Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KLLA0E21121g5.432ON52648021990.0
AER257W5.432ON47741716130.0
SAKL0G02486g5.432ON50042215960.0
Kpol_1062.315.432ON51341815720.0
Ecym_47635.432ON53841715570.0
YOR119C (RIO1)5.432ON48441815440.0
Suva_8.1725.432ON48641815420.0
Skud_15.2825.432ON48541815380.0
NCAS0F033605.432ON50942515380.0
KAFR0E039205.432ON49742315300.0
Smik_15.2975.432ON48641815240.0
KLTH0F16104g5.432ON54042215270.0
TPHA0E017805.432ON50841915230.0
Kwal_55.214335.432ON47642115180.0
TDEL0E019305.432ON50241115140.0
CAGL0L11594g5.432ON50742015010.0
TBLA0A037605.432ON50441914940.0
KNAG0C049305.432ON49642014920.0
NDAI0B056505.432ON46238214490.0
ZYRO0F09988g5.432ON46041113071e-177
CAGL0H08019g2.44ON4251621303e-07
TPHA0H009202.44ON4292591214e-06
Suva_14.1362.44ON4261511162e-05
NCAS0G015802.44ON4242591143e-05
Smik_14.1252.44ON4201841116e-05
Skud_14.1292.44ON4251511081e-04
KAFR0A077602.44ON4252591072e-04
NDAI0F036002.44ON4212591062e-04
KNAG0F010602.44ON4281871062e-04
ABL166W2.44ON4141431063e-04
TDEL0A008602.44ON4191361044e-04
Kpol_400.72.44ON4252591045e-04
SAKL0E13552g2.44ON419259980.002
Ecym_64492.44ON417138940.007
ZYRO0C10340g2.44ON416152930.008
KLTH0B07722g2.44ON428137920.011
KLLA0D19008g2.44ON422259910.018
TBLA0G003702.44ON444166820.21
KLLA0F15576g5.200ON51251780.65
Ecym_11191.104ON79149761.2
Skud_2.3776.161ON106985742.2
Kpol_1029.172.199ON133460732.7
YBR245C (ISW1)6.161ON112970724.1
Kwal_33.136651.144ON211929724.2
Suva_4.5056.161ON106970714.3
Kwal_27.111316.179ON90290706.9
KLTH0B03432g5.200ON50977688.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KLLA0E21121g
         (526 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} simi...   851   0.0  
AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic ...   625   0.0  
SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {...   619   0.0  
Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON} (67759....   610   0.0  
Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar...   604   0.0  
YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON} ...   599   0.0  
Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON...   598   0.0  
Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {...   597   0.0  
NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {O...   597   0.0  
KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {O...   593   0.0  
Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {...   591   0.0  
KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} simi...   592   0.0  
TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.4...   591   0.0  
Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119...   589   0.0  
TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.4...   587   0.0  
CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} hig...   582   0.0  
TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {O...   580   0.0  
KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.4...   579   0.0  
NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa] ...   562   0.0  
ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {...   508   e-177
CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly...    55   3e-07
TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {O...    51   4e-06
Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207...    49   2e-05
NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44      49   3e-05
Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207...    47   6e-05
Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207...    46   1e-04
KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa] ...    46   2e-04
NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {O...    45   2e-04
KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.4...    45   2e-04
ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homo...    45   3e-04
TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.4...    45   4e-04
Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON} ...    45   5e-04
SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]...    42   0.002
Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}...    41   0.007
ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {...    40   0.008
KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {...    40   0.011
KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]...    40   0.018
TBLA0G00370 Chr7 (72205..73539) [1335 bp, 444 aa] {ON} Anc_2.44 ...    36   0.21 
KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} simi...    35   0.65 
Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}...    34   1.2  
Skud_2.377 Chr2 complement(676769..679978) [3210 bp, 1069 aa] {O...    33   2.2  
Kpol_1029.17 s1029 (32401..36405) [4005 bp, 1334 aa] {ON} (32401...    33   2.7  
YBR245C Chr2 complement(708150..711539) [3390 bp, 1129 aa] {ON} ...    32   4.1  
Kwal_33.13665 s33 complement(339375..345734) [6360 bp, 2119 aa] ...    32   4.2  
Suva_4.505 Chr4 complement(879220..882429) [3210 bp, 1069 aa] {O...    32   4.3  
Kwal_27.11131 s27 (654646..657354) [2709 bp, 902 aa] {ON} YGL093...    32   6.9  
KLTH0B03432g Chr2 complement(277684..279213) [1530 bp, 509 aa] {...    31   8.8  

>KLLA0E21121g Chr5 (1886452..1888032) [1581 bp, 526 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 526

 Score =  851 bits (2199), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/480 (87%), Positives = 420/480 (87%)

Query: 1   MMNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDP 60
           MMNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDP
Sbjct: 1   MMNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIES 120
           RTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIES
Sbjct: 61  RTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIES 120

Query: 121 TKQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQ 180
           TKQKAL                PKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQ
Sbjct: 121 TKQKALTAESEDATSTSTATDEPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQ 180

Query: 181 HNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHP 240
           HNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHP
Sbjct: 181 HNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHP 240

Query: 241 YKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMS 300
           YKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMS
Sbjct: 241 YKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMS 300

Query: 301 LDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPL 360
           LDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPL
Sbjct: 301 LDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPL 360

Query: 361 KLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTAXX 420
           KLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTA  
Sbjct: 361 KLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTASE 420

Query: 421 XXXXXXXXXXXXXXXXXXLPNLVTDINXXXXXXXXXXXXXXXXXXXXXXXXWVSDKDTPL 480
                             LPNLVTDIN                        WVSDKDTPL
Sbjct: 421 QYELSSSDDEEDDVDGDDLPNLVTDINEDDIAGSDEDDDSDETNDSSDGDGWVSDKDTPL 480

>AER257W Chr5 (1110411..1111844) [1434 bp, 477 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR119C (RIO1)
          Length = 477

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/417 (72%), Positives = 347/417 (83%), Gaps = 42/417 (10%)

Query: 2   MNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDPR 61
           M+++D+L KL L +  +H NT+ILE++AN IKTDELSLT+GKT+KDKANRATVENVLDPR
Sbjct: 1   MDLEDQLRKLKLRDDTDHDNTRILEKFANQIKTDELSLTKGKTNKDKANRATVENVLDPR 60

Query: 62  TMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIEST 121
           TMRFL++++NRG+LS FNGCLSTGKEANVYHA +G  E             GAP+     
Sbjct: 61  TMRFLRALVNRGVLSEFNGCLSTGKEANVYHALSGATE-------------GAPE----- 102

Query: 122 KQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQH 181
                                   K EYAVKIYKTSILVFKDRERYVDGEFRFRN+RS H
Sbjct: 103 ------------------------KSEYAVKIYKTSILVFKDRERYVDGEFRFRNARSHH 138

Query: 182 NPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPY 241
           NPRKMIKIWAEKEFRNLKRIYQSGVIPCP+P+E++SNVLVMEFLNRGDGFASPRLKD+P+
Sbjct: 139 NPRKMIKIWAEKEFRNLKRIYQSGVIPCPQPVEIKSNVLVMEFLNRGDGFASPRLKDYPF 198

Query: 242 KDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMSL 301
           KDR+EI HYY++M++Y+RLLYQVC+LVHADLSEYNSIVH+ KLYIIDVSQSVQPEHPMSL
Sbjct: 199 KDRDEIYHYYHVMVSYIRLLYQVCQLVHADLSEYNSIVHQSKLYIIDVSQSVQPEHPMSL 258

Query: 302 DFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPLK 361
           DFLRMDIKN+N YF+++GIDIFPERVIFQF+ISE LDKF+GD RS++DL +YVA NLP K
Sbjct: 259 DFLRMDIKNINMYFERMGIDIFPERVIFQFVISETLDKFRGDMRSAEDLRSYVAANLPRK 318

Query: 362 LTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTA 418
            T +DEAED+VFRSLHL+RNLGGLEERDFDRFTDGKFDLLKSLIA +N K S  FTA
Sbjct: 319 QTAQDEAEDQVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKSLIAQDNAKISNTFTA 375

>SAKL0G02486g Chr7 complement(206119..207621) [1503 bp, 500 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 500

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/422 (72%), Positives = 349/422 (82%), Gaps = 37/422 (8%)

Query: 2   MNIDDKLEKLNL-----ANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVEN 56
           M+++    KL+L      +RD HVN++IL++Y++ IKTDELSLTRGKT+KDKANRATVEN
Sbjct: 1   MSVEASFSKLHLRDGPDEHRD-HVNSRILDKYSHRIKTDELSLTRGKTNKDKANRATVEN 59

Query: 57  VLDPRTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQ 116
           VLDPRTMRFL+ +++RG+LS  NGCLSTGKEANVYHAFAGN                A Q
Sbjct: 60  VLDPRTMRFLRGLVSRGVLSDLNGCLSTGKEANVYHAFAGN----------------ANQ 103

Query: 117 NIESTKQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRN 176
             E  ++ +                    K+EYAVKIYKTSILVFKDRERYVDGEFRFRN
Sbjct: 104 PSEEAEKDSKDELV---------------KREYAVKIYKTSILVFKDRERYVDGEFRFRN 148

Query: 177 SRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRL 236
           SRSQHNPRKMIKIWAEKEFRNLKRI+QSGVIPCP+PIEVRSNVLVMEFLNRG+GFASPRL
Sbjct: 149 SRSQHNPRKMIKIWAEKEFRNLKRIHQSGVIPCPQPIEVRSNVLVMEFLNRGNGFASPRL 208

Query: 237 KDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPE 296
           KDHPYKDREEIK+YY+ M+AYMRLLYQVC+LVHADLSEYN+IVH D+LY+IDVSQSVQPE
Sbjct: 209 KDHPYKDREEIKYYYHTMVAYMRLLYQVCQLVHADLSEYNTIVHHDRLYMIDVSQSVQPE 268

Query: 297 HPMSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVAD 356
           HPMSLDFLRMDIKN+NSYF+K GIDIFPERVIFQFIISE LDKF+GDY +  DL  YV+ 
Sbjct: 269 HPMSLDFLRMDIKNINSYFEKTGIDIFPERVIFQFIISETLDKFQGDYHNDQDLRDYVSK 328

Query: 357 NLPLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENF 416
           NLPLK T EDEAEDEVFRSLHL+RNL GLEERDFDRFTDGKFDLLKSLIA++N+K + NF
Sbjct: 329 NLPLKSTAEDEAEDEVFRSLHLVRNLNGLEERDFDRFTDGKFDLLKSLIAHDNKKNATNF 388

