --LLAKNQRYKSFLQEYPKLKDEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKT 411

Query: 416 KIIQLHPRQEIFDADPFKTGNVYFNTVXXXXXXXXXQPIIKANGKKYFPGNVSLTIDSSL 475
            I+QL PRQE+F A   K GN+YFNTV         QP+IK++GKKYFPGNVSLTID S 
Sbjct: 412 LILQLSPRQEVFQAS--KNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSF 469

Query: 476 EFGIFRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWE 535
           EFG+FR++G GGS  PG+L   R +   S E RFIIQDVEVWGCGG+KE E Q+KQW+WE
Sbjct: 470 EFGVFRNVGHGGSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWE 529

Query: 536 EAEAKRRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572
           EAE++RRQ INL S+GED+ALLEM GLVG HQSGGS+
Sbjct: 530 EAESERRQYINLSSIGEDKALLEMVGLVGHHQSGGSL 566

>Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  453 bits (1166), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 249/565 (44%), Positives = 338/565 (59%), Gaps = 15/565 (2%)

Query: 1   MGQSTSKEHENARTNESKLK---GESLMDFFNDRCLKQLTTAELISFKNNIPEGKELNDY 57
           MGQS+S    N   + S  K      ++ +FN++  +Q+T  EL+SFK N+ + + LN  
Sbjct: 1   MGQSSSVSSRNEEGSSSSKKFTNNRDVLSYFNNKAQQQVTIPELVSFKGNL-QIENLNTP 59

Query: 58  VEVSDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEXXXXXXXXXXXXXXXXERA 117
           +    +  + + P +  +++ +  NM   L+NFPL+  SYE                 R 
Sbjct: 60  ISHKPLFNVLHFPPNHTIVVGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRC 119

Query: 118 IKYTDWKKYNDLKMLFITLSLEKNIKAEPLMDSSALSDC-KDWKGVIRSYNGTDFDELKV 176
            K+   K Y+ LK+LFI+LSL+K  K E   ++    +  +  K +I  ++  D + L +
Sbjct: 120 EKFLKIKSYDQLKLLFISLSLQKTDKEELSEENEENINRERHVKQIITDFDDVDTEMLCL 179

Query: 177 XXXXXXXXXXXXXXXSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCL 236
                          S      N K DND   +  + FK  A+N++RTMNP+++S  +  
Sbjct: 180 PADFMLQFLSWLLILSVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVS--NVE 237

Query: 237 DSSITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVNESELS 296
              IT+ QFS A+  V PNL  PL+ LMEH  Y+D DLV  D        ++I+  + L+
Sbjct: 238 SHFITFEQFSTAIRTVMPNLFKPLENLMEHFFYLDNDLVSRDANLSSIQDSRIMTPALLA 297

Query: 297 QLATFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGD 356
           QL+T LPKE+   + Q LY+GR+SGFSMRS Q+KVFKWMAP+IL V GMRI + D+    
Sbjct: 298 QLSTGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDE---- 353

Query: 357 AYAV-KNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSST 415
            YA  KNPRYR+FL E+ KLK  DQ +D     K+K  FAV I DPWKV+NKD FGD +T
Sbjct: 354 -YAAEKNPRYRHFLDEFPKLKDSDQKMDASHLSKKKTTFAVYIDDPWKVTNKDYFGDLNT 412

Query: 416 KIIQLHPRQEIFDADPFKTGNVYFNTVXXXXXXXXXQPIIKANGKKYFPGNVSLTIDSSL 475
           +IIQ+ PRQ+I+  +  + G +YFNT+         QP IKA  K+Y PGNVSLT DS+L
Sbjct: 413 RIIQISPRQDIYKVN--QKGTIYFNTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTL 470

Query: 476 EFGIFRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWE 535
           EF +FRH G GG   PG L   R EE + FE  F+IQDVEVWGCGGEKELEEQ+KQ  WE
Sbjct: 471 EFAVFRHTGYGGLLDPGLLSMERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWE 530

Query: 536 EAEAKRRQKINLQSMGEDRALLEMA 560
           EAE+KRRQ+IN +S+GEDRALLEMA
Sbjct: 531 EAESKRRQQINFRSLGEDRALLEMA 555

>NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {ON}
           Anc_5.431 YOR118W
          Length = 584

 Score =  453 bits (1166), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 254/599 (42%), Positives = 366/599 (61%), Gaps = 42/599 (7%)

Query: 1   MGQS-TSKEHENART-NESKLK-GESL--MDFFNDRCLKQLTTAELISFKNNIPEGKELN 55
           MGQ  +S E  N +T NE +++ G +L    +F  R +   T  ELIS+KN +     L+
Sbjct: 1   MGQHISSAEKPNTKTHNEKEIQFGNALEVQKYFQKRTIGHFTPLELISYKNKL-NHDHLD 59

Query: 56  DYVEVSDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEXXXXXXXXXXXXXXXXE 115
           D +   +I ++ ++P D+ ++ ++  NM H+L NFP L +                   +
Sbjct: 60  DMITKEEIIQLLHLPDDNVILSNMIFNMVHSLCNFPFLGERIWDITAGNLLTCIILLDND 119