Query: 417 TA 418
            A
Sbjct: 389 NA 390

>Kpol_1062.31 s1062 (67759..69300) [1542 bp, 513 aa] {ON}
           (67759..69300) [1542 nt, 514 aa]
          Length = 513

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/418 (71%), Positives = 351/418 (83%), Gaps = 6/418 (1%)

Query: 2   MNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDPR 61
           M+ D+K ++L ++  D  VNT+ILE+Y + IKTDELS T+GKT+KDKANRATVENVLDPR
Sbjct: 1   MSFDEKFDRLKISGND--VNTRILEKYGHKIKTDELSFTKGKTNKDKANRATVENVLDPR 58

Query: 62  TMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNH-EERHLLVEGHDDTIGAPQNIES 120
           TMRFLK++ NRG++SAFNGCLSTGKEANVYHAFAG+    R+  V+  D        +  
Sbjct: 59  TMRFLKALTNRGVISAFNGCLSTGKEANVYHAFAGDGTSSRNTDVKVEDLVKLTSVEVNQ 118

Query: 121 TKQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQ 180
             ++                   + +KEYA+KIYKTSILVFKDRERYVDGE+RFRNSRSQ
Sbjct: 119 DSEEDNGDNNNVADIDGSKPEGVELRKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRSQ 178

Query: 181 HNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHP 240
           HNPRKMIKIWAEKEFRNL+RI+QSGVIP PKP+EV+SNVLVMEFLNRG+GFASPRLKD+P
Sbjct: 179 HNPRKMIKIWAEKEFRNLRRIHQSGVIPAPKPVEVKSNVLVMEFLNRGNGFASPRLKDYP 238

Query: 241 YKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMS 300
           YKDR+EI  YY++++AYMRLLYQVCRLVHADLSEYN+IVH+ KLY+IDVSQSV+PEHPMS
Sbjct: 239 YKDRDEIFWYYHILVAYMRLLYQVCRLVHADLSEYNTIVHQGKLYMIDVSQSVEPEHPMS 298

Query: 301 LDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPL 360
           LDFLRMDIKNVN YF+K+GIDIFPER+IFQF+ISE L+ FKGD  S+DDL  +V +NLP+
Sbjct: 299 LDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISEKLETFKGDLNSADDLREFVKNNLPI 358

Query: 361 KLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTA 418
           K TDEDEAEDEVFRSLHL+RNLGGLEERDFDRFTDGKFDLLK+LIA++N+K   NFTA
Sbjct: 359 KSTDEDEAEDEVFRSLHLVRNLGGLEERDFDRFTDGKFDLLKTLIASDNQK---NFTA 413

>Ecym_4763 Chr4 (1483168..1484784) [1617 bp, 538 aa] {ON} similar to
           Ashbya gossypii AER257W
          Length = 538

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/417 (70%), Positives = 349/417 (83%), Gaps = 23/417 (5%)

Query: 2   MNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDPR 61
           M++++KL +L L +  EH N++IL+++AN IKTDELS+TRGKTSKDKANRATVENVLDPR
Sbjct: 33  MDLENKLGRLKLLDHSEHENSRILDKFANQIKTDELSVTRGKTSKDKANRATVENVLDPR 92

Query: 62  TMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIEST 121
           TMRFL+S+++RGI++ FNGCLSTGKEANVYHAF GN  +   +VE     I         
Sbjct: 93  TMRFLRSLIHRGIITEFNGCLSTGKEANVYHAF-GNAVD---IVEKQHKVI--------- 139

Query: 122 KQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQH 181
           +Q ++                   K EYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQH
Sbjct: 140 RQSSICSDSEGDT----------KKVEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQH 189

Query: 182 NPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPY 241
           NPRKMIKIWAEKEFRNLKRIY +GVI CPKPIE++SNVLVMEFLNRGDGFASP+LKD+PY
Sbjct: 190 NPRKMIKIWAEKEFRNLKRIYHTGVISCPKPIEIKSNVLVMEFLNRGDGFASPKLKDYPY 249

Query: 242 KDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMSL 301
            DR+EI ++Y++M+AY+RLLYQVC+LVHADLSEYNSIVHE KLYIIDVSQSVQPEHPMSL
Sbjct: 250 SDRQEIYYFYHVMVAYIRLLYQVCQLVHADLSEYNSIVHESKLYIIDVSQSVQPEHPMSL 309

Query: 302 DFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPLK 361
           DFLRMDIKN+N+YF K+GI++F ER IFQF+ISE L+KFKGDYRS D L+ Y ++ LPLK
Sbjct: 310 DFLRMDIKNINAYFVKIGINVFSERAIFQFVISEKLEKFKGDYRSYDHLQKYASEYLPLK 369

Query: 362 LTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTA 418
           LT+EDE EDE+FRSLHL+RNLGGLEE DFDRFT+GKFDLLKSL++ +N+K ++ FTA
Sbjct: 370 LTEEDEVEDEIFRSLHLVRNLGGLEEGDFDRFTNGKFDLLKSLVSQDNQKVAKTFTA 426

>YOR119C Chr15 complement(548792..550246) [1455 bp, 484 aa] {ON}
           RIO1Essential serine kinase involved in cell cycle
           progression and processing of the 20S pre-rRNA into
           mature 18S rRNA
          Length = 484

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/418 (69%), Positives = 346/418 (82%), Gaps = 31/418 (7%)

Query: 2   MNIDDKLEKLNLA-NRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDP 60
           M+++DK + L+++    +H+N Q+LE+Y++ IKTDELS +R KTSKDKANRATVENVLDP
Sbjct: 1   MSLEDKFDSLSVSQGASDHINNQLLEKYSHKIKTDELSFSRAKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIES 120
           RTMRFLKSM+ RG+++  NGCLSTGKEANVYHAFAG  +   +     D+  G  + +E+
Sbjct: 61  RTMRFLKSMVTRGVIADLNGCLSTGKEANVYHAFAGTGKAPVI-----DEETGQYEVLET 115

Query: 121 TKQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQ 180
              +A                      EYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQ
Sbjct: 116 DGSRA----------------------EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQ 153

Query: 181 HNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHP 240
           HNPRKMIKIWAEKEFRNLKRIYQSGVIP PKPIEV++NVLVMEFL+RG+GFASP+LKD+P
Sbjct: 154 HNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYP 213

Query: 241 YKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMS 300
           YK+R+EI HYY+ M+AYMRLLYQVCRLVHADLSEYN+IVH+DKLY+IDVSQSV+PEHPMS
Sbjct: 214 YKNRDEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIVHDDKLYMIDVSQSVEPEHPMS 273

Query: 301 LDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPL 360
           LDFLRMDIKNVN YF+K+GI IFPERVIFQF+ISE L+KFKGDY +   L  Y+A NLP+
Sbjct: 274 LDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISETLEKFKGDYNNISALVAYIASNLPI 333

Query: 361 KLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTA 418
           K T++DEAEDE+FRSLHL+R+LGGLEERDFDR+TDGKFDLLKSLIA++N +   NF A
Sbjct: 334 KSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNER---NFAA 388

>Suva_8.172 Chr8 complement(306553..308013) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/418 (68%), Positives = 350/418 (83%), Gaps = 31/418 (7%)

Query: 2   MNIDDKLEKLNLANR-DEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDP 60
           M+ +DK EKL ++ R  +H+N Q+L+++++ IKTDELS ++ KTSKDK+NRATVENVLDP
Sbjct: 1   MSFEDKFEKLTVSQRASDHINNQLLDKFSHKIKTDELSFSKAKTSKDKSNRATVENVLDP 60

Query: 61  RTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIES 120
           RTMRFLKSM+NRG+++  NGCLSTGKEANVYHAFAG  +   +     D+  G  + +E+
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVV-----DEETGKYEVLET 115

Query: 121 TKQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQ 180
              +A                      EYA+KIYKTSILVFKDRE+YVDGEFRFRN+RSQ
Sbjct: 116 DGLRA----------------------EYAIKIYKTSILVFKDREKYVDGEFRFRNARSQ 153

Query: 181 HNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHP 240
           HNPRKMIKIWAEKEFRNLKRI+QSGVIP PKP+EV++NVLVMEFL+RGDGFASP+LKD+P
Sbjct: 154 HNPRKMIKIWAEKEFRNLKRIHQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPKLKDYP 213

Query: 241 YKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMS 300
           YKDREEI HYY  M+AYMRLLYQVCRLVHADLSEYN+I+H+D+LY+IDVSQSV+PEHPMS
Sbjct: 214 YKDREEIFHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDQLYMIDVSQSVEPEHPMS 273

Query: 301 LDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPL 360
           LDFLRMDIKNVN YF+K+GI+IFPERVIFQF+ISEVL+KFKGDY++  DL  Y++ NLP+
Sbjct: 274 LDFLRMDIKNVNLYFEKMGINIFPERVIFQFVISEVLEKFKGDYKNVPDLIGYISKNLPI 333

Query: 361 KLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTA 418
           K T++DEAEDE+FRSLHL+R+LGGLEERDFDR+TDGKFDLLKSLIA++N +   NF A
Sbjct: 334 KSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNER---NFAA 388

>Skud_15.282 Chr15 complement(505219..506676) [1458 bp, 485 aa] {ON}
           YOR119C (REAL)
          Length = 485

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/418 (69%), Positives = 346/418 (82%), Gaps = 31/418 (7%)

Query: 2   MNIDDKLEKLNLANR-DEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDP 60
           M+++D+ ++L ++ R  +H+N Q+LE+Y++ IKTDELS ++ KTSKDKANRATVENVLDP
Sbjct: 1   MSLEDRFDRLTVSQRASDHINNQLLEKYSHKIKTDELSFSKAKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIES 120
           RTMRFLKSM+NRG+++  NGCLSTGKEANVYHAFAG              T  AP   E 
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAG--------------TGKAPVIDEE 106

Query: 121 TKQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQ 180
           T Q  +                   +KEYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQ
Sbjct: 107 TGQYEVLETDGL-------------RKEYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQ 153

Query: 181 HNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHP 240
           HNPRKMIKIWAEKEFRNLKRI+QSGVIP P+P+EV++NVLVMEFL+RG+GFASP+L+D+P
Sbjct: 154 HNPRKMIKIWAEKEFRNLKRIHQSGVIPAPRPVEVKNNVLVMEFLSRGNGFASPKLRDYP 213