Query: 116 RAIKYTDWKKYNDLKMLFITLSLEKNI---------------KAEPLMDSSALSD--CKD 158
           R  ++   K Y+ +K+LFI L L  N                K+E +  +S  S     +
Sbjct: 120 RCQRFIGSKSYDQIKLLFILLCLSTNNSSGKPLSASNSKLREKSENISTTSIYSQEIGYN 179

Query: 159 WKGVIRSYNGTDFDELKVXXXXXXXXXXXXXXXSRCCILNNCKI-DNDVLAKSLEDFKHQ 217
              +++SYNG   D+L V               S  C   NCKI  N+ +  S  +++  
Sbjct: 180 LTDILQSYNGISIDDLSVPALSLSECFTWTLIMSIKCPTANCKILPNETIYNSWNEYQKA 239

Query: 218 ALNIVRTMNPEIISMSDCLDSSITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDA 277
           +LNI+R+M+  I+S  D  D  I++TQF      V PN  +PL+ +M H+LYMD+DL++ 
Sbjct: 240 SLNILRSMDSSIVSNLD--DYRISFTQFENVFTSVVPNFTHPLENIMNHLLYMDKDLINH 297

Query: 278 DVLQ-PISNPTKIVNESELSQLATFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMA 336
            V++ P S   K+++ES L+QL+T LPKE+  S+ QKLY+GR+SGFSMRS QSK FKW+A
Sbjct: 298 PVMEIPKS---KLMSESLLAQLSTTLPKELFISKLQKLYIGRQSGFSMRSLQSKCFKWLA 354

Query: 337 PTILFVEGMRIRDEDDEDGDAYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAV 396
           PTIL V G+ I ++++ +       NPR++ FLQE+ KL   +Q L+     K+K+ FAV
Sbjct: 355 PTILLVSGLIIPNDEEYN-------NPRFKRFLQEFPKLNDNEQSLEPCHSYKKKISFAV 407

Query: 397 CIRDPWKVSNKDLFGDSSTKIIQLHPRQEIFDADPFKTGN-VYFNTVXXXXXXXXXQPII 455
            I +PW+V+NK+ FGD +++II+L PRQ+IF +   K+   +YFNT+         QP +
Sbjct: 408 YIDEPWRVTNKEFFGDLNSRIIELSPRQDIFKS--LKSHELIYFNTIGCGIGIGDKQPHV 465

Query: 456 K--ANGKKYFPGNVSLTIDSSLEFGIFRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQD 513
              AN +KY PGNVSLT++S+LEF +FRH+G GG+F P  L++ RG E  SFE +FIIQD
Sbjct: 466 SNGANSRKYQPGNVSLTLESTLEFAVFRHVGHGGAFSPSELLTKRGTEEESFEIKFIIQD 525

Query: 514 VEVWGCGGEKELEEQVKQWQWEEAEAKRRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572
           VEVWGCGGEKELEEQ+KQ  WEEAEAKRRQ++NL+S+ EDRALLEM GLVGQHQSGGS+
Sbjct: 526 VEVWGCGGEKELEEQMKQLAWEEAEAKRRQQVNLKSISEDRALLEMVGLVGQHQSGGSM 584

>NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.431
           YOR118W
          Length = 573

 Score =  452 bits (1164), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 253/588 (43%), Positives = 355/588 (60%), Gaps = 31/588 (5%)

Query: 1   MGQS-TSKEHENARTNES--KLKG------ESLMDFFNDRCLKQLTTAELISFKNNIPEG 51
           MGQ+ +S ++E +   E   + KG      E L + F  R L   T  EL++FK  I  G
Sbjct: 1   MGQTPSSNQNEPSHLKEEGKQYKGITFNSEEELRESFKRRILCHFTPLELVAFKKKI--G 58

Query: 52  KELND------YVEVSDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEXXXXXXX 105
            E  D      Y+  ++++ + ++P+++ +++ +   +   L+NFPLL++          
Sbjct: 59  HEQTDSEAGVEYISKNELTNLLHLPRENVLLVDLTYKLIAILSNFPLLREPQTEVTEIGL 118

Query: 106 XXXXXXXXXERAIKYTDWKKYNDLKMLFITLSLEKNIKAEPLMDSSALSDCKDWKGVIRS 165
                    ER  ++     Y+ L ++FI +SL+   K  P   +    + ++   ++R+
Sbjct: 119 LMCIILLSKERCHRFIGSNTYDQLGLIFIAMSLDYADKLLPYARTPKKLNVEE---LLRT 175

Query: 166 YNGTDFDELKVXXXXXXXXXXXXXXXSRCCILNNCKIDN-DVLAKSLEDFKHQALNIVRT 224
           ++    DEL++                  C  +NC++   +   ++   ++  A NI+R+
Sbjct: 176 FDNIPIDELEIPAPVLLQFLSWGLLLLIKCPTSNCQLKPINEFYQNWSSYEKAAKNIIRS 235

Query: 225 MNPEIISMSDCLDSSITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPIS 284
           M+  II   +  D  I YTQFS     V PN   PL+ LM H+LYMD DL+D + + P++
Sbjct: 236 MDQSIIR--NLTDVRINYTQFSDVFKAVLPNFTTPLESLMGHLLYMDSDLIDHETM-PMN 292

Query: 285 NPTKIVNESELSQLATFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEG 344
           N +K+++E  L+QLAT LPKE+  S+ QKLYVGRESGFSMRS QSK F W AP+IL V G
Sbjct: 293 N-SKLMSEPLLAQLATVLPKELFLSKLQKLYVGRESGFSMRSLQSKCFNWEAPSILLVSG 351

Query: 345 MRIRDEDDEDGDAYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKV 404
           M I D    D      KNPRY  FL++Y KLK E QHLD    +++K  FAV I DPW+V
Sbjct: 352 MLISD----DLQYAKEKNPRYGKFLEQYPKLKEEQQHLDACHSQRKKATFAVYIDDPWRV 407

Query: 405 SNKDLFGDSSTKIIQLHPRQEIFDADPFKTGNVYFNTVXXXXXXXXXQPIIKANGKKYFP 464
           +NK+ FG  ++ IIQL PRQ++F A   K   +YFNTV         QP+I    KKY P
Sbjct: 408 TNKEFFGSMNSMIIQLAPRQDVFHAS--KPNMIYFNTVGGGIGFGNKQPLISNAHKKYIP 465

Query: 465 GNVSLTIDSSLEFGIFRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKE 524
           GNVSLTIDS+LEF +FRH+G GG+FKP  L++ RG+E  SFE +FIIQDVEVWGCGGEKE
Sbjct: 466 GNVSLTIDSTLEFAVFRHIGYGGAFKPSALLTKRGKEDESFEIKFIIQDVEVWGCGGEKE 525

Query: 525 LEEQVKQWQWEEAEAKRRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572
           L+EQ+K+ +WEEAEAKRRQ INL+S+GEDRALLEMAGLVGQ QSGGS+
Sbjct: 526 LQEQIKKLEWEEAEAKRRQHINLKSLGEDRALLEMAGLVGQSQSGGSM 573

>ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 554

 Score =  444 bits (1143), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 238/581 (40%), Positives = 351/581 (60%), Gaps = 36/581 (6%)

Query: 1   MGQSTSKEHENARTNESKLKGESLMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYVEV 60
           MGQ TS+    + T+ +      ++  FNDR LKQ T  EL+SFKN +  GK+LN+ +  
Sbjct: 1   MGQRTSQATLQSSTHFTS--NSDILKSFNDRALKQFTVTELVSFKNKL--GKDLNERLTN 56

Query: 61  SDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEXXXXXXXXXXXXXXXXERAIKY 120
            ++++   +P+D  ++  +  N    L NFPL+++SYE                ER  KY
Sbjct: 57  EELTKWLSVPQDEILLRELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKY 116

Query: 121 TDWKKYNDLKMLFITLSLEKNIKAEP-LMDSSALSDCKDWKGVIRSYNGTDFDELKVXXX 179
              + Y+ LK+ FI LS+ K +K +P L  SS+  +  D   ++++++G   +EL V   
Sbjct: 117 VKSRNYDQLKLWFIALSIRKTVKEDPNLSSSSSSEESFDVTRILKTFDGLHVNELSVPFA 176

Query: 180 XXXXXXXXXXXXSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCLDSS 239
                       +  C +NNCK++N  +  +   +   A  I+R+M P    M +   S 
Sbjct: 177 YMVPFISWLLILTTYCPINNCKLENVAMFDNWNSYIKSAHTILRSMRP----MDES--SW 230

Query: 240 ITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISN------PTKIVNES 293
           I Y  F+  +  +AP++ +PL  +MEH+L+ D +LVD     P+S        +K++N +
Sbjct: 231 IEYEPFAHTMRSIAPHIFDPLTRVMEHLLFKDDELVD-----PLSENRGEIASSKLLNSA 285

Query: 294 ELSQLATFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDE 353
            L+Q+++ L K++     Q+LY+GR+ GFSMRSFQ+KVFKW APTI+ + G RI D+++ 
Sbjct: 286 LLAQISSALSKQLPIYHLQRLYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEE- 344

Query: 354 DGDAYAVKNPRYRNFLQEYGKLKSEDQ--HLDTLSKKKRKLLFAVCIRDPWKVSNKDLFG 411
               Y+VKN R+R FL EY KLK  D    ++ +   K K++ AV + DPWK++NK+ FG
Sbjct: 345 ----YSVKNTRFRKFLHEYPKLKPSDMDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFG 400

Query: 412 DSSTKIIQLHPRQEIFDADPFKTGNVYFNTVXXXXXXXXXQPIIKANGKKYFPGNVSLTI 471
              T I+QL P QE+F +   +   +YFNT+         QP+IK+  K Y PGNVSLT+
Sbjct: 401 GPHTTIVQLSPFQEVFGSS--RENALYFNTIGGGIGIGNKQPVIKSTAKSYSPGNVSLTM 458