Query: 241 YKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMS 300
           Y+DREEI HYY+ M+AYMRLLYQVCRLVHADLSEYN+I+H DKLY+IDVSQSV+PEHPMS
Sbjct: 214 YRDREEIFHYYHTMVAYMRLLYQVCRLVHADLSEYNTIIHNDKLYMIDVSQSVEPEHPMS 273

Query: 301 LDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPL 360
           LDFLRMDIKNVN YF+K+G+ IFPERVIFQF+ISE L+KFKGDY +  DL  Y+A NLP+
Sbjct: 274 LDFLRMDIKNVNLYFEKMGVSIFPERVIFQFVISESLEKFKGDYHNVIDLVGYIAKNLPI 333

Query: 361 KLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTA 418
           K T++DEAEDE+FRSLHL+R+LGGLEERDFDR+TDGKFDLLKSLIA++N +   NF A
Sbjct: 334 KSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNER---NFAA 388

>NCAS0F03360 Chr6 complement(679314..680843) [1530 bp, 509 aa] {ON}
           Anc_5.432 YOR119C
          Length = 509

 Score =  597 bits (1538), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/425 (68%), Positives = 350/425 (82%), Gaps = 11/425 (2%)

Query: 2   MNIDDKLEKLNLAN--RDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLD 59
           M+++DK ++LN++N  R EH N +IL++Y +  KTDE+S TR KT+KDKANRATVENVLD
Sbjct: 1   MSLEDKFDRLNISNEPRTEHANNKILDKYEHKFKTDEMSFTRSKTNKDKANRATVENVLD 60

Query: 60  PRTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHE-ERHLLVEGHDDTIGAPQNI 118
           PRTMRFLK++ +RG++S FNGCLSTGKEANVYHAFAG+ +    +++E  ++        
Sbjct: 61  PRTMRFLKALTSRGVISDFNGCLSTGKEANVYHAFAGDSKLHADVVLEAKEEEDEDEDEN 120

Query: 119 ESTKQKA-----LXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFR 173
           E  +        L                 ++KKEYAVKI+KTSILVFKDRERYVDGEFR
Sbjct: 121 EEDEDDLPIDHNLKEKLETELRPEMLTKVSQDKKEYAVKIFKTSILVFKDRERYVDGEFR 180

Query: 174 FRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFAS 233
           FRNSRSQHNPRKMIKIWAEKEFRNL+RIYQSGVIP PKPIEV++NVLVMEFL RGDGFAS
Sbjct: 181 FRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSGVIPVPKPIEVKNNVLVMEFLGRGDGFAS 240

Query: 234 PRLKDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSV 293
           PRLKDHPYKDREEI HYY+ ++AYMRL+YQ+CRLVHADLSEYN ++H+DK+YIIDVSQSV
Sbjct: 241 PRLKDHPYKDREEIFHYYHTIVAYMRLMYQICRLVHADLSEYNILIHKDKMYIIDVSQSV 300

Query: 294 QPEHPMSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETY 353
           +PEHPMSLDFLRMDIKN+N YF+K+GIDIFPERVIFQFIIS+ L+ F GDYR  +DL  Y
Sbjct: 301 EPEHPMSLDFLRMDIKNINFYFEKMGIDIFPERVIFQFIISDTLENFNGDYRDYNDLRDY 360

Query: 354 VADNLPLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYS 413
           VA NLP+K +++DEAEDE+FRSL+L+RNL GLEERDFDR+TDGKFDLLKSLIA++N K  
Sbjct: 361 VAQNLPIKKSEQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDGKFDLLKSLIAHDNEK-- 418

Query: 414 ENFTA 418
            NF+A
Sbjct: 419 -NFSA 422

>KAFR0E03920 Chr5 complement(775345..776838) [1494 bp, 497 aa] {ON}
           Anc_5.432 YOR119C
          Length = 497

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/423 (67%), Positives = 346/423 (81%), Gaps = 23/423 (5%)

Query: 2   MNIDDKLEKLNLAN---RDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVL 58
           M+I+DK + L ++      +H+N QIL++Y + IKT+E SL+RGKT+KDKANRATVENVL
Sbjct: 1   MSIEDKFDNLKISGGRGSSDHINNQILDKYGHKIKTNEFSLSRGKTNKDKANRATVENVL 60

Query: 59  DPRTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHE---ERHLLVEGHDDTIGAP 115
           DPRTM+FL+++M+RG++S+F+GCLSTGKEANVYHAFAG      +   LV+        P
Sbjct: 61  DPRTMKFLQALMSRGVISSFDGCLSTGKEANVYHAFAGTGRPAGQVPTLVQEEMSVPVDP 120

Query: 116 QNIESTKQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFR 175
             + + + K                     ++EYA+KIYKTSILVFKDRERYVDGEFRFR
Sbjct: 121 SELSAQEDK--------------DENSTDRREEYAIKIYKTSILVFKDRERYVDGEFRFR 166

Query: 176 NSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPR 235
           N+RSQHNPRKMIKIWAEKEFRNLKRIYQS VIP PKPIE+++NVLVMEFLNRGDGFASPR
Sbjct: 167 NARSQHNPRKMIKIWAEKEFRNLKRIYQSEVIPAPKPIEIKNNVLVMEFLNRGDGFASPR 226

Query: 236 LKDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQP 295
           LKDHPYKDREEI HYY+ ++AY+RLLYQVC LVHADLSEYN++VH+ +LY+IDVSQSV+P
Sbjct: 227 LKDHPYKDREEIFHYYHTLVAYIRLLYQVCHLVHADLSEYNTLVHQGRLYVIDVSQSVEP 286

Query: 296 EHPMSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVA 355
           EHPMSLDFLRMDIKNVN YF+K+GIDIFPER+IFQF+ISE LDKF GDY+SSDDL  YV 
Sbjct: 287 EHPMSLDFLRMDIKNVNFYFEKMGIDIFPERIIFQFVISETLDKFNGDYKSSDDLRDYVR 346

Query: 356 DNLPLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSEN 415
            NLP+K T +DEAEDE+FRSL+L+RNL GLEERDFDR+T+G+FDLLKSL+A++N K   N
Sbjct: 347 QNLPIKATGQDEAEDEIFRSLYLVRNLNGLEERDFDRYTEGRFDLLKSLLAHDNEK---N 403

Query: 416 FTA 418
           F A
Sbjct: 404 FAA 406

>Smik_15.297 Chr15 complement(509934..511394) [1461 bp, 486 aa] {ON}
           YOR119C (REAL)
          Length = 486

 Score =  591 bits (1524), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/418 (69%), Positives = 343/418 (82%), Gaps = 31/418 (7%)

Query: 2   MNIDDKLEKLNLANR-DEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDP 60
           M+++D  +KL ++ R  +H+N Q+LE+Y++ IKTDELS  R KTSKDKANRATVENVLDP
Sbjct: 1   MSLEDNFDKLTVSQRASDHINNQLLEKYSHKIKTDELSFNRAKTSKDKANRATVENVLDP 60

Query: 61  RTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIES 120
           RTMRFLKSM+NRG+++  NGCLSTGKEANVYHAFAG  +   +     D+  G  + +E+
Sbjct: 61  RTMRFLKSMVNRGVIADLNGCLSTGKEANVYHAFAGTGKAPVI-----DEETGKYEVLET 115

Query: 121 TKQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQ 180
              +                       EYA+KIYKTSILVFKDRERYVDGEFRFRNSRSQ
Sbjct: 116 DGPRP----------------------EYAIKIYKTSILVFKDRERYVDGEFRFRNSRSQ 153

Query: 181 HNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHP 240
           HNPRKMIKIWAEKEFRNLKRIYQSGVIP PKPIEV++NVLVMEFL+RG+GFASP+LKD+P
Sbjct: 154 HNPRKMIKIWAEKEFRNLKRIYQSGVIPAPKPIEVKNNVLVMEFLSRGNGFASPKLKDYP 213

Query: 241 YKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMS 300
           Y+DR EI HYY  M+AYMRLLYQVCRLVHADLSEYN+I+H+DKL++IDVSQSV+PEHPMS
Sbjct: 214 YRDRGEIFHYYYTMVAYMRLLYQVCRLVHADLSEYNTIIHDDKLFMIDVSQSVEPEHPMS 273

Query: 301 LDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPL 360
           LDFLRMDIKNVN YF+K+GI IFPERVIFQF+ISE L+KFK DY +  DL  Y+A NLP+
Sbjct: 274 LDFLRMDIKNVNLYFEKMGISIFPERVIFQFVISESLEKFKDDYHNVTDLVGYIAKNLPI 333

Query: 361 KLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTA 418
           K T++DEAEDE+FRSLHL+R+LGGLEERDFDR+TDGKFDLLKSLIA++N +   NF A
Sbjct: 334 KSTEQDEAEDEIFRSLHLVRSLGGLEERDFDRYTDGKFDLLKSLIAHDNER---NFAA 388

>KLTH0F16104g Chr6 (1306436..1308058) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12196 YOR119C Saccharomyces cerevisiae RIO1
           Essential protein that plays a role in cell cycle
           progression
          Length = 540

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/422 (69%), Positives = 346/422 (81%), Gaps = 37/422 (8%)

Query: 2   MNIDDKLEKLNL-----ANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVEN 56
           M+++D L KL+L     A+RD H+NTQIL+++A++IKTDELS+TR KTSKDKANRATVEN
Sbjct: 53  MSLEDGLGKLSLHEKHGADRD-HINTQILDKHAHNIKTDELSVTRAKTSKDKANRATVEN 111

Query: 57  VLDPRTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQ 116
           VLDPRTMRFL+++ +RG++S FNGCLSTGKEANVYHAFAG                GA  
Sbjct: 112 VLDPRTMRFLQALKSRGVISEFNGCLSTGKEANVYHAFAG---------------YGAKS 156

Query: 117 NIESTKQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRN 176
           + E  +QK L                   ++EYA+KIYKTSILVFKDRERYVDGEFRFRN
Sbjct: 157 SEE--EQKVLPNQG--------------ERREYAIKIYKTSILVFKDRERYVDGEFRFRN 200

Query: 177 SRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRL 236
           SRSQHNPRKMIKIWAEKEFRNLKRIYQSGV+P P+PIEV+SNVLVMEFLNRGDGFASP+L
Sbjct: 201 SRSQHNPRKMIKIWAEKEFRNLKRIYQSGVVPAPEPIEVKSNVLVMEFLNRGDGFASPKL 260