Query: 472 DSSLEFGIFRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQ 531
           DS+LEF + RH G GG  KPG ++  +      FE + ++QDVEVWGCGGEKELEEQ+KQ
Sbjct: 459 DSALEFAVLRHAGQGGVLKPGLVVGDK-----DFEVKMLLQDVEVWGCGGEKELEEQLKQ 513

Query: 532 WQWEEAEAKRRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572
           W+WEE+EAKRRQ+INL+S+GEDRALLEMAGLVGQ QSGGS+
Sbjct: 514 WEWEESEAKRRQQINLRSIGEDRALLEMAGLVGQAQSGGSV 554

>Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON}
           complement(14315..16003) [1689 nt, 563 aa]
          Length = 562

 Score =  430 bits (1105), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 236/577 (40%), Positives = 346/577 (59%), Gaps = 20/577 (3%)

Query: 1   MGQSTSKEHENARTNESKL----KGESLMDFFNDRCLKQLTTAELISFKNNIPEGKELND 56
           MGQ+ S E + ++  ++++      E ++DFFN+R L  L   E+  FK+ + + K+L+D
Sbjct: 1   MGQTPSVESQESKETKNEMPELKSREDILDFFNNRSLSILLPMEIECFKSRLGD-KDLSD 59

Query: 57  YVEVSDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEXXXXXXXXXXXXXXXXER 116
            +   + + +  I   ++ +  +  N F  ++ FP L +  E                ER
Sbjct: 60  PLTKDEFNTLLRIADSNSQLQILLWNFFLKISAFPFLSNRSESMTGFGILKGIILLTRER 119

Query: 117 AIKYTDWKKYNDLKMLFITLSLEKNIKAEPLMDSSALSDCKDWKGVIRSYNGTDFDELKV 176
             KY  W     +K++FI L+ ++ +  +   ++S        + V+ + +G D     V
Sbjct: 120 IKKYLGWSNAKLIKLIFIGLTSQEKVGVK--TEASVFK----IQHVLDTLDGIDLASSTV 173

Query: 177 XXXXXXXXXXXXXXXSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCL 236
                          S  C  +NCK++   L    +D++  A ++VR+MN +I +    +
Sbjct: 174 KDTDMLSFITWLLLLSVHCPTSNCKLNEKSLYDKWKDYEIVASSMVRSMNKKITTTGKGI 233

Query: 237 DSSITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVNESELS 296
              I+Y+ FS  +  V+ N+++PL+ ++EH+LY   DL++   L      TK++    ++
Sbjct: 234 --GISYSDFSHTIVAVSKNVMSPLENIVEHMLYKQDDLLEFPCLDTFLKETKLMTYPLVA 291

Query: 297 QLATFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGD 356
           QL T LP EIV S+ QKLYVGRESG+SMRS QSKVF W A TIL V G RI D    D +
Sbjct: 292 QLCTVLPNEIVMSQLQKLYVGRESGYSMRSLQSKVFNWKAATILLVSGTRIVD----DIE 347

Query: 357 AYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTK 416
               KNPRY+ FL+EY KLK EDQ +D     K+K+ FAV I +PW+V+NK+ FG+  T 
Sbjct: 348 YSENKNPRYKRFLEEYPKLKDEDQEMDDCHNLKKKVTFAVYIDEPWRVTNKNYFGEKRTS 407

Query: 417 IIQLHPRQEIFDADPFKTGNVYFNTVXXXXXXXXXQPIIKANGKKYFPGNVSLTIDSSLE 476
           II+L PRQ+ F++   K G+VYFNT+         QP+ K N  +Y PGNVSLT+D++LE
Sbjct: 408 IIELSPRQDKFNS--LKVGSVYFNTIGGGIGIGNNQPVTKLNSVRYAPGNVSLTLDNTLE 465

Query: 477 FGIFRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEE 536
           FG+FRH G GG+  P  L+    EE  +FE RF+I+DVEVWGCGGEKELEEQ+++W+WEE
Sbjct: 466 FGVFRHTGYGGTIGPSELLKKNNEENKAFEIRFLIRDVEVWGCGGEKELEEQLREWKWEE 525

Query: 537 AEAKRRQKINLQSMGEDRALLEMAGLVGQH-QSGGSI 572
           AEAKRRQ+INL++MGEDRALLEMAG++GQH QSGGSI
Sbjct: 526 AEAKRRQEINLKTMGEDRALLEMAGIIGQHGQSGGSI 562

>TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.431
           YOR118W
          Length = 565

 Score =  419 bits (1078), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 232/582 (39%), Positives = 340/582 (58%), Gaps = 27/582 (4%)

Query: 1   MGQSTS-KEHENARTNES--KLKGE-SLMDFFNDRCLKQLTTAELISFKNNIPEGKELND 56
           MGQ +S  E  +  +NES   L  E  ++D+FN R + Q +  EL+ FK+ +    E++D
Sbjct: 1   MGQGSSIPEASSGDSNESIKDLTSELEIVDYFNKRVISQFSNIELLCFKHLL----EIDD 56

Query: 57  YVEVSD---ISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEXXXXXXXXXXXXXXX 113
           Y  + D   + ++  I   S  + ++ +N    L NFP +    +               
Sbjct: 57  YSTIIDDAVVYKLLQIQDVSDRLRNLILNFIKRLTNFPFISTVADNVTAYGLLKTIVILQ 116