Query: 237 KDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPE 296
           KD PYKDR+E  +YY+ M+AY+RLLYQ C+LVHADLSEYN+IVH  KLY+IDVSQSVQPE
Sbjct: 261 KDFPYKDRDETLYYYHTMVAYIRLLYQCCQLVHADLSEYNTIVHNQKLYVIDVSQSVQPE 320

Query: 297 HPMSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVAD 356
           HPMSLDFLRMDIKN+NSYF+++ IDIFPER IFQF+IS+ L+KF+G+Y +++DL  YVA 
Sbjct: 321 HPMSLDFLRMDIKNINSYFERMSIDIFPERAIFQFVISDKLEKFEGEYTNAEDLRQYVAK 380

Query: 357 NLPLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENF 416
            L  K   EDEAEDEVFRSLHL+RNLGGLEERDFDRFT GKFDLLKSLIA++N+K + NF
Sbjct: 381 TLRPKSGPEDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNQKVASNF 440

Query: 417 TA 418
           TA
Sbjct: 441 TA 442

>TPHA0E01780 Chr5 (357819..359345) [1527 bp, 508 aa] {ON} Anc_5.432
           YOR119C
          Length = 508

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/419 (68%), Positives = 346/419 (82%), Gaps = 11/419 (2%)

Query: 2   MNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDPR 61
           M+++ K +KL + +  EH+N++ILE+Y + IKTDELS T+GKT+KDKANRATVENVLDPR
Sbjct: 1   MSLEGKFDKLKV-HESEHINSKILEKYGHKIKTDELSDTKGKTNKDKANRATVENVLDPR 59

Query: 62  TMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIEST 121
           TM+ LK+++NRG++  FNGCLSTGKEANVYHAFAG+ +     V+G+ + +     +E  
Sbjct: 60  TMKSLKTLINRGVIFEFNGCLSTGKEANVYHAFAGDGK-----VKGNAEVLPQISELEDV 114

Query: 122 KQKALXXXXXXXXXXXXXXXXP--KNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRS 179
             K L                   K +KEYA+KIYKTSILVFKDRERYVDGEFRFRN+RS
Sbjct: 115 LNKELIPGQIEVPTIKSEEEQTQLKQRKEYAIKIYKTSILVFKDRERYVDGEFRFRNARS 174

Query: 180 QHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDH 239
           QHNPRKMIKIWAEKEFRNL+RI+QSG+IP P+P+EV+ N+LVMEFL RGDGFASPRL+DH
Sbjct: 175 QHNPRKMIKIWAEKEFRNLRRIFQSGIIPAPEPVEVKYNILVMEFLGRGDGFASPRLRDH 234

Query: 240 PYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPM 299
            YK REEI +YY+ ++AY+RLLYQVCRLVHADLSEYN+IVH+DKLY+IDVSQSV+PEHPM
Sbjct: 235 QYKTREEIIYYYHTLVAYIRLLYQVCRLVHADLSEYNTIVHDDKLYVIDVSQSVEPEHPM 294

Query: 300 SLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLP 359
           SLDFLRMDIKNVN YF+K+GIDIFPER+IFQF+IS  LDKF GD RSS DL  Y+A  LP
Sbjct: 295 SLDFLRMDIKNVNGYFEKMGIDIFPERIIFQFVISSELDKFTGDPRSSVDLRNYIAHYLP 354

Query: 360 LKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTA 418
           +K TDEDE +DE+FRSLHL+RNL GLEERDFDRFTDGKFDLLK+LIA++N+K   NFTA
Sbjct: 355 VKCTDEDELKDEIFRSLHLVRNLDGLEERDFDRFTDGKFDLLKTLIASDNQK---NFTA 410

>Kwal_55.21433 s55 (835062..836492) [1431 bp, 476 aa] {ON} YOR119C
           (RIO1) - similar to a C.elegans ZK632.3 protein [contig
           130] FULL
          Length = 476

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/421 (67%), Positives = 341/421 (80%), Gaps = 35/421 (8%)

Query: 2   MNIDDKLEKL----NLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENV 57
           M++ D+++ L    N   +D+H+NTQIL+++A++IK DELS++RGKTSKDKANRATVENV
Sbjct: 1   MSLKDRMDNLRLRDNFEPQDDHINTQILDKHAHNIKADELSVSRGKTSKDKANRATVENV 60

Query: 58  LDPRTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQN 117
           LDPRTMRFL+++ +RG++S FNGC+STGKEANVYHAFA                IGA   
Sbjct: 61  LDPRTMRFLQALTSRGVISQFNGCVSTGKEANVYHAFA---------------EIGAKNT 105

Query: 118 IESTKQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNS 177
            E+ +                     + ++E A+KI+KTSILVFKDRERYVDGEFRFRNS
Sbjct: 106 EEAGE----------------VLPNLEERRELAIKIFKTSILVFKDRERYVDGEFRFRNS 149

Query: 178 RSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLK 237
           RSQHNPRKMIKIWAEKEFRNLKRIYQSG++P P+P+EVRSNVLVMEFL+RG+GFASPRLK
Sbjct: 150 RSQHNPRKMIKIWAEKEFRNLKRIYQSGLVPAPEPVEVRSNVLVMEFLSRGNGFASPRLK 209

Query: 238 DHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEH 297
           D+PYKDREE  HYY  M+AY+RLLYQ C+LVHADLSEYN+IVH  +LYIIDVSQSVQPEH
Sbjct: 210 DYPYKDREETAHYYYTMVAYIRLLYQCCQLVHADLSEYNAIVHNKELYIIDVSQSVQPEH 269

Query: 298 PMSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADN 357
           PMSLDFLRMDIKNVN+YF+++ +D+FPERVIFQF+ISE LDKF GDY SS DL  YV+ N
Sbjct: 270 PMSLDFLRMDIKNVNNYFERMSVDVFPERVIFQFVISETLDKFSGDYTSSVDLRDYVSKN 329

Query: 358 LPLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFT 417
           LP+K   +DEAEDEVFRSLHL+RNLGGLEERDFDRFT GKFDLLKSLIA++N + +  FT
Sbjct: 330 LPVKSGPQDEAEDEVFRSLHLVRNLGGLEERDFDRFTLGKFDLLKSLIAHDNERVASTFT 389

Query: 418 A 418
           A
Sbjct: 390 A 390

>TDEL0E01930 Chr5 (363913..365421) [1509 bp, 502 aa] {ON} Anc_5.432
           YOR119C
          Length = 502

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/411 (69%), Positives = 337/411 (81%), Gaps = 35/411 (8%)

Query: 2   MNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDPR 61
           M+++D+ ++L++++  EH N QIL++++N+IKTDELS TR K+SKDKANRATVENVLDPR
Sbjct: 1   MSLEDQFDRLDISHGREHANIQILDKHSNNIKTDELSFTRSKSSKDKANRATVENVLDPR 60

Query: 62  TMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIEST 121
           TMRFLKSMMNRG++S FNGCLSTGKEANVYHAFAG                   ++IE +
Sbjct: 61  TMRFLKSMMNRGVISEFNGCLSTGKEANVYHAFAG-------------------ESIEDS 101

Query: 122 KQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQH 181
           K   +                   KKE A+KIYKTSILVFKDRERYVDGEFRFRNSRSQH
Sbjct: 102 KDGHVQ----------------GEKKELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQH 145

Query: 182 NPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPY 241
           NPRKMIKIWAEKEFRNL+RI QSGVIP PKP+EV++NVLVMEFL+RGDGFASPRLKDH +
Sbjct: 146 NPRKMIKIWAEKEFRNLRRINQSGVIPAPKPVEVKNNVLVMEFLSRGDGFASPRLKDHLF 205

Query: 242 KDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMSL 301
            DR EI HYY+ M+AY+RLLYQVCRLVHADLSEYN+IVH+ KLYIIDVSQSV+PEHPMSL
Sbjct: 206 ADRAEIYHYYHTMLAYIRLLYQVCRLVHADLSEYNAIVHDQKLYIIDVSQSVEPEHPMSL 265

Query: 302 DFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPLK 361
           DFLRMDIKN+N+YF+K+GIDIFPER+IFQF+ISE L+KF G+ +SS DL  YV+  LP+K
Sbjct: 266 DFLRMDIKNINAYFEKMGIDIFPERLIFQFVISETLEKFDGNPKSSADLSNYVSKALPVK 325

Query: 362 LTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKY 412
            T  D  EDE+FRSLHL+RNL GLEERDFDRFTDGKFDLLKSLIA++N ++
Sbjct: 326 STTGDVEEDEIFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLIAHDNERH 376

>CAGL0L11594g Chr12 (1239169..1240692) [1524 bp, 507 aa] {ON} highly
           similar to uniprot|Q12196 Saccharomyces cerevisiae
           YOR119c
          Length = 507

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/420 (66%), Positives = 341/420 (81%), Gaps = 25/420 (5%)

Query: 1   MMNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDP 60
           M ++ DK   + ++   +H+N QI+++Y + IKTDELS+ + KT+KDKANRATVENVLDP
Sbjct: 1   MDDLSDKFRNVKVST--DHINNQIMDKYGHKIKTDELSINKAKTNKDKANRATVENVLDP 58

Query: 61  RTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDD---------T 111
           RTMRFL +++NRG+++  NGCLSTGKEANVYHAFAG+     +  E   D          
Sbjct: 59  RTMRFLNALVNRGVIAGLNGCLSTGKEANVYHAFAGSK----MATEQQSDEPKEDIDANA 114

Query: 112 IGAPQNIESTKQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGE 171
           I +  NI+ ++ +A                  + +KEYA+KIYKTSIL+FKDRERYVDGE
Sbjct: 115 IPSKGNIDISENRA----------KTAEDLIREGRKEYAIKIYKTSILIFKDRERYVDGE 164

Query: 172 FRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGF 231
           FRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQ GVIP P+PIEV++NVLVMEFLNRGDGF
Sbjct: 165 FRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQMGVIPSPEPIEVKNNVLVMEFLNRGDGF 224

Query: 232 ASPRLKDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQ 291
           ASP+L+D+PYKDREEI +YY+++++YMRLLYQVCRLVHADLSEYN+IVH++KLY+IDVSQ
Sbjct: 225 ASPKLRDYPYKDREEIYYYYHILVSYMRLLYQVCRLVHADLSEYNTIVHKEKLYMIDVSQ 284

Query: 292 SVQPEHPMSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLE 351
           SV+PEHPMSLDFLRMDIKNVN YF+K+GI+IF E+ IFQF+I++ LDKF GD  S +DL 
Sbjct: 285 SVEPEHPMSLDFLRMDIKNVNLYFEKMGIEIFQEKAIFQFVITDTLDKFDGDMNSYEDLR 344

Query: 352 TYVADNLPLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRK 411
            YVA N+P+K T EDEAEDEVFRSLHL+RNL GLEERDFDRFTDGKFDLLKSL+A +N+K
Sbjct: 345 KYVATNIPIKRTQEDEAEDEVFRSLHLVRNLEGLEERDFDRFTDGKFDLLKSLLAQDNKK 404

>TBLA0A03760 Chr1 complement(938917..940431) [1515 bp, 504 aa] {ON}
           Anc_5.432 YOR119C
          Length = 504

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/419 (68%), Positives = 340/419 (81%), Gaps = 22/419 (5%)

Query: 2   MNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRGKTSKDKANRATVENVLDPR 61
           M +DD  +KL+L+N   H N +IL+++ + IKTDE S++RGKT+KDKANRATVENVLDPR
Sbjct: 1   MVLDDDFQKLDLSN--NHDNNRILDKHGHKIKTDEFSISRGKTNKDKANRATVENVLDPR 58

Query: 62  TMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGA--PQNIE 119
           TMRFLK++ +RGI+S FNGC+STGKEANVYHAFAG             DTI    P+  +
Sbjct: 59  TMRFLKALTSRGIISDFNGCISTGKEANVYHAFAG-------------DTISPFEPKTHD 105

Query: 120 STKQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRS 179
           S +                    P  +KEYA+KIYKTSILVFKDRERYVDGE+RFRNSRS
Sbjct: 106 SFENLVNTYDPYSNPNNNDTILEP--RKEYAIKIYKTSILVFKDRERYVDGEYRFRNSRS 163

Query: 180 QHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDH 239
           QHNPRKMIKIWAEKEFRNLKRIYQS VIP PKPIEV++NVLVMEFLNRGDGFASPRLKD+
Sbjct: 164 QHNPRKMIKIWAEKEFRNLKRIYQSKVIPVPKPIEVKNNVLVMEFLNRGDGFASPRLKDY 223

Query: 240 PYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPM 299
           PYKD  +I HYY+ MI Y+RLLYQVCRLVHADLSEYN++VH++KLY+IDVSQSV+PEHPM
Sbjct: 224 PYKDHNDIVHYYHTMIVYIRLLYQVCRLVHADLSEYNTLVHKNKLYVIDVSQSVEPEHPM 283

Query: 300 SLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLP 359
           SLDFLRMDIKN+N+YF+++G+ IF ER+IFQF ISE LD F G+Y + DDL  YV +NLP
Sbjct: 284 SLDFLRMDIKNINNYFERMGVAIFAERIIFQFTISETLDNFNGNYSNEDDLRMYVKNNLP 343

Query: 360 LKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTA 418
           LK+  +D+AEDE+FRSLHL+RNLGGLEERDFDR+TDGKFDLLKSLIA++N K   NF+A
Sbjct: 344 LKVPGKDDAEDEIFRSLHLVRNLGGLEERDFDRYTDGKFDLLKSLIAHDNEK---NFSA 399

>KNAG0C04930 Chr3 (951832..953322) [1491 bp, 496 aa] {ON} Anc_5.432
           YOR119C
          Length = 496

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/420 (67%), Positives = 341/420 (81%), Gaps = 22/420 (5%)

Query: 2   MNIDDKLEKLNLAN--RDEHVNTQILERYANSIKTDELSLTR-GKTSKDKANRATVENVL 58
           M++++K EKL++ +  +D+  N ++L++YA+ IK D+ S ++  KT+KDKANRATVENVL
Sbjct: 1   MSVEEKFEKLSIDHHVKDDTANNKLLDKYAHKIKNDQFSFSKVKKTTKDKANRATVENVL 60

Query: 59  DPRTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNI 118
           DPRTMRFL+++MNRGI+S FNGCLSTGKEANVYHAFAG+   R       ++++ A    
Sbjct: 61  DPRTMRFLQALMNRGIISDFNGCLSTGKEANVYHAFAGDGVSRASGTLPDEESLLARLTQ 120

Query: 119 ESTKQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSR 178
           E    +A                    KKEYA+KI+KTSILVFKDRERYVDGEFRFRNSR
Sbjct: 121 EERAVQA----------------SVGGKKEYAIKIFKTSILVFKDRERYVDGEFRFRNSR 164

Query: 179 SQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKD 238
           SQHNPRKMIKIWAEKEFRNLKRIYQSG +P PKP+EV++NVLVMEFLNRGDGFASPRL+D
Sbjct: 165 SQHNPRKMIKIWAEKEFRNLKRIYQSGAVPVPKPVEVKNNVLVMEFLNRGDGFASPRLRD 224

Query: 239 HPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHP 298
           +PYKD + I+ YY  ++AYMRL+YQVC LVHADLSEYN +VH D+LYIIDVSQSVQPEHP
Sbjct: 225 YPYKDTDSIRQYYCTLVAYMRLMYQVCGLVHADLSEYNVLVHNDRLYIIDVSQSVQPEHP 284

Query: 299 MSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNL 358
           MSLDFLRMDIKNVN YF K+GIDIFPER+IFQF+ISE LDKF+GDY+SS DL  YV  NL
Sbjct: 285 MSLDFLRMDIKNVNLYFGKMGIDIFPERIIFQFVISESLDKFEGDYKSSKDLTEYVESNL 344

Query: 359 PLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRKYSENFTA 418
           P+K T++DE EDEVFRSL+L+RNL GLEERDFDRFT+GKFDLLKSL+A++  K   NFTA
Sbjct: 345 PVKKTEQDEMEDEVFRSLYLVRNLEGLEERDFDRFTEGKFDLLKSLLAHDMEK---NFTA 401

>NDAI0B05650 Chr2 complement(1380239..1381627) [1389 bp, 462 aa]
           {ON} Anc_5.432 YOR119C
          Length = 462

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/382 (71%), Positives = 318/382 (83%), Gaps = 11/382 (2%)

Query: 37  LSLTRGKTSKDKANRATVENVLDPRTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAG 96
           +S T+GKT+KDKANRATVENVLDPRTM+FLK++ +RG++S FNGCLSTGKEANVYHAFAG
Sbjct: 1   MSFTKGKTNKDKANRATVENVLDPRTMKFLKALTSRGVISDFNGCLSTGKEANVYHAFAG 60

Query: 97  NHEERHLLVEGHDDTIGAPQNIESTKQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKT 156
           + +        H D    P +  +  ++AL                 K+KKEYAVKI+KT
Sbjct: 61  DSK-------LHSDDTDEPHDDNNIDEEALKEKLETQINPEETRLQ-KDKKEYAVKIFKT 112

Query: 157 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVR 216
           SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNL+RIYQS VIP PKPIEV+
Sbjct: 113 SILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLRRIYQSNVIPVPKPIEVK 172

Query: 217 SNVLVMEFLNRGDGFASPRLKDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYN 276
           +NVL+MEFLNRGDGFASPRL+D+PYKDREE+ HYY++ IAYMRL+YQVCRLVHADLSEYN
Sbjct: 173 NNVLIMEFLNRGDGFASPRLRDYPYKDREEVIHYYHIAIAYMRLMYQVCRLVHADLSEYN 232

Query: 277 SIVHEDKLYIIDVSQSVQPEHPMSLDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEV 336
            ++H + +YIIDVSQSV+PEHPMSLDFLRMDIKN+N YF ++GIDIFPERVIFQFIISE 
Sbjct: 233 ILIHNNLMYIIDVSQSVEPEHPMSLDFLRMDIKNINMYFDRMGIDIFPERVIFQFIISET 292

Query: 337 LDKFKGDYRSSDDLETYVADNLPLKLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDG 396
           LDKF G+Y   +DL  YVA  LP+K T +DEAEDE+FRSL+L+RNL GLEERDFDR+TDG
Sbjct: 293 LDKFTGNYNDYNDLRDYVAKTLPIKKTAQDEAEDEIFRSLYLVRNLEGLEERDFDRYTDG 352

Query: 397 KFDLLKSLIANENRKYSENFTA 418
           KFDLLKSLIA++N K   NF+A
Sbjct: 353 KFDLLKSLIAHDNEK---NFSA 371

>ZYRO0F09988g Chr6 complement(811306..812688) [1383 bp, 460 aa] {ON}
           similar to uniprot|Q12196 YOR119C Saccharomyces
           cerevisiae RIO1 Essential protein that plays a role in
           cell cycle progression
          Length = 460

 Score =  508 bits (1307), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 249/411 (60%), Positives = 309/411 (75%), Gaps = 51/411 (12%)

Query: 2   MNIDDKLEKLNLANRDEHVNTQILERYANSIKTDELSLTRG-KTSKDKANRATVENVLDP 60
           M+++ + ++L+++   +  NT+ILE+Y N I+    +  +G KT KDK++RATVENVLDP
Sbjct: 1   MSLETEFDRLHVSKHQD--NTRILEKYENRIENGGFTSGKGNKTYKDKSDRATVENVLDP 58

Query: 61  RTMRFLKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIES 120
           RTM+FL ++ NRG++S FNGC+S+GKEANVYHAF                    P+    
Sbjct: 59  RTMKFLSALTNRGVISEFNGCISSGKEANVYHAFG-------------------PEG--- 96

Query: 121 TKQKALXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQ 180
                                     +E A+KIYKTSILVFKDRERYVDGEFRFRNSRSQ
Sbjct: 97  --------------------------QELAIKIYKTSILVFKDRERYVDGEFRFRNSRSQ 130

Query: 181 HNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHP 240
           HNPRKMIKIWAEKEFRNL+RI+ SGV+P   P+EV+SNVLVM+FLNRGDG  SPRLKD+ 
Sbjct: 131 HNPRKMIKIWAEKEFRNLRRIHSSGVVPTACPVEVKSNVLVMQFLNRGDGAPSPRLKDYQ 190

Query: 241 YKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDKLYIIDVSQSVQPEHPMS 300
           YKD  E+ HYY   IAYMRLLYQVCRLVHADLSEYN +VH++ L+IIDVSQSV+P HPMS
Sbjct: 191 YKDELEVAHYYYKAIAYMRLLYQVCRLVHADLSEYNIVVHQNALHIIDVSQSVEPYHPMS 250