Query: 114 XERAIKYTDWKKYNDLKMLFITLSLEKNIKAEPLMDSSALSDCKDWK--GVIRSYNGTDF 171
            ++ IKYT+  + N LK+LFI L        +   D+  + DC +     ++ +Y+G   
Sbjct: 117 KQKFIKYTNNNQLNMLKILFIALG-----DYDREEDNKKILDCHNISISTILTTYDGIPI 171

Query: 172 DELKVXXXXXXXXXXXXXXXSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIIS 231
            ++ V               S  C  NN  +D   + K  E ++  A+++VR+MNP+II 
Sbjct: 172 HDISVSSSNMISFLTWILALSNVCPTNNSIVDTKHMFKYWEKYETSAISLVRSMNPDIIK 231

Query: 232 MSDCLDSSITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVN 291
             D  + +I + QF  A+  + P++  PL+ L+ H+L+M+  L+ +  ++     +K++ 
Sbjct: 232 PDD--NQNILFIQFKTALETIMPHVYLPLEHLLNHLLFMESSLIKSQEIEISFQESKLMT 289

Query: 292 ESELSQLATFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDED 351
            +  SQL+T L  ++V S+  KLY GRESGFSMRSFQSK FKW APTIL + GMR+ D  
Sbjct: 290 FAVASQLSTLLRNDVVISKLHKLYSGRESGFSMRSFQSKAFKWNAPTILLISGMRVTD-- 347

Query: 352 DEDGDAYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFG 411
             D +    KNPRY+ F+ +Y +L+  DQ+L+    K RK+ FAV + +PWKVSNK  FG
Sbjct: 348 --DVEYATKKNPRYKKFIDQYPRLRDLDQNLEPCHSKLRKVTFAVYVDEPWKVSNKLQFG 405

Query: 412 DSSTKIIQLHPRQEIFDADPFKTGNVYFNTVXXXXXXXXXQPIIKANGKKYFPGNVSLTI 471
              T I++L PRQ+ F A   K G +YFNTV         QP+ K N   Y PGNVSLTI
Sbjct: 406 GLKTLIVELSPRQDCFRAA--KPGVIYFNTVGGGIGIGSSQPVQKKNSLSYTPGNVSLTI 463

Query: 472 DSSLEFGIFRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQ 531
           D+SLEFG FRH G GGS +P  ++  + +   +FE RF+IQD+EVWGCGGEKE++EQ+KQ
Sbjct: 464 DNSLEFGAFRHTGYGGSIEPSSILQKKEDATRTFEIRFLIQDIEVWGCGGEKEIDEQLKQ 523

Query: 532 WQWEEAEAKRRQKINLQSMGEDRALLEMAGLVGQH-QSGGSI 572
           W WEE EAK+RQ++NL+SMGEDRALLEMAG++G H  SGGS+
Sbjct: 524 WAWEEEEAKKRQRVNLKSMGEDRALLEMAGIIGNHAHSGGSL 565

>KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {ON}
           Anc_5.431 YOR118W
          Length = 577

 Score =  404 bits (1039), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 235/585 (40%), Positives = 326/585 (55%), Gaps = 21/585 (3%)

Query: 1   MGQS-TSKEHENARTNESKLKG---ESLMDFFNDRCLKQLTTAELISFKNNIPEGKELND 56
           MGQS +S+E E  + ++ +L     E +   +NDR L+Q   +EL +FK  +   ++LND
Sbjct: 1   MGQSVSSQEPEPTQESDPQLGNGTTEEIEQEYNDRVLRQFNASELYTFKCRVGMTRQLND 60

Query: 57  YVEVSDISRMYYIPKDSAVML--SVFMNMFHTLANFPLLQDSYEXXXXXXXXXXXXXXXX 114
            V   ++     +P +  +     + + +   L  FP + ++                  
Sbjct: 61  VVLEQELLEWLCLPLEGHLQQPSKLLVGVIKVLGQFPFISNTGGNLTAVSLLKAVILINR 120

Query: 115 ERAIKYTDWKKYNDLKMLFITLSLEKNIKAEPLMDSSALSDCKDWKGVIRSYNGTD--FD 172
            + +KY   K YN L+++F+ L L ++       +S    +  + + VI SY+G      
Sbjct: 121 GKCLKYIGNKSYNHLELIFMALYLAQDSHDSTKKESYDPKEPHNIEKVISSYDGNSDCVS 180

Query: 173 ELKVXXXXXXXXXXXXXXXSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISM 232
           E+ V               S      N +ID          ++  A N++RTMN  IIS 
Sbjct: 181 EITVQADNLLQFTTMLLLLSARIPRPNSQIDLKTADNDWAKYEKSAYNVIRTMNSSIIS- 239

Query: 233 SDCLDSSITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVNE 292
             C   +I++ QF   ++ + P +L  L  L++H+LY    LVD   L P    TK++N 
Sbjct: 240 -SCQTHTISFHQFYDVISILLPTILTTLDNLLQHLLYTPDQLVDHTALGPTFTETKVMNH 298