Query: 301 LDFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPL 360
           LDFLRMDIKN+N+YF K+G+ +F ER+IFQFII+E L+ F+GDY+++DDL  Y+ ++LPL
Sbjct: 251 LDFLRMDIKNINAYFGKMGVSLFQERMIFQFIIAETLEGFQGDYKTADDLVEYLVEHLPL 310

Query: 361 KLTDEDEAEDEVFRSLHLIRNLGGLEERDFDRFTDGKFDLLKSLIANENRK 411
           K   E   EDE+FRSLHL+R+LGGLEERDFDRFTDGKFDLLKSLIAN+N +
Sbjct: 311 KTPTEGADEDEIFRSLHLVRSLGGLEERDFDRFTDGKFDLLKSLIANDNER 361

>CAGL0H08019g Chr8 (781773..783050) [1278 bp, 425 aa] {ON} highly
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207w
          Length = 425

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 76/162 (46%), Gaps = 20/162 (12%)

Query: 174 FRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFAS 233
            RNSR   N   + K+ A KEF  +  +Y  G I  P+      +V+VM+ +   DG+  
Sbjct: 142 LRNSRQGTNWMHLSKLAASKEFEFMSMLYAKGFI-VPQAYGCSRHVVVMDLI---DGYPM 197

Query: 234 PRLKDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDK---------L 284
            RL++H    +   K Y +LM   ++L      L+H D +E+N ++  D+          
Sbjct: 198 RRLREH----KNIPKLYSDLMTFIVKL--ANSGLIHCDFNEFNIMIKNDEAVTDEKDCGF 251

Query: 285 YIIDVSQSVQPEHPMSLDFLRMDIKNVNSYF-QKLGIDIFPE 325
            +ID  Q +  +H  +  + + D+  +  +F +KL  D  PE
Sbjct: 252 VVIDFPQCISIQHKDAEFYFKRDVDCIRRFFKKKLKYDPQPE 293

>TPHA0H00920 Chr8 complement(188834..190123) [1290 bp, 429 aa] {ON}
           Anc_2.44 YNL207W
          Length = 429

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 52/259 (20%), Positives = 103/259 (39%), Gaps = 68/259 (26%)

Query: 66  LKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIESTKQKA 125
           LKS++N+  + +  G +  GKE+++Y     N  +R L +                    
Sbjct: 85  LKSLLNKDTVYSIGGTIGVGKESDIYEGSDKNGNKRVLKIH------------------- 125

Query: 126 LXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRK 185
                                     ++ +TS    K+   Y+      R S    N   
Sbjct: 126 --------------------------RLGRTSFHTVKNNRDYL------RRSNQGTNWMN 153

Query: 186 MIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPYKDRE 245
           + K+ A KE++ +  +Y  G    P+P +   +V+VME +    G+   RL+ H    ++
Sbjct: 154 LSKLAANKEYQFMSLLYTKG-FKVPEPFDNSRHVIVMELIR---GYPMRRLRKH----KD 205

Query: 246 EIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHED-------KLYIIDVSQSVQPEHP 298
             K Y +LM   ++L      L+H D +E+N ++ ++          +ID  Q +  +H 
Sbjct: 206 IPKLYSDLMKFILQL--ANSGLIHCDFNEFNIMIKDEVEDENDCGFVVIDFPQCISIQHK 263

Query: 299 MSLDFLRMDIKNVNSYFQK 317
            +  + + D+  +  +F+K
Sbjct: 264 DADFYFKRDVDGIRRFFKK 282

>Suva_14.136 Chr14 (250349..251629) [1281 bp, 426 aa] {ON} YNL207W
           (REAL)
          Length = 426

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 71/151 (47%), Gaps = 17/151 (11%)

Query: 174 FRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFAS 233
            R S    N   + ++ A KE++ +  +Y  G    P+P +   +++VME +N   GF  
Sbjct: 142 LRKSSQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNSRHIVVMELIN---GFPM 197

Query: 234 PRLKDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHED-------KLYI 286
            RL+ H    +   K Y +LM   ++L      L+H D +E+N ++ ++          +
Sbjct: 198 RRLRKH----KNIPKLYSDLMCFIVQL--GNSGLIHCDFNEFNVMIKDELEDENDCGFVV 251

Query: 287 IDVSQSVQPEHPMSLDFLRMDIKNVNSYFQK 317
           ID  Q V  +H  +  + + D+  +  +F+K
Sbjct: 252 IDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>NCAS0G01580 Chr7 (281438..282712) [1275 bp, 424 aa] {ON} Anc_2.44
          Length = 424

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 51/259 (19%), Positives = 105/259 (40%), Gaps = 68/259 (26%)

Query: 66  LKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIESTKQKA 125
           LK+M+NR  + +  G +  GKE+++Y   A +   R + +                    
Sbjct: 85  LKTMLNRNTIYSIGGSIGVGKESDIYQVSAVDGNPRVMKIH------------------- 125

Query: 126 LXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRK 185
                                     ++ +TS    ++   Y+      RN++   N   
Sbjct: 126 --------------------------RLGRTSFHTVRNNRDYL------RNTKQGVNWMY 153

Query: 186 MIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPYKDRE 245
           + ++ A KE++ +  +Y  G    P+P +   +++VME +    G+   RL+ H    + 
Sbjct: 154 LSRLAANKEYQFMSMLYTKG-FEVPEPFDNSRHIIVMELIK---GYPMRRLRKH----KN 205

Query: 246 EIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVH---EDK----LYIIDVSQSVQPEHP 298
             K Y +LM   ++L      L+H D +E+N ++    ED+      +ID  Q +  +H 
Sbjct: 206 IPKLYSDLMNFIVKL--GNSGLIHCDFNEFNIMIKDKPEDENDCGFVVIDFPQCISIQHQ 263

Query: 299 MSLDFLRMDIKNVNSYFQK 317
            +  + + D+  +  +F+K
Sbjct: 264 DAAYYFQRDVDCIRRFFKK 282

>Smik_14.125 Chr14 (234660..235922) [1263 bp, 420 aa] {ON} YNL207W
           (REAL)
          Length = 420

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 46/184 (25%), Positives = 86/184 (46%), Gaps = 26/184 (14%)

Query: 144 KNKKEYAVKIYK---TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKR 200
           KN K   +KI++   TS    ++   Y+      RNS    N   + ++ A KE++ +  
Sbjct: 115 KNGKPRVMKIHRLGRTSFHSVRNNRDYL------RNSNQGANWMHLSRLAANKEYQFMSM 168

Query: 201 IYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPYKDREEIKHYYNLMIAYMRL 260
           +Y  G    P+P +   +++VME +   +G+   RL+ H    +   K Y +LM   + L
Sbjct: 169 LYSKG-FKVPEPFDNSRHIVVMELI---EGYPMRRLRKH----KNIPKLYSDLMCFIVEL 220

Query: 261 LYQVCRLVHADLSEYNSIVH---EDK----LYIIDVSQSVQPEHPMSLDFLRMDIKNVNS 313
                 L+H D +E+N ++    ED+      +ID  Q V  +H  +  + + D+  +  
Sbjct: 221 ANS--GLIHCDFNEFNIMIKNEVEDEKDCGFVVIDFPQCVSIQHQDADYYFQRDVDCIRR 278

Query: 314 YFQK 317
           +F+K
Sbjct: 279 FFKK 282

>Skud_14.129 Chr14 (244224..245501) [1278 bp, 425 aa] {ON} YNL207W
           (REAL)
          Length = 425

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 72/151 (47%), Gaps = 17/151 (11%)

Query: 174 FRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFAS 233
            +NS    N   + ++ A KE++ +  +Y  G    P+P +   +++VME +   +G+  
Sbjct: 142 LKNSNQGANWMHLSRLAANKEYQFMSMLYSKG-FKVPEPFDNSRHIVVMELI---EGYPM 197

Query: 234 PRLKDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVH---EDK----LYI 286
            RL+ H    +   K Y +LM   + L      L+H D +E+N +V    ED+      +
Sbjct: 198 RRLRKH----KNIPKLYSDLMCFVVELANS--GLIHCDFNEFNIMVKDKVEDEQDCGFVV 251

Query: 287 IDVSQSVQPEHPMSLDFLRMDIKNVNSYFQK 317
           ID  Q V  +H  +  + + D+  +  +F+K
Sbjct: 252 IDFPQCVSIQHQDADYYFQRDVDCIRRFFKK 282

>KAFR0A07760 Chr1 complement(1560351..1561628) [1278 bp, 425 aa]
           {ON} Anc_2.44 YNL207W
          Length = 425

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/259 (18%), Positives = 106/259 (40%), Gaps = 67/259 (25%)

Query: 66  LKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIESTKQKA 125
           LK+M+NR  + +  G +  GKE+++Y     N  E+ + +                    
Sbjct: 85  LKTMLNRETVYSVGGTIGVGKESDIYRVSDRNGTEKVMKIH------------------- 125

Query: 126 LXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRK 185
                                     ++ +TS    K++  Y+      +N+++  N   
Sbjct: 126 --------------------------RLGRTSFHTVKNKRDYIK-----KNAKNGVNWMY 154

Query: 186 MIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPYKDRE 245
           + KI A KE++ +  ++  G    P+  +   + +VME +    G+   RL+ H     +
Sbjct: 155 LSKIAAGKEYQFMTLLFAKG-FDVPEAFDCSRHCIVMELIK---GYPMRRLRKH-----K 205

Query: 246 EIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVH---EDK----LYIIDVSQSVQPEHP 298
            I   Y+ +++++  L     L+H D +E+N ++    ED+      +ID  Q +  +H 
Sbjct: 206 NIPKLYSDLMSFIVKLGN-SGLIHCDFNEFNIMIKDKVEDENDPGFVVIDFPQCISIQHN 264

Query: 299 MSLDFLRMDIKNVNSYFQK 317
            +  + + D+  +  +F+K
Sbjct: 265 DAEFYFKRDVDCIRRFFKK 283

>NDAI0F03600 Chr6 complement(860282..861547) [1266 bp, 421 aa] {ON}
           Anc_2.44 YNL207W
          Length = 421

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/259 (17%), Positives = 103/259 (39%), Gaps = 67/259 (25%)

Query: 66  LKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIESTKQKA 125
           LK+M+NR  + +  G +  GKE+++Y     N   + + +                    
Sbjct: 85  LKTMLNRDTVYSIGGSIGVGKESDIYQVSDKNGVSKVMKIH------------------- 125

Query: 126 LXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRK 185
                                     ++ +TS    ++   Y+      +N ++  N   
Sbjct: 126 --------------------------RLGRTSFHTVRNNRDYLK-----KNVKNGVNWMY 154

Query: 186 MIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPYKDRE 245
           + ++ A KE++ +  +Y  G    P+P +   ++++M  +   +G+   RL+ H      
Sbjct: 155 LSQLAANKEYQFMSMLYTKG-FEVPEPFDNSRHIIIMGLI---EGYPMRRLRKH-----N 205

Query: 246 EIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHED-------KLYIIDVSQSVQPEHP 298
            I   YN ++ ++  L     L+H D +E+N ++ ++          +ID  Q +  +HP
Sbjct: 206 NIPKLYNDLMKFIVRLAN-SGLIHCDFNEFNIMIKDEVEDENDCGFVVIDFPQCISIQHP 264

Query: 299 MSLDFLRMDIKNVNSYFQK 317
            +  + + D+  +  +F+K
Sbjct: 265 DAEFYFQRDVDCIRRFFKK 283

>KNAG0F01060 Chr6 (188811..190097) [1287 bp, 428 aa] {ON} Anc_2.44
           YNL207W
          Length = 428

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 88/187 (47%), Gaps = 29/187 (15%)

Query: 144 KNKKEYAVKIYK---TSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKR 200
           KN  E  +KI++   TS    ++   Y+      +NS++  N   + K+ A KE++ +  
Sbjct: 115 KNGVEKVMKIHRLGRTSFHTVRNNRDYLR-----KNSKNGANWMFLSKLAAAKEYQFMSL 169

Query: 201 IYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPYKDREEIKHYYNLMIAYMRL 260
           ++  G    P+P +   ++++ME +    GF   RL+ H    +   K Y +LM   + L
Sbjct: 170 LHSRG-FRVPEPFDHSRHIIIMELIK---GFPMTRLRKH----QNVPKLYSDLMKFILEL 221

Query: 261 LYQVCRLVHADLSEYNSIVHEDKL----------YIIDVSQSVQPEHPMSLDFLRMDIKN 310
                 L+H D +E+N ++ +DKL           +ID  Q +  +H  +  + + D+  
Sbjct: 222 --GNSGLIHCDFNEFNIMI-KDKLDGSDPNDTGFIVIDFPQCISIQHQDASFYFQRDVDC 278

Query: 311 VNSYFQK 317
           +  +F+K
Sbjct: 279 IRRFFKK 285

>ABL166W Chr2 (88546..89790) [1245 bp, 414 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL207W (RIO2)
          Length = 414

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/143 (23%), Positives = 66/143 (46%), Gaps = 17/143 (11%)

Query: 182 NPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPY 241
           N  ++  + AE+E+  +  +Y  G    PKP     + +VME++    G+   RL+ H  
Sbjct: 149 NWMRLSHLSAEREYAYMCLLYSKG-FSVPKPYANSRHAIVMEYIR---GYPMRRLRSHS- 203

Query: 242 KDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHED-------KLYIIDVSQSVQ 294
                 K Y +LM   ++L      ++H D +E+N ++ +D          +ID  Q + 
Sbjct: 204 ---NVPKLYSDLMAFVVKLANH--GMIHCDFNEFNIMIKDDIDDPEDQGFVVIDFPQCIS 258

Query: 295 PEHPMSLDFLRMDIKNVNSYFQK 317
            +H  +  + + D+  +  +F+K
Sbjct: 259 IQHQEAEYYFKRDVDCIRRFFKK 281

>TDEL0A00860 Chr1 (143723..144982) [1260 bp, 419 aa] {ON} Anc_2.44
           YNL207W
          Length = 419

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 68/136 (50%), Gaps = 17/136 (12%)

Query: 189 IWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPYKDREEIK 248
           + A+KE++ +  +Y  G I  P+P +   ++++ME +   DGF    L++H        K
Sbjct: 157 LAAQKEYQFMSLLYSKGFI-VPQPYDNSRHIVLMELI---DGFPMRNLRNHS----NIPK 208

Query: 249 HYYNLMIAYMRLLYQVCRLVHADLSEYNSIVH---EDK----LYIIDVSQSVQPEHPMSL 301
            Y +LM   ++L      L+H D +E+N ++    ED       +ID  Q +  +H  + 
Sbjct: 209 LYSDLMTFAVKLANS--GLIHCDFNEFNIMIKNTVEDSKDCGFVVIDFPQCISIQHKDAD 266

Query: 302 DFLRMDIKNVNSYFQK 317
            + + DI+ +  +F+K
Sbjct: 267 FYFQRDIECIRRFFRK 282

>Kpol_400.7 s400 complement(15841..17118) [1278 bp, 425 aa] {ON}
           complement(15841..17118) [1278 nt, 426 aa]
          Length = 425

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 50/259 (19%), Positives = 100/259 (38%), Gaps = 68/259 (26%)

Query: 66  LKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIESTKQKA 125
           LKS++N+  + +    +  GKE+++Y A   N E R + +     T              
Sbjct: 85  LKSLLNKDTVYSVGNTIGVGKESDIYQASDRNGEHRVMKIHRLGRT-------------- 130

Query: 126 LXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRK 185
                             KN ++Y  K  + +  +F  R                     
Sbjct: 131 -------------SFHTVKNNRDYLKKYNQGASWMFLSR--------------------- 156

Query: 186 MIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPYKDRE 245
              + A KE++ +  +Y  G    PK  +   +++VME +    GF   RL+ H     +
Sbjct: 157 ---VAANKEYQFMSLLYSKG-FTVPKAFDNSRHIVVMELIK---GFPLRRLRKH-----D 204

Query: 246 EIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDK-------LYIIDVSQSVQPEHP 298
            I   Y+ ++ ++  L     L+H D +E+N ++ ++K         +ID  Q +  +H 
Sbjct: 205 NIPKLYSDLMCFIVNLAN-SGLIHCDFNEFNIMIKDEKDDENDCGFIVIDFPQCISIQHK 263

Query: 299 MSLDFLRMDIKNVNSYFQK 317
            +  + + D+  +  +F+K
Sbjct: 264 DADFYFKRDVDCIRRFFKK 282

>SAKL0E13552g Chr5 complement(1118842..1120101) [1260 bp, 419 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability
          Length = 419

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/259 (18%), Positives = 99/259 (38%), Gaps = 69/259 (26%)

Query: 66  LKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIESTKQKA 125
           LK+M+NR  + +    +  GKE+++Y     N   R + +                    
Sbjct: 85  LKAMLNRDTVYSIGATIGVGKESDIYQVSDRNGNSRVMKIH------------------- 125

Query: 126 LXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRK 185
                                     ++ +TS    K+   Y+ G       R   +   
Sbjct: 126 --------------------------RLGRTSFQTVKNNRDYLKG-------RQSASWMF 152

Query: 186 MIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPYKDRE 245
           + ++ A KE++ +  +Y  G    P+P +   ++++ME +    G+   RL+ H     +
Sbjct: 153 LSRLAANKEYQFMSLLYSKG-FKVPEPFDNSRHIILMELIK---GYPMRRLRKH----HD 204

Query: 246 EIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHED-------KLYIIDVSQSVQPEHP 298
             K Y +LM   + L      L+H D +E+N ++ ++          +ID  Q +  +H 
Sbjct: 205 LPKLYSDLMCFIVNLANH--GLIHCDFNEFNIMIKDEVDDENDCGFVVIDFPQCISIQHK 262

Query: 299 MSLDFLRMDIKNVNSYFQK 317
            +  + + D+  +  +F+K
Sbjct: 263 DAEYYFQRDVDCIRRFFKK 281

>Ecym_6449 Chr6 complement(873295..874548) [1254 bp, 417 aa] {ON}
           similar to Ashbya gossypii ABL166W
          Length = 417

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 65/138 (47%), Gaps = 21/138 (15%)

Query: 189 IWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPYKDREEIK 248
           + A KE++ +  +Y  G    P+P +   ++++ME++    G+   RL++H        K
Sbjct: 156 LAANKEYQFMNLLYSKG-FKVPRPYDNSRHIILMEYIK---GYPMRRLREH--------K 203

Query: 249 HYYNLMIAYMRLLYQVCR--LVHADLSEYNSIVHEDK-------LYIIDVSQSVQPEHPM 299
               L    M+ + Q+    L+H D +E+N ++ +           +ID  Q +  +H  
Sbjct: 204 DLPRLYSELMKFIVQLGNHGLIHCDFNEFNIMIKDKTDGPDDLGFIVIDFPQCISIQHKD 263

Query: 300 SLDFLRMDIKNVNSYFQK 317
           +  + + D++ +  +F+K
Sbjct: 264 AEYYFQRDVECIRRFFKK 281

>ZYRO0C10340g Chr3 complement(793323..794573) [1251 bp, 416 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 416

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/152 (22%), Positives = 69/152 (45%), Gaps = 18/152 (11%)

Query: 174 FRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFAS 233
            ++SR   +   +  + A KE+  L  ++  G    P+  +   ++++MEF+    GF  
Sbjct: 142 LKHSRQGTSWMHLSLLAAHKEYEFLALLHSRG-FQVPEAFDNSRHMVLMEFIK---GFPM 197

Query: 234 PRLKDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHED--------KLY 285
             L+ H       I   Y+ ++ +   L +   L+H D +E+N ++ +            
Sbjct: 198 KNLRTH-----SNIPKLYSDLMKFAVDLAK-SGLIHCDYNEFNIMIKDQDTTDSSDCGFV 251

Query: 286 IIDVSQSVQPEHPMSLDFLRMDIKNVNSYFQK 317
           +ID  Q +  +HP +  F R DI+ +  +F+K
Sbjct: 252 VIDFPQCISIQHPDAEFFFRRDIECIRRFFKK 283

>KLTH0B07722g Chr2 complement(625231..626517) [1287 bp, 428 aa] {ON}
           similar to uniprot|P40160 Saccharomyces cerevisiae
           YNL207W RIO2 Protein required for cell viability
          Length = 428

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/137 (21%), Positives = 67/137 (48%), Gaps = 17/137 (12%)

Query: 188 KIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPYKDREEI 247
           ++ A KE++ +  ++  G    P+P +   ++++ME +   DG+    ++ H    +   
Sbjct: 155 RLAANKEYQFMSLLHSKG-FTVPEPFDNSRHMILMELI---DGYPMRNMRLH----KNLP 206