Query: 293 SELSQLATFLP-KEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDED 351
              + L   L  K    S+ QKLYVGR+SGFSMRSFQ KVF W APT+LFV G RI+D+D
Sbjct: 299 GSFALLQFALADKGYPISKLQKLYVGRDSGFSMRSFQGKVFHWHAPTLLFVSGSRIQDDD 358

Query: 352 DEDGDAYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFG 411
           D   +    KNPRY  FL+++ KL+  DQ L     KKRK++F + I  PW+V+NKD F 
Sbjct: 359 DYSKN----KNPRYSKFLEDFRKLRDTDQQLSPCLLKKRKVMFVIYIESPWRVTNKDYFS 414

Query: 412 DSSTKIIQLHPRQEIFDADPFKTGNVYFNTVXXXXXXXXXQPIIKANGKKYFPGNVSLTI 471
              T I QL P  +IF A+  +   VYFNT+         QP  K N ++Y PGN+SLT+
Sbjct: 415 AGRTTIFQLSPELDIFKAN--RDDVVYFNTMGGGIGIGDTQPYTKVNYREYRPGNISLTL 472

Query: 472 DSSLEFGIFRHLGAGGSFKPGRLISGRGEE----RNSFEYRFIIQDVEVWGCGGEKELEE 527
           DSSLEFG FR++G GG F+PG L + R  +     NS+E RF+IQDVEVWGCGGEKEL E
Sbjct: 473 DSSLEFGAFRNVGPGGMFEPGALFTRRNGDGVVTSNSYELRFLIQDVEVWGCGGEKELSE 532

Query: 528 QVKQWQWEEAEAKRRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572
           Q+KQ QWEE EAKRRQ +NL+S+ EDRALLEMAGLVGQHQSGGSI
Sbjct: 533 QMKQLQWEETEAKRRQHVNLKSLSEDRALLEMAGLVGQHQSGGSI 577

>AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR118W
          Length = 557

 Score =  392 bits (1008), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 214/573 (37%), Positives = 321/573 (56%), Gaps = 17/573 (2%)

Query: 1   MGQ-STSKEHENARTNESKLKGESLMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYVE 59
           MGQ ++S   E   +  +    ++L+ FFN R L+QL+  E  +F  NI +  E  + ++
Sbjct: 1   MGQRASSHVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEELD 60

Query: 60  VSDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEXXXXXXXXXXXXXXXXERAIK 119
           +  ++ +Y +P D      VF      L +FPL+ D                   +RA +
Sbjct: 61  LQALATLYGVPADVPWFTEVFYTFVCRLTSFPLMNDC-SPPTYMGLLKVCLLFNKKRAAR 119

Query: 120 YTDWKKYNDLKMLFITLSLEKNIKAEPLMDSSALSDCKDWKGVIRSYNGTDFDELKVXXX 179
           YT  K Y+   ++   L+  ++   E +       D  D   +I + +GT   EL+V   
Sbjct: 120 YTARKSYDVASLVLALLAPPRDACDENV-------DQFDGDKLIDTLDGTFIAELEVRPN 172

Query: 180 XXXXXXXXXXXXSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCLDSS 239
                       S+ C  +N  +   +      +     L ++R+++  I+S SD    S
Sbjct: 173 KLVRYSPFIAQISQVCNGSNEPLSRSMFPAWNRN-NQIPLALLRSLDSTIVSRSDARSRS 231

Query: 240 ITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVNESELSQLA 299
           ITY QF+  +  V PN+ + L + +E + Y+ RD  +  +  P    + IV    L+QL+
Sbjct: 232 ITYQQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQLS 291

Query: 300 TFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYA 359
           T  P+  +F+  Q+L+V  ++GFSM  FQ+KVFKWMAPTILFV G RI+D++        
Sbjct: 292 TLYPRINLFTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDDE-----IVC 346

Query: 360 VKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQ 419
            KN RY+ FLQ+Y  LK  +Q L    +KKR L++A+ +RDPWK++NKDLFGD  T IIQ
Sbjct: 347 TKNKRYKAFLQDYPALKDAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDTTIIQ 406

Query: 420 LHPRQEIFDADPFKTGNVYFNTVXXXXXXXXXQPIIKANGKKYFPGNVSLTIDSSLEFGI 479
           L PRQ+IF A   +  N+YFN V         QP +K  GK+YFPGNVS T+D S+EF +
Sbjct: 407 LAPRQKIFKAQ--EAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEFAV 464

Query: 480 FRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEA 539
           FR++G GG F  G  +    E+  S+E+R +I+D+EVWG GGE+EL++Q+++WQWEEAEA
Sbjct: 465 FRNVGDGGMFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEAEA 524

Query: 540 KRRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572
            +R+ I      EDRALLEMAG+VG +QSGGS+
Sbjct: 525 TKRKYIKTNGGNEDRALLEMAGIVGHYQSGGSV 557

>CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q12108 Saccharomyces cerevisiae
           YOR118w
          Length = 555

 Score =  359 bits (922), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 219/581 (37%), Positives = 326/581 (56%), Gaps = 35/581 (6%)

Query: 1   MGQSTSKEHEN--ARTNESKLKGESLMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYV 58
           MGQ+ S   +N  ++++      + ++ +FN R +K  T  E+ +FK       +LN+ +
Sbjct: 1   MGQTASSPQDNKESKSHPQFKTRDEILQYFNTRVVKLFTVTEIAAFKKRF-NAIDLNEPI 59

Query: 59  EVSDISRMYYIPKDSAVMLSVFMNMFHTLANFPL----LQDSYEXXXXXXXXXXXXXXXX 114
           + + I    Y+     V  S        L NFPL    + DS                  
Sbjct: 60  DDTLIKEALYLDAQPNVW-SAVSETIRLLQNFPLFHQPIADSITGFGLLKVIAIINVKRF 118

Query: 115 ERAIKYTDWKKYNDLKMLFITLSLEKNIK-AEPLMDSSALSDCKDWKGVIRSYNGTDFDE 173
           E+ +  T   +Y+    + +TL L    K +E  + S+ L D      ++++Y+  + + 
Sbjct: 119 EKLVN-TTITRYD----ITVTLGLCGQAKESENKIKSTNLGD------ILKTYDHIEIES 167

Query: 174 LKVXXXXXXXXXXXXXXXSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMS 233
           + +                      NCK++      +  +FK  A++I  T++    ++ 
Sbjct: 168 IHIPYDKLILLVAWLLTLVTGVATTNCKVELSDTIANWNNFKSSAISIANTISTS--ALG 225

Query: 234 DCLDSSITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVD-ADVLQPISNPTKIVNE 292
           +  D  I  T    A N +  +L+  +  L EH+L+   DL+D  + L  +S+   ++  
Sbjct: 226 NANDIGIPATDILNAFNTIMISLVPYMSNLFEHLLFGVDDLIDHVNDLANLSH-QDVLTP 284

Query: 293 SELSQLATFLPKEIVFSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDD 352
           S  +Q+   LP  I  ++ QKLYVG+ESGFSMRS QSKVF+W APT++ V G RI D++ 
Sbjct: 285 SLYAQVIIGLPNSITITKLQKLYVGKESGFSMRSLQSKVFRWKAPTLMIVSGTRISDDE- 343

Query: 353 EDGDAYA-VKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFG 411
               +YA  KNPRYR+FL  + KL+  DQ+LD +   K+K+ +AV I +PWKVSNK+ FG
Sbjct: 344 ----SYADSKNPRYRSFLYSFPKLRENDQNLDAIHLTKKKVTYAVYIDEPWKVSNKEKFG 399

Query: 412 DSSTKIIQLHPRQEIFDADPFKTGNVYFNTVXXXXXXXXXQPIIKANGKKYFPGNVSLTI 471
            ++  I++L P+Q+ + +   +T  +YFNT+         QPI+K N  K+ PGN+SLT+
Sbjct: 400 ATNMTIMELTPQQKTYQSCMERT--MYFNTIGGGIGVGSEQPIVKQNDIKFIPGNISLTM 457

Query: 472 DSSLEFGIFRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQ 531
           DSSLEFG+FRH+GAGG FK   L     ++  SFE RFIIQ+VEVWGCGGEKEL EQ+KQ
Sbjct: 458 DSSLEFGVFRHVGAGGGFKTSLL---DNDDSKSFEIRFIIQNVEVWGCGGEKELAEQLKQ 514

Query: 532 WQWEEAEAKRRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572
            +WEEAEAKRRQ INLQS+ ED+ALLEM GLVGQHQSGGS+
Sbjct: 515 LEWEEAEAKRRQTINLQSLSEDKALLEMVGLVGQHQSGGSV 555

>TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa]
           {ON} Anc_5.431 YOR118W
          Length = 492

 Score =  229 bits (584), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 136/315 (43%), Positives = 185/315 (58%), Gaps = 28/315 (8%)

Query: 252 VAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVNESELSQLATFLPKEIVFSRF 311
           + PN+ + LK L+EH LY  +D +    L P       +N++ L Q+   + K  +    
Sbjct: 202 IVPNIFDCLKNLIEHSLYT-KDQLKECPLGPSQFTKTKMNQAILCQILLSMRKRSM--DI 258

Query: 312 QKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIRDEDDEDGDAYAVKNPRYRNFLQE 371
            KLY+GRE+G+SMRSFQSKVFKW APTIL + G +I ++ +     Y+ KN RY++FL  
Sbjct: 259 SKLYIGRENGYSMRSFQSKVFKWKAPTILLITGKKIINDQE-----YSEKNNRYKSFLNS 313

Query: 372 YGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVSNKDLFGDSSTKIIQLHPRQEIFDA-D 430
           Y +LK       T         FA+ I +PWK++ K  FG   TKIIQL PRQ++F   D
Sbjct: 314 YPRLKDGKTTFQT----PLHYTFAIYIEEPWKMT-KGYFGGLHTKIIQLSPRQDVFTCTD 368