Query: 248 KHYYNLMIAYMRLLYQVCRLVHADLSEYNSIV-------HEDKLYIIDVSQSVQPEHPMS 300
           K Y +LM+  ++L      L+H D +E+N ++        ++   +ID  Q +  +H  +
Sbjct: 207 KLYSDLMLFIVKLANH--GLIHCDFNEFNIMIKNSVTGPEDNGFIVIDFPQCISIQHQDA 264

Query: 301 LDFLRMDIKNVNSYFQK 317
             F + D+  +  +F+K
Sbjct: 265 EFFFKRDVDCIRRFFKK 281

>KLLA0D19008g Chr4 complement(1598807..1600075) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P40160 YNL207W
           Saccharomyces cerevisiae RIO2 Protein required for cell
           viability,
          Length = 422

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 52/259 (20%), Positives = 101/259 (38%), Gaps = 69/259 (26%)

Query: 66  LKSMMNRGILSAFNGCLSTGKEANVYHAFAGNHEERHLLVEGHDDTIGAPQNIESTKQKA 125
           LKSM+NR  L +    +  GKE+++Y     + E + L +                    
Sbjct: 85  LKSMLNRDTLYSVGTTIGVGKESDIYQVSDRSGESKVLKIH------------------- 125

Query: 126 LXXXXXXXXXXXXXXXXPKNKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRK 185
                                     ++ +TS    K+   Y+      RN +S  +   
Sbjct: 126 --------------------------RLGRTSFHTIKNNRDYL------RNGQSA-SWMH 152

Query: 186 MIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPYKDRE 245
           + K+ A KE++ +  +Y       P+P +   + ++ME +    G+   RL  H    + 
Sbjct: 153 LSKLAANKEYQFMTMLYDRN-FEVPQPFDNSRHCVLMEHIR---GYPMRRLGKH----KN 204

Query: 246 EIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIV------HEDKLYI-IDVSQSVQPEHP 298
             K Y +LM   ++L      L+H D +E+N ++       +D  Y+ ID  Q +  +H 
Sbjct: 205 LPKLYSDLMCFIVKLANH--GLIHCDFNEFNIMIKDEPEGEDDPGYVVIDFPQCISIQHQ 262

Query: 299 MSLDFLRMDIKNVNSYFQK 317
            +  + + D+  +  +F+K
Sbjct: 263 DAAYYFKRDVDCIRRFFKK 281

>TBLA0G00370 Chr7 (72205..73539) [1335 bp, 444 aa] {ON} Anc_2.44
           YNL207W
          Length = 444

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/166 (19%), Positives = 72/166 (43%), Gaps = 31/166 (18%)

Query: 175 RNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASP 234
           +NS+   N   +  + A KE++ +  +Y S     PKP +   ++++ME +   +G+   
Sbjct: 144 KNSKIGTNWMVLSGLAALKEYQFMSILY-SNDFKVPKPFDNSRHIIIMELI---EGYPMR 199

Query: 235 RLKDHPYKDREEIKHYYNLMIAYMRLLYQVCRLVHADLSEYNSIVHEDK----------- 283
           RL+    K++ ++   YN ++ ++  L     L+H D +E+N ++ E             
Sbjct: 200 RLRS---KNQLKLAKLYNELMCFIVKLAD-HGLIHCDFNEFNIMIKEINNSNTDNNTTYT 255

Query: 284 ------------LYIIDVSQSVQPEHPMSLDFLRMDIKNVNSYFQK 317
                         +ID  Q +   H  +  + + D+  +  +F+K
Sbjct: 256 NKNKNSDDFDLDFTVIDFPQCISINHAYAEYYFKRDVDCIRRFFKK 301

>KLLA0F15576g Chr6 (1437595..1439133) [1539 bp, 512 aa] {ON} similar
           to uniprot|Q07950 Saccharomyces cerevisiae YLR020C YEH2
           Steryl ester hydrolase catalyzes steryl ester hydrolysis
           at the plasma membrane involved in sterol metabolism
          Length = 512

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 158 ILVFKDRE-RYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQSGVI 207
           IL+F  R+ R VDGE R  N    H P  + KIW   E+ +L  ++ S VI
Sbjct: 443 ILLFTPRQDRLVDGE-RLINHFINHEPHSVYKIWYIDEYSHLDVLWASDVI 492

>Ecym_1119 Chr1 complement(244327..246702) [2376 bp, 791 aa] {ON}
           similar to Ashbya gossypii AFR647C
          Length = 791

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/49 (26%), Positives = 32/49 (65%), Gaps = 3/49 (6%)

Query: 153 IYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRI 201
           +++T  + F+D++R+ +G    R   +QH+P +++K+    E+ ++KR+
Sbjct: 312 LFETKPMYFEDQKRFFNGVIEIR---TQHDPLELLKLCKRIEYEDMKRV 357

>Skud_2.377 Chr2 complement(676769..679978) [3210 bp, 1069 aa] {ON}
           YBR245C (REAL)
          Length = 1069

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 9/85 (10%)

Query: 17  DEHVNTQILERYANSIKTDELSLTRGKT-SKDKANRATVENVLDPRTMRFLKSMMNRGIL 75
           D  V  +ILER    ++ D+L + + +T SK K N+A  ++         L SM+  G  
Sbjct: 569 DNSVEEKILERATQKLRLDQLVIQQNRTSSKKKENKADSKDA--------LLSMIQHGAA 620

Query: 76  SAFNGCLSTGKEANVYHAFAGNHEE 100
             F    STG          G  +E
Sbjct: 621 DVFKSGTSTGSAGTPEPGSEGKGDE 645

>Kpol_1029.17 s1029 (32401..36405) [4005 bp, 1334 aa] {ON}
           (32401..36405) [4005 nt, 1335 aa]
          Length = 1334

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 201 IYQSGVIPCPKPIEVRSNVLVMEFLNRGDGFASPRLKDHPYKDREEIKHYYNLMIAYMRL 260
           I+ SG+I  P+ +E  +N++ +E  +R   FA   +  HP   +E    Y N MI Y  +
Sbjct: 314 IHDSGLIESPRTVEDDANIIDIESKSRYLNFAKTFISSHPTIAQE----YVNKMIMYPEM 369

>YBR245C Chr2 complement(708150..711539) [3390 bp, 1129 aa] {ON}
           ISW1ATPase subunit of imitation-switch (ISWI) class
           chromatin remodelers; ATPase; forms a complex with Ioc3p
           called Isw1a and a complex with Ioc2p and Ioc4p called
           Isw1b; Isw1a and Isw1b have both partially overlapping
           and distinct roles with Isw1a involved in repression of
           transcription initiation and Isw1b involved in
           regulation of transcription elongation
          Length = 1129

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 9/70 (12%)

Query: 17  DEHVNTQILERYANSIKTDELSLTRGKTS-KDKANRATVENVLDPRTMRFLKSMMNRGIL 75
           D  V  +ILER    ++ D+L + + +TS K K N+A  ++         L SM+  G  
Sbjct: 629 DNSVEEKILERATQKLRLDQLVIQQNRTSLKKKENKADSKDA--------LLSMIQHGAA 680

Query: 76  SAFNGCLSTG 85
             F    STG
Sbjct: 681 DVFKSGTSTG 690

>Kwal_33.13665 s33 complement(339375..345734) [6360 bp, 2119 aa]
           {ON} YCR032W (BPH1) - (putative) acetic acid export pump
           [contig 114] FULL
          Length = 2119

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 342 GDYRSSDDLETYVADNLPLKLTDEDEAED 370
           GD+  ++ +  YV D LP+K  D  EAED
Sbjct: 48  GDFLETNSISEYVYDQLPIKFADVGEAED 76

>Suva_4.505 Chr4 complement(879220..882429) [3210 bp, 1069 aa] {ON}
           YBR245C (REAL)
          Length = 1069

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 9/70 (12%)

Query: 17  DEHVNTQILERYANSIKTDELSLTRGKT-SKDKANRATVENVLDPRTMRFLKSMMNRGIL 75
           D  V  +ILER    ++ D+L + + +T SK K N+A  ++         L SM+  G  
Sbjct: 569 DNSVEEKILERATQKLRLDQLVIQQNRTSSKKKENKADSKDA--------LLSMIQHGAA 620

Query: 76  SAFNGCLSTG 85
             F    STG
Sbjct: 621 DVFKSGTSTG 630

>Kwal_27.11131 s27 (654646..657354) [2709 bp, 902 aa] {ON} YGL093W
           (SPC105) - component of spindle pole [contig 31] FULL
          Length = 902

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 7/90 (7%)

Query: 302 DFLRMDIKNVNSYFQKLGIDIFPERVIFQFIISEVLDKFKGDYRSSDDLETYVADNLPLK 361
           D  R +   VN+Y    G    P   I+ F   E+L + +   +   +LE  +A N P  
Sbjct: 479 DLERSEWPLVNAYTALYGD--MPVLEIYAFCCKELLKRIQRSRQLFKELEEQIALNPPPA 536

Query: 362 L-----TDEDEAEDEVFRSLHLIRNLGGLE 386
           L       E  A +E+ + LHLIR+   LE
Sbjct: 537 LYKMLTESESSASNELNQKLHLIRDFSRLE 566

>KLTH0B03432g Chr2 complement(277684..279213) [1530 bp, 509 aa] {ON}
           similar to uniprot|Q07950 Saccharomyces cerevisiae
           YLR020C YEH2 Steryl ester hydrolase catalyzes steryl
           ester hydrolysis at the plasma membrane involved in
           sterol metabolism
          Length = 509

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 4/77 (5%)

Query: 145 NKKEYAVKIYKTSILVFKDRERYVDGEFRFRNSRSQHNPRKMIKIWAEKEFRNLKRIYQS 204
           N+++     Y   ++    ++R VDGE R  N  +   P+ + KIW   E+ +L  ++  
Sbjct: 431 NQEKITTDEYPRILMFIPKQDRLVDGE-RLINHFTNCEPQSLYKIWYIDEYSHLDVLWSH 489

Query: 205 GVIP-CPKPI--EVRSN 218
            VI    KPI   +R+N
Sbjct: 490 DVIERVGKPILNTIRTN 506

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,224,921
Number of extensions: 2087035
Number of successful extensions: 6526
Number of sequences better than 10.0: 62
Number of HSP's gapped: 6677
Number of HSP's successfully gapped: 75
Length of query: 526
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 412
Effective length of database: 40,409,475
Effective search space: 16648703700
Effective search space used: 16648703700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)