Query: 431 PFKTGNVYFNTVXXXXXXXXXQPIIKANGKKYFPGNVSLTIDSSLEFGIFRHLGAGGSFK 490
           P     VYF+T               ++  KY PGNVS+TIDS+LEF +FRH G      
Sbjct: 369 P---NAVYFHTQNGIGIGNEHM----SSDNKYKPGNVSITIDSTLEFAVFRHSG------ 415

Query: 491 PGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELEEQVKQWQWEEAEAKRRQKINLQSM 550
           PG   +G    +  FE R  IQ VEVWGCGG KEL EQ  +W+WEE EA+RRQ +++  +
Sbjct: 416 PGVFKTGIIANQEIFEIRLHIQSVEVWGCGGAKELAEQKHEWEWEEREAQRRQHVSMH-V 474

Query: 551 GEDRALLEMAGLVGQ 565
            EDRALLE+AG++G+
Sbjct: 475 TEDRALLELAGIIGE 489

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 61/145 (42%), Gaps = 21/145 (14%)

Query: 270 MDRDLVDADVLQPISNPTKIVNESELSQLATFLP-KEIVFSRFQKLYVGRESGFSMRSFQ 328
           MD +++D   LQP         +S    L T LP K+ VF   + L +  +      SF 
Sbjct: 195 MDDEIIDIAALQP--------GQSHAPGLVTLLPPKDPVFEGKKCLVLDLDETLVHSSF- 245

Query: 329 SKVFKWMAPTILFVEGMRIRDEDDEDGDAYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKK 388
               K++  T  FV  + I   DD+  + Y +K P    FL+  GKL        ++S+ 
Sbjct: 246 ----KYLR-TADFVIPVEI---DDQVHNVYVIKRPGVDEFLERVGKLYEVVVFTASVSRY 297

Query: 389 KRKLLFAVCIRDPWKVSNKDLFGDS 413
              LL    I DP    +  LF DS
Sbjct: 298 GDPLL---DILDPRGAVHHRLFRDS 319

>KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON} 
          Length = 1493

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 355 GDAYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVS--NKDLFGD 412
           GD      PR  +F +  G  + +D HL T S  +  L F+  +R P +VS   KD + +
Sbjct: 913 GDVLVDGRPRDESFPRSIGYCQQQDLHLKT-STVRESLRFSAYLRQPAEVSVEEKDAYVE 971

Query: 413 SSTKIIQL 420
              KI+++
Sbjct: 972 EVIKILEM 979

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON}
           Anc_5.500 YDR406W
          Length = 1499

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 355 GDAYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVS--NKDLFGD 412
           GD      PR  +F +  G  + +D HL T S  +  L F+  +R P +VS   KD + +
Sbjct: 911 GDVLVDGRPRDESFPRSIGYCQQQDLHLKT-STVRESLRFSAYLRQPAEVSVEEKDAYVE 969

Query: 413 SSTKIIQL 420
              KI+++
Sbjct: 970 EVIKILEM 977

>ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa]
           {ON} highly similar to uniprot|P33302 Saccharomyces
           cerevisiae YOR153W PDR5 Short-lived membrane ABC (ATP-
           binding cassette) transporter actively exports various
           drugs expression regulated by Pdr1p also involved in
           steroid transport cation resistance and cellular
           detoxification during exponential growth
          Length = 1486

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 355 GDAYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVS--NKDLFGD 412
           GD +    PR  +F +  G  + +D HL T S  +  L F+  +R P  VS   KD + +
Sbjct: 904 GDVFVNGKPRDTSFPRSIGYCQQQDLHLTT-STVRESLRFSAYLRQPSTVSEQEKDDYVE 962

Query: 413 SSTKIIQL 420
              KI+++
Sbjct: 963 QVIKILEM 970

>Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR153W
           (REAL)
          Length = 1510

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 355 GDAYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKVS--NKDLFGD 412
           GD +    PR ++F +  G  + +D HL T + ++  L F+  +R P +VS   KD + +
Sbjct: 928 GDIFVDGIPRDKSFPRSIGYCQQQDLHLKTATVRE-SLRFSAYLRQPAEVSIEEKDRYVE 986

Query: 413 SSTKIIQL 420
              KI+++
Sbjct: 987 EVIKILEM 994

>Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}
           YOR153W (PDR5) - multidrug resistance transporter
           [contig 336] FULL
          Length = 1474

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 355 GDAYAVKNPRYRNFLQEYGKLKSEDQHLDTLSKKKRKLLFAVCIRDPWKV--SNKDLFGD 412
           GD     N R  +F +  G  + +D HL T + ++  L FA  +R P  V  S KD + D
Sbjct: 887 GDILINGNKRDASFARSIGYCQQQDLHLQTATVRE-SLRFAAHLRQPQSVPSSEKDKYVD 945

Query: 413 SSTKIIQL 420
              KI+++
Sbjct: 946 EVIKILEM 953

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,697,752
Number of extensions: 2546711
Number of successful extensions: 7594
Number of sequences better than 10.0: 33
Number of HSP's gapped: 7690
Number of HSP's successfully gapped: 33
Length of query: 572
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 457
Effective length of database: 40,294,809
Effective search space: 18414727713
Effective search space used: 18414727713
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)